Please wait - finding best movies...
Sir Robin of Locksley, defender of downtrodden Saxons, runs afoul of Norman authority and is forced to turn outlaw. With his band of Merry Men, he robs from the rich, gives to the poor and still has time to woo the lovely Maid Marian, and foil the cruel Sir Guy of Gisbourne, and keep the nefarious P …rince John off the throne. (Read More)
| Subgenre: | swashbucklerhistorical event |
| Themes: | justicetheftrobberyescapemurder |
| Mood: | poetic justice |
| Locations: | castleenglandforest |
| Characters: | thief herowarriortough guythiefmusiciansoldier |
| Story: | vigilante justicesword and shieldsword duelshot with a bow and arrowoutlaw ganginterrupted hangingsaved from hangingbow and arrowking of englandgentleman thiefriver battlesherwood forestnarrow escapesword fighthorse chase …knife fightthatched rooffire pitquill pen1190slongbowportcullisnormanquarterstaffbullseyeregentswordsmanshipplantagenetsaxonluteusurper12th centuryfriarpushed down stairsroastbritish royaltypiggy back ridemarksmanencampmentlancejewelswinkoutnumberedcartcoronationsteel helmetgallowsprocessionvineoathmacehorse and wagonbanquettargetmiddle agesvictorytrapdoorrevoltchainednoosebishoptavernhideouttreasonhistorical fictionvigilantismrobberswordsmanstick fightdaggerdictatorarrowcapturedeermedieval timesoutlawdrummerfight to the deathcrossbowshieldslavetournamentknightrebelspearfireplaceropeprincebattlefieldvigilantehanginglegendduelfictional warfishingdisarming someonetrialprisonerambushcandlegood versus evilcombatshowdownswordbattlerescuechaseknifedancing (See All) |
After being captured by Turks during the Crusades, Robin of Locksley and a Moor, Azeem, escape back to England, where Azeem vows to remain until he repays Robin for saving his life. Meanwhile, Robin's father, a nobleman loyal to King Richard the Lionhearted, has been murdered by the brutal Sheriff o …f Nottingham, who helped install Richard's treacherous brother, Prince John, as king while Richard is overseas fighting the Crusades. When Robin returns home, he vows to avenge his father's death and restore Richard to the throne. Even though Maid Marian, his childhood friend, cannot help him, he escapes to the Forest of Sherwood where he joins a band of exiled villagers and becomes their leader. With their help he attempts to cleanse the land of the evil that the Sheriff has spread. (Read More)
| Subgenre: | swashbucklersword and sorcery |
| Themes: | theftrobberyescapemurderfriendshippregnancytortureweddingmagiccourageprison escapemurder of father |
| Mood: | poetic justice |
| Locations: | castleenglandforestvillage |
| Characters: | warriorthiefsingerbabypriestaction herowitchcousin cousin relationshippregnant wifepoaching |
| Story: | sword and shieldsword duelshot with a bow and arrowoutlaw gangsaved from hangingbow and arrowking of englandriver battlesherwood forestsword fighthorse chase1190squarterstaffswordsmanshipplantagenet …12th centuryfriarmiddle ageshideoutrobberswordsmanstick fightdaggerarrowmedieval timesoutlawcrossbowknightrebelprincebattlefielddueldisarming someoneambushgood versus evilcombatshowdownswordrescueknifefemale nuditymale nuditymale rear nuditydogexplosionshowerfirefistfighthorseshot in the chestface slapshot in the headbare buttfalling from heightletterhand to hand combatrivershot in the backcleavagestabbingstabbed to deathstabbed in the chestkingdangerperson on fireattackpassionstatuekicked in the faceattempted rapedeath of brotherchildbirthloss of fatherarsongoldstabbed in the stomachtorchguardhit in the crotchrowboatstabbed in the legknife throwingraidsiegehorseback ridingwedding ceremonypeasantbreadshot with an arrowjerusalemarcheryadventure herofalling into watercrashing through a windowfriends who live togethersword and sandalbarbarianarchermiddle ageenglishmanfacial scarbutt slapwriting a letterman on fireforced marriagemasshalf brothermedallionbattle axecousinflaming arrowenglishwomanfall to deathkrav magawhite horsestained glass windowdevil worshipinterrupted weddinggunpowderstabbed with a swordmelonstabbed in the heartwind chimereturn homecatholic masskilled with a swordagainst the oddsballadeermistletoecrusadessitting in a treefacial cutdeath of cousincorrupt priestman murders a womanface woundfacial injurykneed in the crotchstabbed with a spearpublic hangingspitting in someone's faceblack horseblood oathmoorsthrown out a windowkilled with an arrownottingham englandhorseback chasehot candle waxmass hangingscars on backhiding in a treeantlerhit with a stickholding one's hand over someone's mouthvow of revengewoman slaps a womancut on faceoutdoor weddingdeer antlersheld at sword point1100senglish nobilityinability to swimreference to the prodigal sonvillage set on firepushed through a windowcan't swimcutting the palm of one's handdrum rollface scarsword held to throatunable to swimband of outlawsexploding barrelfather's gravemurder of cousinstolen horsedagger held to throatlife debtscimitarchildbirth complicationking richard ioutlaw hideoutstabbed with a dagger (See All) |
An imaginative Disney version of the Robin Hood legend. Fun and romance abound as the swashbuckling hero of Sherwood Forest and his valiant sidekick plot one daring adventure after another to outwit the greedy prince and his partner as they put the tax squeeze on the poor.
| Subgenre: | swashbuckler2d animationdisney |
| Themes: | theftrobberyfriendshipmoneytortureweddingheroexecutiongreed |
| Mood: | rain |
| Locations: | castleenglandforestchurch |
| Characters: | thief herowarriorthiefpriestaction herovillainsheriff |
| Story: | bow and arrowsherwood forestnarrow escapesword fightregentswordsmanshiplute12th centuryfriarmiddle agesrobberswordsmanstick fightarrowmedieval times …outlawtournamentrebelprincelegenddisarming someonegood versus evilcombatswordchasecharacter name in titledogkisstitle spoken by characterfireunderwearcatjailfoot chaseaxedisguisefootballsnakevoice overmissionrabbitpigchickenbearsleepingcross dressingarsonwolfballoontalking animalelephantmouseblockbusterfaked deathfalse identityanthropomorphismguardimaginationanthropomorphic animalhypnosisliondungeonturtleowlanimal name in titlevillain played by lead actorsidekickpeasantfoxcorporal punishmentcrocodilearcherysquirreladventure herosleeptyrantfriends who live togetherroosterarcherbowblacksmithanachronismraccoonvillain arrestedgender disguisevultureburning buildingcarriagechildhood sweetheartjail breakaxe fightrhinocerospuppet showcollisionreference to walt disneyhippopotamusexecutionerfurrycastle thunderanimal protagonistbadgerbased on legendtaxorphan boyplay fightanthropomorphic mousebadmintonbased on folk talewolf whistlelong swordstorkwooden swordends with a weddingthumb suckingminstreltax collectoraleanthropomorphic dogends with weddinganthropomorphic catanthropomorphic birdanthropomorphic bearanthropomorphic rabbitstorybook in opening shotanimal villainspiraling eyesanthropomorphic turtleanthropomorphic elephantanthropomorphic foxanthropomorphic pigprince john (See All) |
In this case, a group of archaeologists and combat experts led by Paul Walker and Frances O'Connor use a "3-D fax machine" (so much for technobabble!) to time-travel back to France in 1357, in hopes of retrieving Walker's father and returning safely to the present. No such luck! Fending for themselv …es against marauding hordes of medieval French warriors at war with the invading British, these semi-intrepid travelers find their body count rising, and the deadline for their return home is rapidly approaching. (Read More)
| Subgenre: | swashbucklercult filmfish out of watersword and fantasy |
| Themes: | escapemurderdeathlovefriendshiprevengesurrealismdrinkingherodeceptiontime travel |
| Locations: | castlehospitalmotorcycleairplanevillagefrancerooftoptunnelcave in |
| Characters: | warriortough guyfather son relationshippolicefrienddoctorteacherstudentpolicemanteacher student relationshipprofessor |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fightsteel helmetmacearrowcapturemedieval timesshieldknightspearbattlefieldduelfictional war …disarming someoneambushcombatshowdownswordbattlerescuebased on novelbloodviolenceone word titlekissfightexplosiontelephone callfirecell phonehorsecomputerdrinkfalling from heightbeerhand to hand combataxestabbingstabbed to deathstabbed in the cheststabbed in the backlocker roomstatueopening action scenehorse ridingsubtitled scenearsoneyeglassesgrenadebeer drinkinghelmetmad scientisttorchcannonmobile phonesiegekingdomruinsmonasterytime machineshot with an arrowmarinearcheryarcheologyartifactreluctant herotour guidehistorianairfieldman on fireinfantrycavalryburning buildingscientific researchscottish accentarchaeologistwormholeflaming arrowbody armorcatapultswordplayaltering historyarcheological digprototypesecret experimentcarvingmagelucky charmelectro shock1300ssecret lablost fatherhundred years warancient swordtrebuchetexperiment on oneselffemale archaeologistmedieval francesilver city new mexico (See All) |
Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.
| Subgenre: | swashbucklermartial artssword and sorcerysword and fantasy |
| Themes: | escapemurdermarriagebetrayalherodeath of fathertime travel |
| Locations: | snowdesert |
| Characters: | warriortough guysoldieraction hero |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fightregentswordsmandaggercrossbowshieldprincefictional warambushgood versus evilcombatshowdown …swordbattlechaseviolenceflashbackkisstitle spoken by characterexplosionhorsehand to hand combatkung fufoot chaseorphanassassinaxemountainarmycolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armykingprincesson the runone against manyfugitivebrotherstylized violencestrong female characterdestinycountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footagesandseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomblack magicframed for murderunclepalaceparkourfortresssorcereradopted sonmacguffinrobesword fightingsword and sandaltitle in titleempirecorrupt officialsubterraneanarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherprince of persiabrother brother hugbrother betrays brother (See All) |
Robin of Locksley, known as the most skilled archer of the land, has just returned to England after fighting in the Holy Crusades, where King Richard the Lionhearted is also fighting. Robin finds that much of what he knew of England has gone to ruin, including his longtime family home having been ta …ken away, all at the hands of the evil Prince John, Richard's brother who has assumed the throne in Richard's absence. Neurotic John is basically being controlled by the equally evil Sheriff of Rottingham, everything they doing to fatten their own coffers at the expense of the commoners and peasants. As such, Robin recruits a band of merry men to help him battle Prince John and the Sheriff, they who include: Blinkin, his blind longtime servant; Ahchoo, the misguided son of Asneeze, the man who helped him escape from prison while fighting in the Crusades; Little John, who seems to think that being called Little is only coincidental to the fact of he being a hulking man; and Little John's friend, Will Scarlet O'Hara, a master with daggers. In going to the palace, Robin falls in love at first sight with Marian of Bagelle, a maid of the court. Marian is looking for the man who has the figurative and literal key to unlock her heart (and more private parts). The Sheriff has his own eyes on Marian, he who in turn is the object of desire of Latrine, a powerful hag of a sorceress of the court. Robin and the Sheriff in particular have a fight to the death mentality to achieve their end goals… (Read More)
| Subgenre: | swashbucklercult filmslapstick comedy |
| Themes: | escapeweddinggangsterheroblindnessescape from prison |
| Mood: | spoofparodybreaking the fourth wall |
| Locations: | castleenglandforestsinging in a bathtub |
| Characters: | thief herowarriortough guythiefafrican americansingeraction herohitmansniperwitchsheriffself referential |
| Story: | sword duelshot with a bow and arrowsaved from hangingbow and arrowsword fightknife fight1190sportcullisquarterstaff12th centuryfriarlancenooseswordsmanstick fight …daggerarrowmedieval timescrossbowknightspearprincebattlefielddisarming someoneambushcombatshowdownswordbattlecharacter name in titlefighttitle spoken by characterpartysurprise endingfirefistfighthorseface slappunched in the facebrawlfalling from heighthand to hand combatfightingcleavagewomanbridgestabbed in the chestkingtalking to the cameratrainingcharacter repeating someone else's dialoguevirginkaratewritten and directed by cast membercharacter's point of view camera shotopening action scenescene during end creditscontestcharacter says i love youobscene finger gesturecult directorcross dressingsubtitled sceneredheadarsonscene during opening creditsservantguardabsurd humorremote controlplayboy magazinedual wieldhit in the crotchlove at first sighttitle appears in writingpsychotronicdungeonsexy womanknife throwingraised middle fingerblind manwoman in bathtubsidekickdirector cameosneakerstowerblack manlizardshot with an arrowjerusalemarcheryadventure herorabbicameo appearancefriends who live togetherarcherbriton abroaddeath of familymimereference to abraham lincolnmoleanachronismhouse on firefairguillotineman in dragman dressed as womansevered earflaming arrowsong and dancecomic herocomic violencecatapultfake beardblowing a kisstrailer narrated by percy rodriguezspeech impedimenttaxestightsreference to mark twainchastity beltballadeerupside down camera shotlong swordhangmanmovie reality crossoverjewish stereotypesinger offscreenminstrelmusical sequence in non musical workmale slaps a malerunning into a treecardboard cut outreference to larry kingmedium breasts (See All) |
Birth of a legend. Following King Richard's death in France, archer Robin Longstride, along with Will Scarlett, Alan-a-Dale and Little John, returns to England. They encounter the dying Robert of Locksley, whose party was ambushed by treacherous Godfrey, who hopes to facilitate a French invasion of …England. Robin promises the dying knight he will return his sword to his father Walter in Nottingham. Here Walter encourages him to impersonate the dead man to prevent his land being confiscated by the crown, and he finds himself with Marian, a ready-made wife. Hoping to stir baronial opposition to weak King John and allow an easy French take-over, Godfrey worms his way into the king's service as Earl Marshal of England and brutally invades towns under the pretext of collecting Royal taxes. Can Robin navigate the politics of barons, royals, traitors, and the French? (Read More)
| Subgenre: | epic |
| Themes: | murderdeathrevengepoliticsfuneralgamblingblindness |
| Mood: | rain |
| Locations: | castleenglandforestbeachchurchlondon englandvillagefranceship |
| Characters: | warriortough guysoldiermother son relationshipaction herosheriffyounger version of characterfrench girl |
| Story: | sword and shieldsword duelbow and arrowking of englandsword fight1190s12th centuryfriarbritish royaltyswordsmanstick fightdaggerarrowmedieval timesoutlaw …crossbowshieldknightfireplacebattlefieldlegenddisarming someoneambushcombatswordbattledancingcharacter name in titlebloodviolenceflashbackmale rear nuditydogtwo word titlebare chested malekissexplosionsingingsurprise endingfirevoice over narrationshot to deathblood splatterfistfighthorseshot in the chestface slapshot in the headslow motion scenepunched in the facebrawlfalling from heighthand to hand combatshot in the backdecapitationaxearmyimpalementstabbed to deathstabbed in the chestmapno opening creditskingshot in the legstabbed in the backperson on firekicked in the facetough girlringattempted rapedeath of brotherdeath of sondeath of husbandcharacter says i love youkissing while having sexqueensubtitled scenetraitorloyaltyburned alivehead buttcaught having sexkicked in the stomachtorchcrushed to deathbald maninvasionchaosshot in the facerowboattitle at the endsiegeblind manowlprequelpalacehorseback ridinginterrupted sexshot in the neckwar violencereading aloudbeeshot with an arrowcrownadventure herodomineering motherfilm starts with textshot in the throatarcherenglishmanfacial scarfrenchmanoverbearing motherwoman slaps a manunwanted kissstaffdying wordsscottish accentfather in law daughter in law relationshipfather in lawpoacherbegins with textaxe fightscotsmanflaming arrowenglishwomanfuneral pyreoystershot in the sidewhite horsestabbed with a swordenglish subtitles in originalfrenchwomanwelshmanproduced by actortaxcrown princekilled with a swordsign of the crossdaughter in lawmurdered priestbeekeeperends with narrationgrainsham marriagemother son conflictblind personferal childcrusadeface woundfacial injuryking of francechain mailbill of rightsdragged by a horsekilled with an arrowmother slaps sonnottingham englandposing as husband and wifebody odorirish wolfhoundaxe in the backburning a documentelbowed in faceshell gamespoiled sonthrowing water on someoneinscriptiondeath of father in lawfemale slaps a malepretending to be marriedenglish nobilityreference to the prodigal sonface scararrow through neckdeath of a kingassuming identity of a dead personblind person reads a facedonkey cartking richard iprince johnstabbed with a daggertrampled by a horseunpaid taxes (See All) |
A 14th century Crusader returns to a homeland devastated by the Black Plague. A beleaguered church, deeming sorcery the culprit of the plague, commands the two knights to transport an accused witch to a remote abbey, where monks will perform a ritual in hopes of ending the pestilence. A priest, a gr …ieving knight, a disgraced itinerant and a headstrong youth who can only dream of becoming a knight join a mission troubled by mythically hostile wilderness and fierce contention over the fate of the girl. When the embattled party arrives at the abbey, a horrific discovery jeopardises the knight's pledge to ensure the girl fair treatment, and pits them against an inexplicably powerful and destructive force. (Read More)
| Subgenre: | suspensesword and sorceryb horrorsword and fantasygothic horror |
| Themes: | religionherodeception |
| Locations: | castlechurchcatholic church |
| Characters: | warriortough guysoldierpriestwitchcatholic priestself flagellationreligious ritual |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fightmacemiddle agesswordsmandaggermedieval timesshieldknightbattlefieldhangingfictional wardisarming someone …ambushcombatshowdownswordbattleknifebloodfightblood splatterhorsekissinghand to hand combatdemonprayerfightingmassacremapritualconfessioncursewolfcrucifixwitchcraftmonkanimal attackbelief in godsnowingmonasterywoman cryingplagueadventure herosword and sandaldisillusionmentinfantrymass gravecavalryaxe fightbattle axeshacklescardinal the priestlord's prayertelling a jokestabbed with a swordbattering ramrope bridgebelief in hellexecution by hangingrotting corpse14th centurypossessed girlcrusadercrusade1300sstabbed with a spearbegging for mercybelief in witchessuspected witch (See All) |
Lancelot lives by the sword. In fact, they're next door neighbours, so teaming up to fight for money comes pretty naturally. Lady Guinevere, on her way to marry King Arthur is ambushed by the evil Sir Malagant. Fortunately Lancelot is lurking nearby and he rescues his future queen. They fall in love …, but Guinevere still fancies the idea of wearing a crown, so she honours her promise to Arthur. Can Lady Guinevere remain faithful, or will this Pretty Woman become a lady of the knight? (Read More)
| Subgenre: | martial artssword and sorcery |
| Themes: | murderkidnappingmarriageadulteryweddingfuneralhero |
| Locations: | villagecave |
| Characters: | warriorhusband wife relationshiplove triangledeath of hero |
| Story: | sword and shieldsword duelsword fighthorse chasemiddle agesswordsmanmedieval timescrossbowshieldknightbattlefieldlegendfictional wardisarming someoneambush …combatshowdownswordbattlenumber in titleflashbacktwo word titletitle spoken by charactershot in the chesthand to hand combatmenage a troiskingopening action scenewaterfallqueenarsonlawtorcharmorraidpassionate kisshorse and carriagemain character diesage differencecremationstandoffshot with an arrowadventure herobarbarianmain character shotstafflast standbattle axeflaming arrowobstacle courseking arthurcamelotexcaliburarthurian legendmace the weaponends with funeralknights of the round tableoubliette (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | robberyescapemurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearfuneralmonster …deceptionmagicangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | castleenglandforestboatlondon englandwatervillagewoodslakeshipcavebrothelsewer |
| Characters: | warriortough guythiefsoldierhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutehostageaction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | bow and arrowcoronationmiddle agestavernhistorical fictionswordsmanmedieval timesoutlawshieldslaveknightrebelspearbattlefieldlegend …fictional wardisarming someoneprisonerambushcandlegood versus evilcombatshowdownswordbattlerescuechaseknifecharacter name in titlebloodviolenceflashbackdogbare chested malefighttitle spoken by characterexplosionsurprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headslow motion scenepunched in the facewritten by directorbrawlfalling from heighthand to hand combatinterrogationdemonprostitutionbritishislandriverfightingshot in the backsubjective cameradecapitationspyfoot chaseorphangangstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestmapsnakenonlinear timelinesevered headanti heroone man armychild in perilritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionburned alivehead buttassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpooljumping from heightrebellionmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked maneaten aliveguarddwarfreverse footagecameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heroaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressiondirector cameoface maskfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcererbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastsubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
| Subgenre: | martial artssword and sorceryalternate historysword and fantasy |
| Themes: | escapemurderdeathrevengesuicidekidnappingjealousypregnancytortureheromagicdeath of fatherbrutalitysupernatural powerdeath of mother …crueltydeath of wifevengeancedeath of daughtermurder of fatherdeath in childbirth (See All) |
| Mood: | gore |
| Locations: | castlesnowboatwoodscampfirewalled city |
| Characters: | warriortough guythiefsoldierhusband wife relationshipfather son relationshipfather daughter relationshipboyaction herowitchsingle fatheryounger version of characterdancing girl |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fighthorse chasechainedtavernswordsmanstick fightdaggercaptureslavespearbattlefieldfictional war …disarming someoneambushgood versus evilcombatshowdownswordbattlerescuechaseknifefemale nuditycharacter name in titlebloodmale nudityviolenceflashbackbare chested malesex scenefightexplosionthree word titlefireshot to deathblood splatterfistfighthorseshot in the chestremakeshot in the headslow motion scenefalling from heightmaskbased on comichand to hand combatinterrogationdemonfightingshot in the backdecapitationfoot chaseassassinbound and gaggedbased on comic bookname in titleaxemassacremountaindisguisethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headnunno opening creditsanti heroone man armychild in perilritualunderwater scenekingcreatureshot in the legprincessdrowningone against manybeaten to deathstabbed in the backkeyperson on fireattackevil mankicked in the facetough girlscarchildbirthexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarywaterfallsevered armfreeze framesingle parenthenchmanpirateburned alivekilling an animalhead buttassassination attempteggcatfightslaverymutilationkicked in the stomachjumping from heightmonkanimal attackgoatinterracial friendshipcrushed to deathback from the deadcelebrationfemale warriordamsel in distressadventurerdual wield3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdark herodungeondisfigurementeye patchpassionate kissdemonic possessionblack magicburned to deathpipe smokingpalacedriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationshot with an arrowmegalomaniacadventure herosorcerertentacletestcrushed headsword fightingsword and sandalslingshothammockbarbarianprehistoric timesarcherfacial scarrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipstarts with narrationwagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallwarrior womanmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All) |
It is the year 1215 and the rebel barons of England have forced their despised King John to put his royal seal to the Magna Carta, a noble, seminal document that upheld the rights of free-men. Yet within months of pledging himself to the great charter, the King reneged on his word and assembled a me …rcenary army on the south coast of England with the intention of bringing the barons and the country back under his tyrannical rule. Barring his way stood the mighty Rochester castle, a place that would become the symbol of the rebel's momentous struggle for justice and freedom. (Read More)
| Subgenre: | swashbucklerindependent filmmartial arts |
| Themes: | justicetheftsuicidetortureseductionbrutalitysadismexecutioncrueltystarvation |
| Mood: | gore |
| Locations: | castleenglandbrothel |
| Characters: | warriorprostitutebullysuicide by hanging |
| Story: | sword and shieldsword duelshot with a bow and arrowbow and arrowsword fightquill penportcullisplantagenetsteel helmetmacemiddle agesswordsmanarrowmedieval timesshield …knightrebelspearhangingbattlefemale nuditybloodviolenceone word titlebare chested maleblood splatterfistfighthand to hand combatprayerdecapitationaxemassacrestabbed to deathmixed martial artskingstabbed in the backprologueevil manpigmercenarysevered armdismembermentwoundmutilationmale bondingdysfunctional marriagesevered handclubarranged marriageblood on faceunfaithful wifestabbed in the neckhungerstabbed in the headfogarmorkingdomdead woman with eyes openfinal showdowncockroachcorporal punishmentshot with an arrowanimal crueltyadventure heroamputationepilogueilliteracyhead cut offstabbed in the shoulderchapelarcherstabbed in the facearm cut offinfantryscoldingimplied sexcavalrysevered footstarvingloveless marriagewoman initiating sexstabbed in the mouthstabbed multiple timesbattle axewine drinkingcut armsliced in twohand cut offnobilityrainy nightbaroncatapultwhite horsedead prostituteswordplaybattering ramspear throwingsingle locationstocksman and woman in bedstealing foodpeachevil kingleg cut offsplit in twoarchbishopcavalry chargecrusaderlong swordarm woundpaying for sexknights templargangrene13th centurychain mailmultiple stabbingsdragged by a horsetwo on a horsetemplar knightabbotvow of silencedeath by swordcauterizationneck slashingeating insectholding someone's head underwaterstabbed through the mouthswordsmenknight templartrebuchetcauterizing a woundeating an insectunconsummated marriagedunking head in waterstabbed with swordvow of chastitycg effectscutting out tonguekilling a pigsword held to throatamputated handarrow in the backlifting up a dresspulling up skirthead sliced in twohead split in twoman cut in halfomnipotent narratorstabbed in neck1210saxe in the shoulderhead cut in twoscaling ladderspear in chestthrowing an axe (See All) |
An affair between the second in line to Britain's throne and the princess of the feuding Irish spells doom for the young lovers.
| Subgenre: | tragedy |
| Themes: | escapemurderdeathrevengemarriageinfidelityrapebetrayaladulterydanceweddingfuneralextramarital affairdeath of fatherbrutality …death of motherguiltunfaithfulnessrivalrygreeddeath of wifehuntingmurder of family (See All) |
| Mood: | rainnightmare |
| Locations: | castleforestbeachchurchboatvillagewoodsseatunnelboat on fire |
| Characters: | warriorsoldierfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboybrother sister relationshipgirldancerpriestlove trianglelust |
| Story: | sword and shieldbow and arrowsword fightsaxonlutecoronationhorse and wagontrapdoorhistorical fictiondaggercapturemedieval timesknightbattlefieldhanging …legendambushcombatswordbattledancingfemale nuditycharacter name in titlebloodmale nudityviolencebare chested malekissfightthree word titlefirepunctuation in titlewoman on topdreamhorseblondeliehand to hand combatrunningriverdecapitationorphandisguisemontagemapsevered headkingprincessflash forwardattackliarpoisonpassionrabbitbraceletdeath of husbandirelandlove interestkissing while having sexbare chested male bondagequeenpowerchild murdertraitorwounddemonstrationhuntersevered handirishforbidden lovehonorback from the deadambitionstabbed in the throatkickingmercilessnesskicked in the crotchrowboattribepassionate kissaxe murderkingdomhorseback ridingbandagewar violencetowerblonde womansailboatcrownsword and sandaldisembodied headstar crossed loverstragic lovemilitary traininganguishman on firerise and fallthroneblasphemydying wordscryptmedievalchantingstreet vendorantidotefeastaxe fightbattle axelong blonde hairlordflaming arrowbaronfuneral pyreruinhanged boypageantcornwallhand chopped offspit in facedrawbridgeelixirlong sworddark agesjoustingtreatythrown from a horseyorkpyrerebuildingplus sign in titlefuneral cortegecelthuman in a cagebetrothaldeath of queenpuffer fish6th centurythought deadunderground passagewaybritanniaviking funeralsword woundburning a corpsenursing someone back to healthburned out houseroman ruin (See All) |
| Subgenre: | martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale |
| Themes: | escapemurderdeathloverevengesurrealismkidnappingmarriagebetrayalfearmonsterherodeceptionmagicanger …obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All) |
| Locations: | castleforestchurchsnowvillagewoodscampfire |
| Characters: | warriortough guythiefsoldierbabyhostagesister sister relationshipaction herolittle girllittle boy |
| Story: | bow and arrowsword fightknife fightcoronationtavernstick fightdeerfight to the deathcrossbowshieldspearfireplacebattlefieldfictional wardisarming someone …ambushcandlegood versus evilcombatshowdownswordbattlerescuechaseknifecharacter name in titlebloodviolencesequelflashbackbare chested malekissfightexplosionsurprise endingvoice over narrationbeatingcorpsefistfighthorsemirrorshot in the chestface slapshot in the headslow motion scenepunched in the facebrawlhand to hand combatsecond parthallucinationriversubjective cameraorphanaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herobirdone man armychild in perildouble crosskingcreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeypowerstylized violencechessiceeavesdroppingtraitorgoldwolfburned aliverevelationhead buttassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footagediamondvisiontarget practicebraveryfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotpassionate kisskingdomblack magicburned to deathowltelekinesisprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackernarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
When a mercenary warrior (Matt Damon) is imprisoned within the Great Wall, he discovers the mystery behind one of the greatest wonders of the world. As wave after wave of marauding beasts besiege the massive structure, his quest for fortune turns into a journey toward heroism as he joins a huge army … of elite warriors to confront the unimaginable and seemingly unstoppable force. (Read More)
| Subgenre: | heistfish out of watercreature featureperiod dramaperiod piecedark fantasyalternate historysword and fantasymonster movielive action and animation |
| Themes: | robberyescapemurderdeathfriendshipsurrealismbetrayalprisonfearfuneralmonsterdeceptionparanoiaredemptiongreed …paniccourageself sacrificenear death experience (See All) |
| Mood: | poetic justice |
| Locations: | churchdesertrooftopcavechinacampfiretunnelsewer |
| Characters: | warriortough guythiefsoldierteacheraction herointerracial relationshipchinesealien monster |
| Period: | 15th centuryzip line |
| Story: | bow and arrowhorse chasebanquetmiddle ageshistorical fictioncapturemedieval timescrossbowshieldspearbattlefieldfictional wardisarming someoneprisonerambush …good versus evilcombatshowdownswordbattlerescuechaseknifeviolenceexplosionthree word titlesurprise endingfirecorpseblood splatterhorseshot in the chestslow motion scenearrestfalling from heightbombdecapitationorphanbound and gaggedaxemassacremountainarmyimpalementstabbed to deathmapsevered headno opening creditsanti herodouble crosscontroversycreatureshot in the legcharacter repeating someone else's dialoguedangerattackstatueknocked outopening action sceneexploding bodysuspicionthreatened with a knifemercenarysevered armgeneralqueensubtitled scenetruststylized violenceshavinggrenadedestructionburned alivecagehelmetjail cellcaptivetemplebeardjumping from heightsevered handirishculture clashhonortorchcannoneaten aliveguardrampagetarget practiceexplosivebraveryinvasiondual wieldanimated sequencepartner3 dimensionalchaosevacuationescape attempt3ddark herodynamiteaerial shotdungeontribesiegestabbed in the eyedark pastkingdomtragic heroburned to deathpalacebullet timeimprisonmentrockettorso cut in halfheroismbanditfemale soldiertranslatorblood on camera lensflagfinal showdowntowergiant monsterfireballstonetwo man armyshot with an arrowarcherywallemperorcommanderdrumfilm starts with textcrash landingoffscreen killingcrashing through a windowmacguffinpotionmale protagonistacrobatfinal battlegurneybritish soldiermeteorarcherhot air balloontragic pastdistrustpsychotronic filmcavalryarmoryacrobaticsthronealien creaturenomadmedallionscrollhands tiedsuit of armorspaniardstudio logo segues into filmkaijumagnetnunchucksharpoongiant creaturecatapultcouncilgunpowdercaught in a netstampedespear throwinggreen bloodspear gunbowlswarmancient chinabackflipgreat wall of chinacannonballstore roomdining roombungee jumpchinese armyaxe throwinghordeman with a ponytailtunic11th centuryburning bodyengine roomsecret military operationstabbed through the mouthhiveopening creditsenvoygreat wallwhite saviorchinese lanternwall of firesleeping potion (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
| Subgenre: | martial artscult filmtragedysword and sorceryepicsword and fantasy |
| Themes: | escapemurderdeathlovefriendshiprevengekidnappingpregnancytortureweddingmonsterherodeceptionmagicmemory …death of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeancecourage (See All) |
| Mood: | rain |
| Locations: | castleforestvillagewoodsfarmlake |
| Characters: | warriortough guysoldierfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipaction herovillainuncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All) |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fighthorse and wagondaggercapturemedieval timesslavespearbattlefieldhangingduelfictional wardisarming someone …prisonercandlegood versus evilcombatshowdownswordbattlerescuechaseknifebloodviolenceflashbackkissfightexplosionfirecryingblood splatterfoodhorseslow motion scenefalling from heightbooktearshand to hand combatrunningneighborsubjective camerasurvivalwineaxemassacremountainstabbingthroat slittingbridgeeatingarmymixed martial artsmapkingprincessnecklacegravelibraryattackpoisonninjapassionreadinglightningfarmerpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralchild murderdestinymachetecaptivestabbed in the stomachwitchcraftgenocidehonorburialpresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardpridedungeonarmorraidsiegelieutenantkingdomblack magictelekinesissmokeimprisonmentcrowheroismpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downsorcererfantasy worldsword and sandalheirclimbing a treetitle in titleflamearcherdeath of grandmotherfacial scarsorceryman on firedeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
When a magic scepter accidentally transports April back through time to 17th Century Japan, the boys take-off in hot pursuit, cowabungling their way out of the sewers right into Samurai-O-Rama! Now they must battle the evil Lord Norinaga to reclaim the magic scepter that will bring them back below t …he subways of New York City. (Read More)
| Subgenre: | independent filmmartial artscult filmsuperhero |
| Themes: | surrealismheromagictime travelsamurai |
| Mood: | poetic justice |
| Locations: | japansewer |
| Characters: | warriortough guyteenageraction herosamurai sword |
| Period: | 1900s1600s |
| Story: | vigilante justicesword duelshot with a bow and arrowbow and arrowsword fighthorse chasestick fightspearbattlefieldvigilantefictional wardisarming someoneambushcombatbattle …chaseviolencesequelfightexplosionfirefistfighthorsebrawlhand to hand combatfightingkung fubased on comic bookvoice overthird partfive word titleninjatough girlopening action scenemartial artistmercenaryarsonpizzamartial arts masterelectronic music scoreheroineslow motiontalking animallifting someone into the airroman numeral in titlepart of trilogyaction heroinechop sockycannonkatana sworddual wieldanthropomorphic animalturtlearmorsequel to cult favoritekung fu fightingkung fu classicfemale fighterninjitsuunsubtitled foreign languagemusketroman numbered sequelwarlordbo staffcavalryliquidanimal that acts humanflintlock rifleflintlock pistolnunchuckslifting male in airreference to clint eastwoodfurryhockey stickteenage mutant ninja turtlesfeudal japanmusketeersaininja turtlemirage comicslampshade (See All) |
In AD 922, Arab courtier Ahmad Ibn Fadlan accompanies a party of Vikings to the barbaric North. Ibn Fadlan is appalled by the Vikings customs-- their wanton sexuality, their disregard for cleanliness, their cold-blooded human sacrifices. And then he learns the horrifying truth: he has been enlisted …to combat a terror that slaughters the Vikings and devours their flesh. (Read More)
| Subgenre: | swashbucklercult filmsword and sorceryepicfish out of waterrevisioniststonepunk |
| Themes: | murderdeathlovereligiondrinkingfearfuneraldeceptiontravelsupernatural powercannibalismmurder of brothernorse mythology |
| Mood: | gorerain |
| Locations: | forestboatwoodscavecampfire |
| Characters: | warriorfamily relationshipsfather son relationshipmother son relationshiptattooboyreference to godfacial tattoo |
| Story: | sword and shieldshot with a bow and arrowbow and arrowsword fightmiddle agesdaggershieldspearprincebattlefieldhanginglegendfictional wargood versus evilcombat …swordbattlebased on novelnumber in titlebloodviolencedogfightthree word titlefirevoice over narrationcorpsehorsedrinkvomitinghand to hand combatdead bodydemonswimmingaxesnakesevered headunderwater scenekingcreaturepoisonmissiontentdeath of brotherhorse ridingwaterfallsevered armpoetbearsleepingcowdismembermenthelmetmutilationsevered handskulltorchinvasioncannibalexilearabeye patchkingdomfortune tellerfast motion scenecameltranslatorprayinggreekcremationalarmvikingdigginglanguage barrierambassadorrespectsword and sandalheirperfumebarbarianfacial scarprophetdiplomatfleeingretreatbanishmentnoblemanflaming arrowhoneybonesadaptation directed by original authorreference to allahangel of deathgonghordemarauderancient times10th centurybeowulfends with funeralirish wolfhoundvisceralcannibal cultflying debrisviking shipodinviking funeralblowing one's nosemohammadvalhallapaupercaliphwashing one's handsarabian horseseastorm (See All) |
The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E …ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)
| Subgenre: | swashbucklermartial artscult filmsword and sorceryepicsword and fantasy |
| Themes: | monsterheromagiccouragemythology |
| Locations: | castle |
| Characters: | warriortough guysoldier |
| Story: | sword duelshot with a bow and arrowbow and arrowstick fightdaggerknightspearbattlefieldduelfictional wardisarming someoneambushgood versus evilcombatsword …battlecharacter name in titlebased on novelone word titlefightbased on bookhorsesecrethand to hand combatdemonfightingsubjective cameradeath of friendmixed martial artskingdragonegghunterdwarfwizardsiegekingdomtragic heroelfheroismadventure herofantasy worldsword fightingsword and sandalopen endedchosen onestaffteenage herofictional countrybattle axeteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All) |
While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga …to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)
| Subgenre: | conspiracytragedysword and sorceryepicdark fantasysword and fantasy |
| Themes: | escapemurderdeathrevengesurrealismsuicidekidnappingghostweddingmonsterdeceptionmagicdeath of fathersupernatural powerredemption …unrequited lovesamurairitual suicide (See All) |
| Locations: | castleforestsnowcemeteryvillagewoodsjapanlakeshipcampfire |
| Characters: | warriortough guysoldierhusband wife relationshipfather son relationshipfather daughter relationshiphostageaction heroteacher student relationshipwitchself mutilationsamurai swordhuman versus monstersamurai warriorhunting party |
| Story: | sword duelbow and arrowsword fighthistorical fictionfight to the deathcrossbowslavetournamentspearbattlefieldlegendambushcandlecombatshowdown …swordbattlerescuechaseknifenumber in titlebloodviolenceflashbackbare chested maletitle spoken by characterexplosionsurprise endingbased on true storyfirebeatingcorpsedigit in titleshot to deathblood splatterhorseshot in the chestshot in the headdemonshot in the backdecapitationfoot chaseorphanaxemassacremountaindisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacestabbed in the backprologueperson on fireattackpoisondragonmanipulationexploding bodyneck breakingtraploss of fatherdirectorial debutshot in the armbare chested male bondagestylized violenceburned aliveheavy raintempleexploding buildingwitchcraftspidervillainessgiantforbidden lovecgihonorburialpresumed deadguardarranged marriagestabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingtragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offarchermusketshape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All) |
The three best of the disbanded Musketeers - Athos, Porthos, and Aramis - join a young hotheaded would-be-Musketeer, D'Artagnan, to stop the Cardinal Richelieu's evil plot: to form an alliance with enemy England by way of the mysterious Milady. Rochefort, the Cardinal's right-hand man, announces the … official disbanding of the King's Musketeers. Three, however, refuse to throw down their swords - Athos the fighter and drinker, Porthos the pirate and lover, and Aramis the priest and poet. Arriving in Paris to join the Musketeers, D'Artagnan uncovers the Cardinal's plans, and the four set out on a mission to protect King and Country. (Read More)
| Subgenre: | swashbucklermartial artsdark comedybuddy comedy |
| Themes: | escapemurderdeathlovefriendshipsuicidekidnappingbetrayalpoliticsprisontorturedrunkennessherodeceptionseduction …couragerevolution (See All) |
| Locations: | castlebarparis francebathtubvillageshipprison fight |
| Characters: | warriorsoldierteenagerpriesthostageaction herohitmanwaitressbibleex husband ex wife relationship |
| Period: | 17th century1600s |
| Story: | sword duelsword fighthorse chasetreasonhistorical fictionswordsmandaggercaptureoutlawcrossbowfireplaceduelgood versus evilcombatshowdown …swordbattlerescuechaseknifebased on novelviolencebare chested maleguntitle spoken by characterexplosionpistolfireshootoutbeatingfistfighthorseshot in the chestblondepunched in the facegunfightbrawlfalling from heightrifleheld at gunpointkung fucleavagespyassassinwineaxedisguiseimpalementstabbed in the chestmapanti herodouble crosskingfemme fataledrowningtrainingmissionsensualitycountrysidethreatened with a knifemercenarywhippingqueenpiratetraitorfalling down stairsloyaltykilling an animalassassination attemptlifting someone into the aircaptivecrucifixhonortorchcannonguardstupiditytarget practicebuddydeath threatfirst kissdungeonbounty huntersiegeeye patchpassionate kisspigeonchallengefemale assassinflagshot with an arrowstabbed in the armfemale spyadventure herobayonetrobefemale villainwindmillmusketassassination plotteenage herosecret pastflintlock rifleflintlock pistolhorse drawn carriagebaroquescrollfalling off a cliffbrandingcardinal the priestmonarchybrandykicked in the chestgunpowderroyal courtstabbed with a bayonetcannonballcorrupt priestattempted seductionconcealed weaponinvincible henchmanoverhearingthree man armythree musketeerscalais francehollow bookheld at sword pointhigh treason (See All) |
In 19th century Qing Dynasty China, a warrior gives his sword, Green Destiny, to his lover to deliver to safe keeping, but it is stolen, and the chase is on to find it. The search leads to the House of Yu where the story takes on a whole different level.
| Subgenre: | martial artscult filmmelodramawuxia |
| Themes: | theftrobberyescapemurderdeathloverevengekidnappingbetrayalpoliticsweddingheroinvestigationdeceptionbrutality …unrequited lovevengeance (See All) |
| Mood: | ambiguous ending |
| Locations: | forestrestaurantdesertvillagewoodsrooftopcavechinarooftop chase |
| Characters: | warriortough guyfather daughter relationshippolice officerhostagesister sister relationshiplove triangleaction heroteacher student relationshipdaughterchinesedeath of hero |
| Period: | 18th century17th century |
| Story: | sword duelsword fightknife fighttavernhistorical fictionswordsmanoutlawspeardueldisarming someonecombatshowdownswordbattlerescue …chaseknifef ratedbased on novelbloodviolenceflashbackkissfightfingeringtitle spoken by charactersingingsurprise endingfistfighthorsepunched in the facebrawlhand to hand combatkung fufoot chasemountaindisguisebridgeimpalementfour word titlemixed martial artspoliticiannunno opening creditsunderwater scenepolice officer killedflash forwardone against manytreewidowerfugitivepoisonundercoverninjatentkicked in the facetough girlpursuitmartial artistloss of fatherpremarital sextied upfirst partunderwaterwaterfallmagical realismstylized violencerunawayfalling down stairsmartial arts masterflyingheroineheavy raincatfightkicked in the stomachvillainessservantjumping from heighthonormonkaction heroinebald manfemale warriorguardarranged marriagekatana swordintriguedual wieldmercilessnessmentorpunched in the chestdark herobathingdeceitundercover coptigermustachetragic heropolice inspectorsecret identitychallengemain character diesbanditkendoparalysismonasterylost lovegovernorforeplaydruggedfemale martial artistmacguffinresponsibilityfemale villaintragic pastwoman fights a mantied up while barefootaristocracybo staffbaldwanted posternew agewu shusecret lovebeijing chinamentor protege relationshipdojo19 year oldhorse drawn carriagemercywing chunantidotebuddhist monkwire fuman fights a womangovernessfemale ninjahouseguestfemale thiefprotegebambooolder woman younger woman relationshipbare midriffcalligraphywuxia fictionswordswomanabbeydowrycombmaster apprentice relationshippoison dartchopsticks the eating utensilunspoken lovebald herobelly buttonex lover ex lover relationshiphorseback chaseknife in shoeqing dynastybuddhist nunjumping from a bridgesheathmountaintop monasteryopening creditstaskmastermale dragtai chi sworddefying gravity (See All) |
In 1431, the Kingdom of Ayutthayan conquers the territory of Sukhothai expanding their lands to the East. The noble Lord Siha Decho is betrayed by his Captain, Rajasena, and is murdered together with his wife. However their son Tien is saved by one loyal soldier and left alone in the woods...
| Subgenre: | martial artscult film |
| Themes: | deathrevengebetrayalheroyouthvengeancemythology |
| Locations: | villagejungle |
| Characters: | warriortough guysoldierboyaction herofather |
| Period: | 15th century |
| Story: | sword duelshot with a bow and arrowoutlaw gangbow and arrowsword fightmiddle agesstick fightmedieval timesoutlawfight to the deathslavedisarming someoneambushcombatshowdown …battlechasenumber in titlebloodviolencesequelflashbackbare chested malefightbeatingdigit in titleblood splatterfistfightslow motion scenebrawlhand to hand combatsecond partnumbered sequelfightingkung fuorphanmixed martial artsone man armyone against manymissionmartial artistbare chested male bondagestylized violencespiritmartial arts masterelephantcaptivechop sockybuddhistkatana swordmeditationbuddhismbanditkung fu fightingkatanafighterkung fu classiccrocodiletestyoung manbo staffmuay thaibuddhayoung boybeefcake martial artssequel by name only1400s (See All) |
Set in Scotland in a rugged and mythical time, "Brave" features Merida, an aspiring archer and impetuous daughter of royalty. Merida makes a reckless choice that unleashes unintended peril and forces her to spring into action to set things right.
| Subgenre: | coming of agecomputer animationslapstick comedycgi animation |
| Themes: | escaperevengemarriageghostdeceptionmagicredemption |
| Locations: | castleforestsnowboatvillagewoodsship |
| Characters: | warriortough guyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipbrother brother relationshipbrother sister relationshipteenage girlfemale protagonistgirlmaid …witchhunting party (See All) |
| Story: | bow and arrowsword fightbullseyelutebanquetarrowmedieval timesshieldrebelspearfireplaceprincelegendambushgood versus evil …showdownswordrescuechaseknifedancingfemale nudityf ratedone word titleflashbackmale rear nuditydogtitle spoken by charactersurprise endingvoice over narrationtitle directed by femaleshot to deathhorseshot in the chestslow motion scenepunched in the facebare buttbirthdayriverswimmingfoot chaseaxemontagefishno opening creditskingprincessnecklacetransformationon the runtrainingflash forwardcursecharacter repeating someone else's dialogueprologuescreamingkeyrace against timetough girllightningprankcontestfeminismchickenwaterfallshot in the armbearqueenstrong female characterchessdestinyfalling down stairsspiritteen angstheavy rainlooking at oneself in a mirrorcakebuttockssheepstrong female leadtorchfateanimal attackapplefemale warriortarget practicebraveryscotland3 dimensionalrowboatscene after end creditspunched in the chestprideaerial shotshadowrainstormknife throwingkingdomwishblack magicsign languagecrowhorseback ridingtriple f ratedhit in the facebirthday presentstuffed animalstrongmanshot with an arrowyoung version of characterarcherycrowndomineering motherfemale heromooningmacguffinstablefight the systemheirarcherbechdel test passedbowbagpipesanimal killingrock climbingmagic spellteenage herothronehide and seekmedievalsuitorscottish accentbroomscotclothes rippinghuman becoming an animallordharptrackerrebellious daughterruinwood carvinginvisiblespit takeclanspear throwingteenage rebellionmatriarchytrackingone legged manrider horse relationshipwooden legmusic lessontug of warscottish highlandstripletscauldrongirl horse relationshipaxe throwingthrown from a horsebareback ridingredheaded girlcubriding bareback10th centuryirish wolfhoundtapestrypeg legceltdisney princessevil spellfemale horse riderfemale archerbetrothalplaying bagpipeshaggisanimal becomes humangirl riding a horsewill o' the wispfiery redheadwork horsedrumstickrefusing to believehighland gamesmenhir (See All) |
In Ancient Greece 1200 B.C., a queen succumbs to the lust of Zeus to bear a son promised to overthrow the tyrannical rule of the king and restore peace to a land in hardship. But this prince, Hercules, knows nothing of his real identity or his destiny. He desires only one thing: the love of Hebe, Pr …incess of Crete, who has been promised to his own brother. When Hercules learns of his greater purpose, he must choose: to flee with his true love or to fulfill his destiny and become the true hero of his time. The story behind one of the greatest myths is revealed in this action-packed epic - a tale of love, sacrifice and the strength of the human spirit. (Read More)
| Subgenre: | martial artsconspiracychrist allegory |
| Themes: | escapemurderdeathrevengesuicidebetrayaltorturedeceptionsupernatural powerdeath of motherunrequited lovehopemythologygreek mythology |
| Locations: | castleforestdesertvillagewoodsshipcavecampfire |
| Characters: | warriortough guysoldierhusband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipteacherhostageaction hero |
| Story: | sword duelbow and arrowsword fightfight to the deathcrossbowshieldslavespearprincebattlefieldlegendambushgood versus evilcombatshowdown …swordbattlechaseknifecharacter name in titlebloodviolencebare chested malefightexplosionsurprise endingfirebeatingshot to deathfistfighthorseshot in the chestshot in the headslow motion scenepunched in the facewritten by directorbrawlfalling from heighthand to hand combatshot in the backdecapitationaxedeath of friendthroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headno opening creditsone man armykingshot in the legprincessskinny dippingattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backelectrocutionstatuekicked in the facelightningopening action sceneshot in the shoulderhorse ridingneck breakingthreatened with a knifemercenarywaterfallshot in the armwhippingbare chested male bondagequeenstylized violencecaptainheavy rainhelmetslaverykicked in the stomachjumping from heightrebellionforbidden loveanimal attackfull moondual wieldstabbed in the throatwhip3 dimensionalegyptstabbed in the legpunched in the chestliondungeonrainstormknife throwingpalacesuper strengthstabbed in the armcommandercheering crowdarenagoddesssword and sandalstabbed in the shoulderarcherbettinggladiatorwarlordforced marriageshot in the crotchanimal killingrock climbinghusband murders wifeman hits a womanbeefcakeancient greecestabbed in the footorigin of heroflaming arrowtyrannybare knuckle fightingspear throwingdeus ex machinahanged by the neckconquestherculeschariotvirtual setdemi godtunicamphitheaterbound in chainsreference to zeusflaming swordbranding ironcliff divingafrican lionfemale gladiatorgolden eagleblood sportarmy on the march (See All) |
The young, sickly King Einon was wounded in a battle. In order for him to survive, he is healed by Draco, a dragon. Some years later, Bowen, a dragon slayer, encounters Draco. The two team up to form a traveling duo that perform an act, but the act is only known by themselves. Bowen supposedly "slay …s" Draco and then collects a reward from the town or village that he protects by killing the dragon who had been "terrorizing" them. From there, Bowen and Draco must save the entire kingdom from the rule of the now evil King Einon, who is part of Draco and Draco a part of him. (Read More)
| Subgenre: | martial artscult filmsword and sorcerysword and fantasy |
| Themes: | escapemurderfriendshiprevengebetrayalfearherodeceptionangerdeath of fathersupernatural powerpovertyhopeblindnesscourage …self sacrificenear death experienceunlikely friendship (See All) |
| Mood: | rain |
| Locations: | castleenglandforestvillagelakecavecampfire |
| Characters: | warriorsoldiermother son relationshippriestchristianitymythical creatureblood lust |
| Story: | shot with a bow and arrowbow and arrowsword fightoathswordsmanarrowmedieval timescrossbowshieldknightspearprincedisarming someonegood versus evilcombat …showdownbattlerescuechaseknifeone word titledogbare chested maleexplosionsingingfirehorseshot in the chestfalling from heightliehand to hand combatswimmingassassindeath of friendbridgearmyimpalementstabbed to deathstabbed in the chestanti herokingpaintrainingattempted murdertreestabbed in the backperson on fireattackdragonfarmerscarpigloss of fathermercenarywaterfallpoetqueenarsonchesscivil warspiritflyingheavy raintalking animalquesthelmetslaveryloss of friendcaptiveexploding buildingfraudsheeprebellionhonortorchmonkmoralityfemale warriorreverse footagetarget practicestarpartnerresurrectionimmortalitymentorheartdungeonsoulhealingarmorblind maneye patchaxe murdertragic heroshametombschemevikingbreadstandoffcomic reliefselfishnessidealismfortresshired killerfencingnarcissismreluctant heroone linertyrantjudofamous scorepart computer animationarcherwatermelonbowmatricideuprisingoff screen murdersecret passagedeterminationproposallong haired maleextinctionaxe fightbattle axejudo throwheart transplantfalconstudent teacher relationshipfire breathing dragonking arthurblamefear of flyingvowfake deathimplied rapestomach ripped openchained to a wallcynicrotting corpselegendary heroevil kingconstellationpushed from heightaxe throwingtrucewooden swordbroken promisedeath of kingflying dragonvalorheld at knifepointpower lustlife forcecode of honorkilling a friendwinged dragondragonslayeringenueprison laborchest woundpeasant armydragon featureheld at sword pointhuman versus dragonmortal woundtalking dragonhorned helmetfencing lessonavalonhuman dragon relationshipreflection in an eyestalemate900sarrow in the shoulderpeasant revolution (See All) |
Philipe Gastone, a thief, escapes from the dungeon at Aquila, sparking a manhunt. He is nearly captured when Captain Navarre befriends him. Navarre has been hunted by the Bishop's men for two years, ever since he escaped with the Lady Isabeau who the Bishop has lusted after. Navarre and Isabeau have … a curse that the Bishop has placed on them that causes Navarre to be a wolf during the night and Isabeau to be a hawk during the day. Navarre insists that Philipe help him re-enter the city to help him kill the heavily guarded Bishop. (Read More)
| Subgenre: | sword and sorcerysword and fantasy |
| Themes: | theftescapemurderdeathloveprisondrinkingmagicevilprison escapereligious tolerance |
| Mood: | rain |
| Locations: | castleforestchurchsnowwatercampfiretunnelsewer |
| Characters: | thiefdancerpriesthorse actor |
| Story: | bow and arrowsword fightlutehorse and wagonbishopmedieval timescrossbowknightspearbattlefieldhangingfictional warprisonercombatsword …battlerescuechasedancingbloodviolencekissfighttitle spoken by charactercryingdreamfoodhorsefalling from heighttearsrunningjailprayerriverswimmingaxemountainimpalementstabbed to deathstabbed in the chestchildbirdtransformationcursefugitivemissionpassionrabbitpursuitcrossreunionunderwatergardenicewolfelectronic music scoreslow motionquestjail cellmousehuntersheepmonkdark herodungeonrainstormarmorkingdomhorseback ridingspellsunsetpickpockettowershot with an arrowdiggingwellsunrisesword fightingcathedralstar crossed loverstragic loveinnhawkchurch belleclipsetalking to selfbear traphuman becoming an animaldawnladyfalconfalling through iceanimal traplovers reunitedpicking a lockkilled with a swordlock pickrider horse relationshiparrow in chesttalking to goddrawbridgecorrupt priestgirl horse relationshipbell ringingbareback ridingdrainenchantmenttrapperduskriding barebackblack horsesword throwingevil spellplanetary alignmentwoman horse relationshipboy horse relationshiptransformfemale horse riderleg hold trapandalusianbird of preyman horse relationshipspeaking in rhymegirl riding a horsestabbed with an arrowstabbed with swordtalking to a horsehooded cloakfalconerfalling from a towerblack knightcastle ruinscow skulltrained horseturned into a birdtwo riding a horse (See All) |
During the reign of the Tang dynasty in China, a secret organization called "The House of the Flying Daggers" rises and opposes the government. A police officer called Leo sends officer Jin to investigate a young dancer named Mei, claiming that she has ties to the "Flying Daggers". Leo arrests Mei, …only to have Jin breaking her free in a plot to gain her trust and lead the police to the new leader of the secret organization. But things are far more complicated than they seem... (Read More)
| Subgenre: | martial artstragedywuxia |
| Themes: | escapemurderdeathrevengemarriagerapebetrayaljealousyprisondrinkingtorturedrunkennessheroseductioncorruption …death of fatherpovertyblindnesswealth (See All) |
| Locations: | forestsnowwatervillagewoodschinacampfirebrothel |
| Characters: | warriormusiciansoldierhusband wife relationshippolicesingerpolice officerdancerlove trianglelust |
| Story: | sword duelbow and arrowsword fightswordsmandaggershieldrebelspearduelprisonerambushcombatshowdownswordbattle …rescuechasedancingsexnuditynumber in titlebloodviolencekissfightsingingsurprise endingfirecryingsonghorseslow motion scenedrinkarrestsecrettearshand to hand combatspyassassinthroat slittingarmyhouseassassinationdouble crosstreestabbed in the backfugitivecharacter's point of view camera shotpassionflowerspursuitgovernmenthorse ridingtied upgeneralmagical realismtruststylized violenceflirtingcaptainflyingwoundmachetecaptiverebellionfollowing someonehonoraction heroinetrappedwindbraverykatana swordstabbed in the throatbathingbooby trapsecret identityemperordrumdeputyautumnsword fightingstar crossed loversromantic rivalrytragic lovedoublecrossbrothel madamimperialismblind girljail breakshowgirlwire fumatchmakerdutyswordplaybamboowuxia fictionswordswomanancient chinapatrolcaptive womanfalling treerebel armytug of warvisually impaired persongreen dressyoung loverstang dynastypavillion9th centurycorrupt governmentwoman with long hairfalling horse (See All) |
When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth, …Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)
| Subgenre: | sword and sorceryepicdark fantasysword and fantasy |
| Themes: | escapemurderdeathfriendshiprevengesurrealismbetrayalghostpregnancyfeardrunkennessfuneralmonsterinvestigationdeception …magicangercorruptionbrutalitysupernatural powersadismexploitationhopeself sacrificeregret (See All) |
| Locations: | castleforestchurchsnowvillagewoods |
| Characters: | warriortough guysoldierhusband wife relationshipfather son relationshipmother son relationshiptattoobrother sister relationshipbabyhostageaction herosingle fatherpregnantengineer |
| Story: | sword duelsword fighthorse chasemacetreasondaggercapturedeerfight to the deathshieldslaveknightrebelprincebattlefield …duelfictional warprisonerambushgood versus evilcombatshowdownswordbattlerescuechaseknifebased on novelbloodviolenceone word titlebare chested malefightexplosionsurprise endingfirevoice over narrationbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headslow motion scenepunched in the facearrestbrawlfalling from heightbookinterrogationdemonriversubjective cameradecapitationsurvivalstrangulationaxemassacremountaindeath of friendthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapsevered headno opening creditsanti herobirdchild in perildouble crossritualunderwater scenekingcreaturetransformationone against manytreelibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentevil manknocked outkicked in the facetough girllightningskeletonmanipulationscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled scenestylized violencesingle parenthenchmaneavesdroppingtraitorwolfloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetblockbustergiantpoolsevered handcovered in bloodsheepskullmind controlhonortorchburialaction heroineanimal attackcrushed to deathfemale warriorfull moonguardbarefootdwarfreverse footageinvasionloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationwizardstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the enddisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationblack magicwilhelm screamtelekinesisexorcismteleportationpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificeportalworld dominationmegalomaniaccrowninterracial marriagesorcererhead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreathorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All) |
Inspired by "The Canterbury Tales," as well as the early life of William Marshall (later First Earl of Pembroke), this is the story of William, a young squire with a gift for jousting. After his master dies suddenly, the squire hits the road with his cohorts Roland and Wat. On the journey, they stum …ble across an unknown writer, Chaucer. William, lacking a proper pedigree, convinces Chaucer to forge genealogy documents that will pass him off as a knight. With his newly-minted history in hand, the young man sets out to prove himself a worthy knight at the country's jousting competition, and finds romance along the way. (Read More)
| Subgenre: | dark comedy |
| Themes: | lovetorturedanceheromemorypoetry |
| Locations: | church |
| Characters: | tough guyfather son relationshipwritervillain |
| Story: | sword and shieldsword duelsword fightlancesteel helmetmiddle agesswordsmandaggermedieval timesshieldtournamentknightduelcombatshowdown …nuditymale nudityflashbackmale rear nuditypunctuation in titlehorselierock musicapostrophe in titlecompetitionfightingbrunettetrainingtentopening action scenesensualitychampionpoetgamecampflatulenceparadeappleimpostorrivalarmorblind manbroken armpassionate kisssurprise after end creditspeasantstabbed in the armblacksmithgambling debtanachronismdreadlocksangry mobfeastgambling addictionswordplaybare midriffplay fightjoustingmusical sequence in non musical workpillorysplinterfarting contestpretend knight (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
| Themes: | escapemurderdeathloverevengesurrealismkidnappingbetrayalfearmonsterdeceptionseductiondeath of fatherbrutalitysupernatural power …redemptionfaithhopeapocalypseblindnesscourageself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
| Mood: | poetic justicedarknessaustralian supernatural |
| Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
| Characters: | warriortough guythiefsoldierhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshiphostageaction heroex husband ex wife relationshipdeath of girlfriend |
| Story: | bow and arrowsword fightknife fightcoronationstick fightdaggerdictatorshieldslaverebelspearbattlefieldfictional warambushgood versus evil …combatshowdownswordbattlerescuechaseknifebloodviolenceflashbackbare chested malekissfightexplosionsurprise endingfirevoice over narrationbeatingcorpsefistfighthorseshot in the chestslow motion scenepunched in the facebrawlfalling from heighthand to hand combatbeddemonorgydecapitationsurvivalbedroomassassinold manaxemassacremountainbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armydouble crossunderwater scenekingcreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueevil manlightningopening action sceneskeletonbraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionburned aliveflyingassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadguardreverse footagehaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathloss of brotherbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackersandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
An American teenager who is obsessed with Hong Kong cinema and kung-fu classics makes an extraordinary discovery in a Chinatown pawnshop: the legendary stick weapon of the Chinese sage and warrior, the Monkey King. With the lost relic in hand, the teenager unexpectedly finds himself traveling back t …o ancient China to join a crew of warriors from martial arts lore on a dangerous quest to free the imprisoned Monkey King. (Read More)
| Subgenre: | martial artscoming of agewuxia |
| Themes: | robberymurderrevengedrunkennessherotime travelvengeancephilosophy |
| Locations: | forestdesertvillagerooftopcavechinacampfire |
| Characters: | warriortough guyteenageraction herobullyvillainwitchamerican |
| Story: | shot with a bow and arrowbow and arrowsword fightoutnumberedmiddle agesswordsmanspearlegenddueldisarming someonecombatshowdownswordbattlechase …based on novelbloodviolenceflashbackfighttitle spoken by characterbeatingdreamfistfighthorseshot in the chesturinationbrawlfalling from heightshootinghand to hand combatfightingkung fushot in the backorphanflashlightwinestrangulationmountainambulancestabbingmixed martial artsbirdkaratestatuemartial artistwaterfallwhippingstylized violencemartial arts masterquesttemplevillainessmonkchop sockykickboxinginterracial romancewhipboston massachusettsprophecyimmortalitymentorbounty hunterkarate chopkatanaalleyhairparkourshot with an arrowarcherywelldrumparamedicartifactpotionresponsibilitypawnshopinnwarlordbo staffcavalrystaffrelicwu shusecret loveslow motion action sceneshaolinsandstormteenager fighting adultturned to stoneprotectorwuxia fictionfighting in the airelixirsparrowunspoken lovemagical weaponburning villagemonkey kingrice paddysagecrescent mooncherry treereferring to oneself in the third person (See All) |
The original Zorro, Don Diego de la Vega, is captured and imprisoned just as Spain concedes California to Santa Anna. 20 years go by and his mortal enemy, Don Rafael Montero, returns to California with a plan to become wealthy at the expense of the peasants. The original Zorro escapes from prison an …d trains a new Zorro to take his place. Much swashbuckling and derring-do ensues. (Read More)
| Subgenre: | swashbucklermartial artssuperherodark comedytragedyepicperiod piece |
| Themes: | robberymurderrevengekidnappingcorruption |
| Mood: | poetic justice |
| Locations: | churchmexicobar brawl |
| Characters: | warriorsoldierfather daughter relationshipbabylove triangleaction heroteacher student relationship |
| Period: | 19th century1840s1820s |
| Story: | vigilante justicesword duelsword fighthorse chasevigilantismswordsmandictatorvigilantedisarming someonegood versus evilshowdowndancingcharacter name in titlemale nuditytitle spoken by character …partypistolhorsebare buttmaskrevolverfoot chasecaliforniaimpalementbrunetteno opening creditsone man armyfemme fataletrainingone against manykaratepassionevil manopening action scenefirst partgoldheroinelifting someone into the airblockbusteraction heroinebar fightwhipthrown through a windowmain character diesbanditoppressionconfessionalyoung version of characteradventure herofencingchild kidnappingsix shootermain character shotmentor protege relationshipflintlock rifleflintlock pistolorigin of herodead brothergold minelong black hairslave laborbowie knifehaciendazorrohuman in a cagelone wolfwhip fightyear 1821 (See All) |
The tyrant Gedren seeks the total power in a world of barbarism. She attacks and kills the keepers of a powerful talisman just before it is destroyed. Gedren then uses the power of the talisman in her raid of the city Hablac. Red Sonja, sister of the keeper, sets out with her magic sword to overthro …w Gedren. The talisman's master Kalidor follows to protect her. Of course they fall in love - however Red Sonja's power bases on the oath to never give herself to any man... (Read More)
| Subgenre: | swashbucklermartial artscult filmsword and sorceryalternate historysword and fantasy |
| Themes: | rapewrestling |
| Locations: | castlesea monster |
| Characters: | warriortough guyfemale protagonistaction hero |
| Story: | sword duelbow and arrowsword fightoathswordsmancrossbowspearbattlefieldduelfictional wardisarming someonecombatshowdownswordbattle …female nuditycharacter name in titlebloodviolencebare chested malekissfightblood splatterhorseblondemaskhand to hand combatfightingdecapitationcleavagewomanmixed martial artsstabbed in the chesttough girlscarunderwatersevered armdismembermentlifting someone into the airvillainessaction heroinecrushed to deathfemale warriorguardpsychotronicsiegeteleportationbeheadingkendomusclemanstrongmanstandoffadventure heroredheaded womanfencinggirl powerbarbarianprehistoric timeslesbian subtextgiant spiderkiller robotbattle axetalismanstone agenipple sliphyborian agelava stream (See All) |
This is the story an amusement park employee named Jamal Walker who is magically transported back to medieval times in 14th-century England. There, Jamal meets Sir Knolte, a dissolute knight, before he stumbles into the court of the usurper King Leo. Jamal is impressed by what he thinks is the reali …sm of the theme park; only after witnessing a gory beheading does he realize, with horror, where he really is. Jamal encounters the beautiful Victoria who is scheming to return the queen to the throne, and falls afoul of the evil Sir Percival. Joining forces with Sir Knolte and Victoria, Jamal teaches the rebels some helpful football, golfing, and boxing moves, before he dons the armor of the awesome "Black Knight"! (Read More)
| Subgenre: | martial artsfish out of wateralternate history |
| Themes: | lovemagicseductiontime travel |
| Locations: | castlevillagewoods |
| Characters: | african americanbully |
| Period: | 2000s |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fightusurperdictatormedieval timesshieldknightspearfictional warcombatswordbattlesex …kissinterracial sexsurprise endingsex in bedhand to hand combatcolor in titledecapitationaxekingprincesskissing while having sexchessflatulencerebelliondungeonsiegepeasantbully comeuppancefast foodtyrantmartial arts traininganachronismcomeuppanceaxe fightbattle axeflaming arrowcomic heroaltering history14th centuryend of warheimlich maneuver1300speasant revoltpeasant army (See All) |
In an ancient time, predating the pyramids, the evil king Memnon is using the psychic powers of his sorceress Cassandra to fortell his great victories. In a last ditch effort to stop Memnon from taking over the world, the leaders of the remaining free tribes hire the assassin Mathayus to kill the so …rceress. But Mathayus ends up getting much more than he bargained for. Now with the help of the trickster Arpid, tribal leader Balthazar and an unexpected ally, it's up to Mathayus to fufill his destiny and become the great Scorpion King. (Read More)
| Subgenre: | martial artssword and sorcery |
| Themes: | betrayalheromagicwrestling |
| Locations: | desertcitycave |
| Characters: | warriortough guythiefboyaction herohorse thief |
| Story: | sword duelshot with a bow and arrowsword fightswordsmandaggerarrowspearbattlefieldduelfictional wardisarming someoneambushcombatshowdownsword …battlerescueknifecharacter name in titleviolencefightexplosionthree word titlefirefistfightbrawlfalling from heighthand to hand combatanimal in titlefightingassassinstrangulationaxethroat slittingimpalementmixed martial artssnakesevered headno opening creditsdream sequenceone man armykingpoisonopening action scenewaterfallcross dressingdestinyspin offskullvisiontelescopeexplosivesandresistancedual wieldinventorhit in the crotchknife throwingraidsiegedead boyrescue missionprequelpalacecamelspit in the facemusclemanstrongmanparkourarcherystabbed in the armcrystalscorpionpatricideanttyrantsword and sandaltitle in titlebowharemarm wrestlingsorceressurnancient egyptvalleyclairvoyantcobraflaming arrowsandstormcatapultfalcongunpowderclairvoyanceswordplayantiquityfire antgrappling hookrubygongsinkholeoasisprecognitionseerflaming swordsoothsayerwrestler as actorarrow in backreference to sodompoisoned arrowarrow catchingarrow in the backgomorrahgomorrahitenear death survivorprequel to sequelacadianarrow in one's backwall of firelima syndrome (See All) |
Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle …dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)
| Subgenre: | martial artssuspenseconspiracycyberpunkscience fantasy |
| Themes: | escapemurderdeathrevengesurrealismkidnappingbetrayalprisonfeardeceptionmemoryangerdeath of fatherdeath of motherparanoia …time travelredemptionguiltsurveillanceexecutionexploitationpaniccourageregret (See All) |
| Locations: | churchhelicopterdesertlondon englandbicycleelevatorvillageshiprooftoptexaslaboratoryspainrooftop chase |
| Characters: | warriortough guysoldierfather son relationshipmother son relationshipfather daughter relationshipdoctortattoopriesthostageaction herosecurity guardamerican abroadself mutilationbabe scientist |
| Period: | 1980s2010syear 198615th century |
| Story: | bow and arrowsword fighthorse chaseknife fighthistorical fictiondaggercrossbowshieldknightspearropeprincebattlefieldfictional warprisoner …ambushgood versus evilcombatswordbattlerescuechaseknifebloodviolenceflashbackbare chested malefightphotographtitle spoken by characterexplosionsingingsurprise endingfirepunctuation in titlecorpseshot to deathfistfightmachine gunhorseshot in the chestshot in the headslow motion scenepunched in the facecomputerbrawlpaintinghand to hand combatbombapostrophe in titlehallucinationcriminalscientistshot in the backsubjective camerafoot chaseassassinstrangulationaxemassacrebasketballthroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestweaponno opening creditsanti heroassassinationdrawingchild in perildouble crossritualshot in the leglatex glovestrainingflash forwardone against manycharacter repeating someone else's dialoguedangerstabbed in the backprologueelectrocutionattackcharacter's point of view camera shotmissionrace against timecover upknocked outkicked in the facetough girlmanipulationscarinjectionneck breakingloss of fathertied upthreatened with a knifemercenaryloss of mothershot in the armsubtitled scenepowerstylized violencehenchmanchessrioteavesdroppingdestinygrenaderevelationhypodermic needlehelmetsecurity camerajail cellstabbed in the stomachkicked in the stomachcaucasianjumping from heightvirtual realityfaked deathart gallerytorchfateaction heroinefemale killersocial commentaryapplefemale warriorhaunted by the pastprison guardbraverystabbed in the throatbased on video gamestabbed in the neckescape attemptoilbible quotestabbed in the legpunched in the chestdark heroaerial shotconvictknife throwingdark pastcorporationrescue missionnewspaper clippingsouthern accentfemale assassinfemale fighterparkourworld dominationsecret societyshot with an arrowyoung version of characterarcherytrailer homestabbed in the armemperordeath rowartifactcolonialismman kills a womantrailer parkcrashing through a windowmacguffinpalm treeeaglewoman kills a manfight the systemmadrid spaincathedralmetal detectorhigh techarcherbladerepeated linegeneticstragic pastwoman fights a manwarlordceoreference to adam and eveprison wardenhusband murders wiferelicarmoryevil corporationx rayed skeletonsinistercrypttotalitarianismdeoxyribonucleic acidhorse drawn carriagejumping from a rooftopmegacorporationaxe fighthooded figuresecret organizationwoman punches a manflaming arrownightstickancestorvisionarybatontranquilizer dartreference to the bibledartlethal injectionpseudo sciencesultanenforcerspear throwingpublic executionchariotinitiation ritevirtualityfree willdisobediencefree fallbaja californiafree runningresearch facilitydescendantknights templartunictranquilizer guncutlassspanish inquisitionchristopher columbusknife in shoedeath row inmatehidden weaponfight with selfreference to marie curiestrapped to a chair1490syear 1492father son reunited (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
| Subgenre: | tragedychrist allegory |
| Themes: | murderdeathloverevengesurrealismsuicidekidnappingbetrayalfeardeceptionbrutalitysupernatural powerdeath of motherhopedeath of wife …self sacrificemythologynear death experience (See All) |
| Locations: | castleforestchurchlondon englandwoodscave |
| Characters: | warriortough guysoldierhusband wife relationshipfather son relationshipmother son relationshiphostagevampireaction heroself mutilationex soldierself healingblood lust |
| Period: | 15th century |
| Story: | bow and arrowsword fightoutnumbereddeermedieval timesshieldspearprincebattlefieldlegendambushcandlegood versus evilcombatshowdown …swordbattlerescuechaseknifecharacter name in titlebloodviolenceflashbackbare chested maleexplosionsurprise endingfirevoice over narrationbeatingcorpseblood splatterhorseslow motion scenepunched in the facefalling from heighthand to hand combatrunningdemonriversubjective cameraaxemassacremountainthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in periltransformationon the runflash forwardattempted murderone against manycursestabbed in the backscreamingperson on firecharacter's point of view camera shottentevil manlightningskeletonshot in the shoulderscarcrossthreatened with a knifedirectorial debutsevered armgeneralbare chested male bondagerefugeesubtitled scenefreeze framestylized violencemaniacdestinywolfburned alivehead buttgothicheavy rainhelmetcrucifixloss of wifespiderskulltorchmonkburialanimal attackback from the deadcannonhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark herorainstormarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
A veteran samurai, who has fallen on hard times, answers a village's request for protection from bandits. He gathers 6 other samurai to help him, and they teach the townspeople how to defend themselves, and they supply the samurai with three small meals a day. The film culminates in a giant battle w …hen 40 bandits attack the village. (Read More)
| Subgenre: | martial artscult filmepiccult classic |
| Themes: | deathlovefriendshiprevengesuicidefeardrunkennessherodeceptionangergriefhopedeath of wifepanicfalling in love …couragesamuraistarvation (See All) |
| Mood: | rain |
| Locations: | forestvillagejapanfarmcampfiretown |
| Characters: | warriortough guythiefhusband wife relationshipfather daughter relationshipchildrenhostageaction heroold friendcrying babysamurai swordsamurai warrior |
| Period: | 16th century |
| Story: | shot with a bow and arrowbow and arrowsword fightvictoryswordsmanstick fightspearbattlefieldduelfishingdisarming someoneprisonercombatshowdownsword …battlechasenumber in titleviolencemale rear nuditybare chested malegunkisssingingfireshot to deathhorseslow motion scenesecretriflehand to hand combatriverorphanold manmapchild in perilold womantrainingfarmerhorse ridingpremarital sextied upmercenarywaterfallflowerlove interestclass differencesarsonhappinessmale bondingcrying womanforbidden lovefollowing someonehonorcrying manburialmoralitycelebrationsufferingkatana swordmisunderstandinghungerdespairensemble castyoung lovearmorsiegeblind mantragic heromoral dilemmacrowdmudtombbanditpeasantkatanakendostrategyassumed identitystandofffencingoffscreen killingilliteracyhumormusketbo staffhouse on firevillagerhillman with no namehostage situationstraight razorharvestlootingflintlock rifleweepingchopping woodricekneelingmoral ambiguitybarricadebarefoot womansicklejidai gekilong black hairstabbed with a swordmillwashing hairelderly womanpracticemockeryoutburstrecruitingshot with a guncaptive womanhead shavinggenealogyelderly manmaster apprentice relationshiproninsabresakecherry blossomnumber 7 in titlefalling off a horsecult favoritestabbed with a spearweeping womandragged by a horseweeping manfalse alarmrice paddywater millsheathplaying flute1570sadmirationrain fightbarleyhot headedcatching fish by handvillage elderdejectionfather hits daughterhorse drawn plow (See All) |
John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to …survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)
| Subgenre: | martial artscoming of ageblack comedysword and sorcerydark fantasysword and fantasy |
| Themes: | robberyescapemurderdeathloverevengesurrealismkidnappingbetrayalghostfearmonsterdeceptionmagicsupernatural power …death of motherredemptionunrequited lovehopecourageself sacrifice (See All) |
| Mood: | nightdarkness |
| Locations: | castleforestchurchsnowvillagewoodsfarmcampfirewalled city |
| Characters: | warriortough guysoldiermother son relationshipmother daughter relationshipsister sister relationshipaction heroalcoholicteacher student relationshipwitchevil witchdeath of student |
| Story: | bow and arrowsword fightknife fighttavernswordsmandeercrossbowknightspearbattlefieldfictional warambushgood versus evilcombatshowdown …swordbattlerescuechaseknifebased on novelviolencedogfighttitle spoken by characterexplosionsurprise endingfirefistfighthorseurinationslow motion scenebrawlfalling from heighthand to hand combatdemonhallucinationassassinstrangulationaxemountainmontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestno opening creditsanti herochild in perilunderwater scenecreaturefemme fataletransformationtrainingskinny dippingstabbed in the backprologueattackpossessiondragonrace against timelightningskeletonfarmerexploding bodypigthreatened with a knifewaterfallbearqueenstylized violencestrong female characterhenchmandestinyburned aliveassassination attemptheavy raincagecatfightvillainesseccentricgiantjumping from heightirishskullstrong female leadtorchaction heroinefemale killerbar fighteaten alivefull moonretirementvisiontarget practicebraverydual wieldson3 dimensionalstabbed in the headoiltime lapse photographystabbed in the legdark heroaerial shotwisecrack humorrainstormdisfigurementknife throwingdemonic possessiontragic heroblack magicburned to deathexorcismteleportationfemale fightergiant monstertwo man armyworld dominationfemale spyhired killerassistantpremonitionman kills a womantrollwoman kills a manstabbed in the shouldersole black character dies clichebladejumping into waterstabbed in the faceclawgravestonepitchforkchosen oneapprenticearmorypitregenerationvillain turns goodmentor protege relationshiptragic villainhorse drawn carriagenetgold coinaxe fightbrandingpendantleopardtalismanwarlockgiant creatureturned to stonebased on young adult novelcaged humancaught in a netwitch huntfemale thiefsilvercrisis of consciencetailtroubled productioncloakbell towerfighting in the airwoman murders a manmaster apprentice relationshipshape shiftingsororicidecauldronaxe throwingman murders a womanbookshelfgemstonesceptertough womanwoman murders a womanwitch hunterrolling down a hilltapestryfarmboydark forestwitch burningopening creditswoman kills a womanblood moongood witchcarry onrolling downhillcliffhanginglancashire (See All) |
Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.
| Subgenre: | martial artssuperheroabsurdismepicslapstick comedydark fantasyscience fantasylive action and animation |
| Themes: | escapemurderdeathrevengesurrealismkidnappingbetrayalfeardrunkennessmonsterdeceptionbrutalitysupernatural powerredemptioncelebrity …sadismalcoholismpanicapocalypsedisabilitycouragerevolutionself sacrificespace travelprison escapenorse mythology (See All) |
| Locations: | forestnew york citybarchurchelevatorvillagewoodsouter space |
| Characters: | warriortough guysoldierfather son relationshiptattoobrother brother relationshipbrother sister relationshipzombiealienhostageaction heroalcoholicvillaincousin cousin relationshipfather …alien monster (See All) |
| Story: | bow and arrowsword fightknife fightdictatorcapturefight to the deathshieldknightrebelspearprincebattlefieldduelfictional wardisarming someone …prisonerambushgood versus evilcombatshowdownswordbattlerescuechaseknifecharacter name in titleviolencesequelflashbacktwo word titlebare chested malefighttitle spoken by characterexplosionsurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestslow motion scenepunched in the facegunfightbrawlfalling from heightbookbased on comicheld at gunpointbeerhand to hand combatdemonriverfightingdecapitationsurvivalfoot chasebased on comic bookname in titleaxemassacremountainbasketballbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestweapontied to a chairsevered headone man armydouble crossspaceshipunderwater scenecreaturefemme fatalethird parttransformationtalking to the cameraon the runattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facetough girllightningopening action sceneskeletonbraceletscene during end creditsmanipulationspeechexploding bodythreatbrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadstylized violencestrong female characterhenchmanapplausedestinywolfdestructionflyingracehead buttelectronic music scoresociopathhelmetbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplanetblockbustereccentriccampjumping from heightclubskullrebellionlaserhomeaction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footagecameohaunted by the pastvisionbootsbraverydual wieldimpostorsonmercilessnesschaosresurrectiondeath threatevacuationprophecyescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault riflewisecrack humorhologrambounty huntereye gougingarmorcliffdark pastkingdomstadiumtelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemfinal battlecrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwoman murders a manwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All) |
After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.
| Subgenre: | martial artssword and sorceryepicsword and fantasyhigh fantasy |
| Themes: | escapemurderdeathloverevengebetrayalghostdeceptionobsessioninsanitygreedself sacrifice |
| Mood: | poetic justice |
| Locations: | castleforestsnowboatdesertcavewalled city |
| Characters: | warriortough guysoldierfather son relationshipfather daughter relationshipbrother brother relationshipbrother sister relationshipaction heromayor |
| Story: | bow and arrowsword fightoutnumberedshieldknightspearropebattlefieldfictional warambushgood versus evilcombatshowdownswordbattle …rescueknifebased on novelviolencesequelflashbackdogfightexplosionsurprise endingfirecorpseshot to deathhorseshot in the chestshot in the headslow motion scenepunched in the facefalling from heighthand to hand combatdead bodydemonhallucinationshot in the backdecapitationsurvivalaxemountaindeath of friendthroat slittingbridgearmystabbed to deathstabbed in the chestmapsevered headno opening creditschild in perilkingcreaturethird partnecklacedrowningstabbed in the backperson on firefantasy sequencedragonstatuetentknocked outrabbittough girlopening action sceneringdeath of brotherpigmercenarysevered armbearrefugeesubtitled scenestylized violencecivil waricegolddestinydestructionhead buttcagehelmetloss of friendloss of loved onetreasurehammercrying womanblockbustergiantjumping from heightpart of trilogyfaked deathforbidden lovehonorburialaction heroineanimal attackgoatcrushed to deathpresumed deadfemale warriorbarefootdwarfdual wieldstabbed in the throat3 dimensionalchaosevacuationfalling to deathwizardstabbed in the headstabbed in the legsexy womandeath of loved oneloss of brothermoral dilemmaprequelpipe smokingauctionbatelfinvisibilityanti warreturning character killed offruinsapparitionwoman cryingfemale fightertoweramputeearcherycrownstabbed in the armeaglewoman kills a manfriends who live togethergoblinstabbed in the shoulderfinal battlecowardarcherraveneight word titleshape shifterstabbed in the facecorrupt officialexploding housewoman fights a manshapeshiftinghit with a hammersorceressinfantryjewelcockney accentanimal killingarmorytear on cheekcity hallepic battlescottish accentadaptationbanishmentgold coinjail breaksuit of armorfranchisestabbed in the footcousinarsenalliterary adaptationsecret passagewayhidden doorgiant creaturecatapultanti villainman dressed as a womanmultiple cameosfalling through icebridge collapsebell towerelkballadeerorchobbitmiddle earthacorngiant wormtunicgemstonescepterprequel and sequelgiant birdhogsinger offscreenminstrelrock throwinglive action remakebare foot womansmoking a pipecollapsing bridgefemale archergiant batpeace negotiationgold ringstone bridgewhite magicblack bloodpile of goldarmy on the march (See All) |
Based on a more realistic portrayal of "Arthur" than has ever been presented onscreen. The film will focus on the history and politics of the period during which Arthur ruled -- when the Roman empire collapsed and skirmishes over power broke out in outlying countries -- as opposed to the mystical el …ements of the tale on which past Arthur films have focused. (Read More)
| Subgenre: | swashbuckler |
| Characters: | warriorsoldier |
| Story: | shot with a bow and arrowbow and arrowsword fightknife fightvictorydaggermedieval timesshieldknightspearbattlefieldcombatswordbattleknife …character name in titleviolencefighthorsefightingkingbased on filmhelmetspin offclubplaystation 2armornintendo gamecubefighting gamexboxsingle playerarcherybehind enemy linessword and sandalcapebritish soldierancient romemultiplayercavalryspin off from filmaxe fightbattle axebritish historyking arthurtomahawkexcaliburarthurian legendancient timesknights of the round table5th centuryroman army (See All) |
In the highlands of Scotland in the 1700s, Rob Roy tries to lead his small town to a better future, by borrowing money from the local nobility to buy cattle to herd to market. When the money is stolen, Rob is forced into a Robin Hood lifestyle to defend his family and honour.
| Subgenre: | swashbucklercult film |
| Themes: | murderloverapepregnancyheropsychopathgamblingvengeance |
| Mood: | star wars spoof |
| Locations: | castle |
| Characters: | thief herowarriortough guythiefsoldierhusband wife relationshipaction heropregnant from rape |
| Period: | 18th century |
| Story: | sword dueloutlaw gangsword fightrevoltswordsmanoutlawduelambushshowdownchaseknifesexbased on novelnudityblood …male nudityviolencemale frontal nuditymale full frontal nuditypistolfireblood splattershot in the chestremakeshot in the headfoot chasestrangulationdeath of friendstabbed to deathdrowningevil manthreatshot in the stomachsociopathhidingscotlandmanhuntenglishprisoner of warperversionraidchallengetorso cut in halfnude swimmingfingering vaginawar herowar violenceadventure heroenglishmanmuskethomosexual subtextlast standflintlock rifleflintlock pistolnoblemanjumping off a bridgeburning housekiltcadaversexual crueltyclanlegendary heronightshirtgeorgian erareign of terrorviolent manhighlandshand rubbing vaginapeasant revoltsadistic crueltyeighteenth centuryjacobiteclaymorehouse burning (See All) |
While protecting his village from rampaging boar-god/demon, a confident young warrior, Ashitaka, is stricken by a deadly curse. To save his life, he must journey to the forests of the west. Once there, he's embroiled in a fierce campaign that humans were waging on the forest. The ambitious Lady Ebos …hi and her loyal clan use their guns against the gods of the forest and a brave young woman, Princess Mononoke, who was raised by a wolf-god. Ashitaka sees the good in both sides and tries to stem the flood of blood. This is met be animosity by both sides as they each see him as supporting the enemy. (Read More)
| Subgenre: | martial artscult filmtragedyepicdisneyadult animationdark fantasysword and fantasychrist allegory |
| Themes: | lovefriendshipherodeceptionnatureprejudicemythologysamurai |
| Mood: | goreanime |
| Locations: | forestjapan |
| Characters: | warriorhuman animal relationshipsamurai sword |
| Period: | 16th century15th century |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fighthorse chaseknife fightdaggerprinceduelfictional wardisarming someonecombatshowdownswordchase …knifef ratedcharacter name in titlebloodviolencetwo word titlegunfighttitle spoken by characterblood splatterhorseriflehand to hand combatdemonfightingshot in the backdecapitationweaponanimaljourneyprincesstransformationcurseopening action scenemanipulationsevered armhatestrong female characterspiritwolfheroinemutilationhunterblockbusterstrong female leadcompassionfemale warriorkatana sworddual wieldpeaceenvironmentalenvironmental issuedark heroenvironmental issuesfolklorekendosuper strengthconservationgirl powerkindnessfablefamous scoretolerancemusketdeforestationgiant animalfortboarmoral ambiguityirondilemmawild boarforest protectionleprosyelknature conservationanimal protectionferal childsevered limbpanterritoryutopia questhuman versus animalwhite wolfthe westcutting off a handanimal allytalking wolf (See All) |
| Subgenre: | epicchrist allegory |
| Themes: | escapemurderdeathloverevengemarriagereligionbetrayaljealousypoliticsdeceptionangerbrutalityredemptionfaith …home invasionexecutionhopeblindnessvengeanceamnesiaforgivenessself sacrificenear death experience (See All) |
| Locations: | beachsnowcemeterydesertwatervillageseashiprooftopcaveoceancampfiresea battle |
| Characters: | warriortough guysoldierfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshiphostagereference to godchristianityteacher student relationshipjewchildhood friend |
| Story: | bow and arrowsword fightbanquetchaineddaggershieldslaverebelprincebattlefielddisarming someoneprisonercombatshowdownsword …battleknifedancingcharacter name in titlebased on novelbloodviolenceflashbackdogbare chested maletitle spoken by characterexplosionpartysurprise endingfirevoice over narrationcorpsehorseshot in the chestremakeshot in the headslow motion scenearrestletterorphanaxemountainmontagearmystabbed in the chestnonlinear timelinefalse accusationno opening creditsassassinationunderwater sceneracial slurtrainingflash forwardperson on firetentlightninglong takecrossgiftreunionthreatened with a knifesevered armwhippingbare chested male bondageclass differencesqueencircusassassination attemptheavy rainfriendship between menhelmetslaverycrucifixbeardrebellioncrying mantorchcompassionsocial commentarydebatepresumed deadcelebrationreverse footageresistancewhiphatredmercilessnessdeath threatgreecemiracleoilsibling rivalryrainstormbalconybetwar veterankingdomstadiumsevered legmoral dilemmapalaceman cryingbriberynarrated by characteroppressioncrucifixionfinal showdownspiral staircasemale friendshiphorse racingshot with an arrowamputeejerusalemarcherygovernorraftemperordrumcheering crowdarenahead injurywagerpalm treestablesword and sandalfight the systemparaplegicarcherbettingancient romecarpenterbowhorse racefreedom fighterresistance fighterdreadlocksloinclothtotalitarianismnomadloss of memoryrowingroman empiredinner tableflaming arrowstabbed in the sideromansheikcaught in the rainjesus christlobotomydiscipleseparation from familydeus ex machinasinking shipnaval battle1st centurychariotfirst aidleprosycrucifixion of jesusroman soldierjerusalem israelcannonballzealotoarreference to julius caesarjulius caesarenslavementlepertunicshackledadopted brotherslave girlcenturionremake of remakeriding accidentroman legionchariot racepontius pilatefast forwardleper colonyadrifttrampledcapsizeroman armycarrying someone over shouldercoliseumrebel fighterroman salutewhipping scars (See All) |
1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god …s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)
| Subgenre: | martial artsblack comedysword and sorcerysword and fantasy |
| Themes: | escapemurderdeathloverevengekidnappingbetrayalghostprisondrunkennessmonsterdeceptionredemptionfaithdeath of wife …self sacrificemurder of familygreek mythology (See All) |
| Mood: | gorenightmaremyth |
| Locations: | foresttrainsnowvillageearthwalled city |
| Characters: | warriortough guysoldiermother son relationshipfather daughter relationshiphostageaction herobullyuncle nephew relationshipex soldier |
| Story: | bow and arrowsword fightknife fightchainedtaverndaggercaptureshieldspearprincebattlefieldlegendfictional warprisonerambush …good versus evilcombatshowdownswordbattlerescueknifecharacter name in titlebloodviolenceone word titleflashbackdogbare chested malefemale rear nudityfighttitle spoken by characterpartyfirecorpseshot to deathblood splatterhorseshot in the chestshot in the headslow motion scenepunched in the facefalling from heightbased on comichand to hand combatjailhallucinationfightingshot in the backdecapitationorphanbased on comic bookaxemassacremountaindisguisemontagethroat slittingarmyimpalementstabbed to deathstabbed in the chestmapsnakenonlinear timelinebrunettesevered headno opening creditsone man armychild in perildouble crosskingcreatureshot in the legprincesstrainingstabbed in the backperson on fireattackstorytellingstatuetentknocked outkicked in the facetough girllightningopening action scenefarmershot in the shoulderdeath of sondarkneck breakingthreatened with a knifemercenarysevered armshot in the armgeneralbare chested male bondagekillingstylized violencecivil warrockpiratetraitorgolddestinywolfhead butthelmetjail cellvandalismfraudlossclubtorchfateaction heroineanimal attackfalse identitycrushed to deathfemale warriorfull moonadventurerhaunted by the pasttarget practicesufferingpastdual wieldstabbed in the throatwhipson3 dimensionalmuteshot in the facegreecestabbed in the headframe uplostswampstabbed in the leghit on the headexploding headdark herolionaerial shotdungeonsoulknife throwingstabbed in the eyekingdomtragic heropalacecrowdrugged drinkstrongmangiant monstermegalomaniacstabbed in the armadventure herobased on graphic novelsword and sandalstabbed in the shoulderteamworkshot in the throatarcherrighteous ragestabbed in the facetragic pastdeath of familywarlordpsychotronic filmscytheanimal killinglong brown hairdreadlocksathens greecegiant animalepic battlestrong manhorse drawn carriageancient greeceaxe fightdouble entendreflaming arrowtyrannygiant creatureambiguitywoman hits a manspear throwingherculeschariotevil kingprecognitionclosing eyes of dead personhead on a stakehurttunictooth ripped outamazon warriorbroken jawfemale mercenaryhydrasoothsayercerberusfemale archeropening creditsheir to thronedark worldgod king (See All) |
Through contact with a mysterious substance, called Ooze, 4 little turtles in the canalization of New York mutate to giant turtles. They can speak, walk upright and love pizza. The wise rat Splinter becomes their mentor and educates them to Ninja fighters. Their arch-enemy is the bad, bad guy Shredd …er, who struggles to gain power over the world. Of course the ninja turtles will do everything to stop him. (Read More)
| Subgenre: | independent filmmartial artscult filmsuperheroslapstick comedy |
| Themes: | murderfriendshiprevengesurrealismheroangerredemptionregret |
| Mood: | poetic justice |
| Locations: | waterapartmentfarmsewer |
| Characters: | warriortough guyfather son relationshippoliceteenagerfriendbrother brother relationshipaction herovillainemployer employee relationship |
| Period: | 1990s |
| Story: | vigilante justicesword duelsword fightknife fightstick fightspearvigilantedueldisarming someoneambushgood versus evilcombatshowdownswordviolence …flashbackfightfirebeatingfistfightbrawlsecretfalling from heightmaskhand to hand combatfightingkung fureporterjournalistbased on comic bookaxedisguiseboxingsubwayargumentbased on tv seriescostumeattackninjatough girlopening action scenescarratfirst partpizzaanswering machineloyaltyelectronic music scoretalking animallifting someone into the aircomastealingblockbusterjumping from heightskateboardchop sockymasked mananthropomorphismkatana swordanthropomorphic animalmentorskateboardingmeditationwisecrack humorturtlefemale reportermutationjuvenile delinquentsecret identitykung fu fightingface maskkatanacartoon on tvstreet gangkung fu classicspit in the faceold dark housesubway stationgolf clubpolice chiefdual roleadvicefish tankurban decayknocked unconsciousninjitsupizza deliverygarbage truckboard gamefather son reunionantiquebo staffanimal that acts humanfemale journalistlifting female in airfalling through the floorantique shopcelebrity impersonationnunchuckshockey maskfurryhockey stickaudio flashbackteenage mutant ninja turtleshit with a golf clubninja armysaicomfortmirage comicsunderground hideoutelectrical wiretalking turtlewashclothcymbalstalking ratanthropomorphic turtlestaff weapon (See All) |
A demon who seeks to create eternal night by destroying the last of the unicorns and marrying a fairy princess is opposed by the forest boy Jack and his elven allies in this magical fantasy. Two different versions of this picture feature soundtracks by either Tangerine Dream or Jerry Goldsmith.
| Subgenre: | swashbucklercult filmfairy talesword and sorcerydark fantasysword and fantasychrist allegory |
| Themes: | betrayalmonsterheromagicseductiondevilmythology |
| Locations: | forest |
| Characters: | warriorboyfriend girlfriend relationship |
| Story: | sword duelshot with a bow and arrowbow and arrowsword fightshieldlegendduelfictional wardisarming someonegood versus evilcombatshowdownswordrescuesurprise ending …firedemondecapitationprincessmissiongothiclifting someone into the airsexual desirereference to satanblack magicelfbrainwashingtemptationadventure herobeastsorcererunderworldsword and sandalgoblinunicornparadiseevil godlifting a male into the aircomfortd box motion codeseductive dancespiritual redemption (See All) |
King Henry V of England is insulted by the King of France. As a result, he leads his army into battle against France. Along the way, the young king must struggle with the sinking morale of his troops and his own inner doubts. The war culminates at the bloody Battle of Agincourt.
| Subgenre: | swashbucklerindependent filmtragedyepic |
| Themes: | courage |
| Locations: | englandfrance |
| Characters: | warrior |
| Period: | 15th century |
| Story: | sword and shieldshot with a bow and arrowbow and arrowsword fightlancearrowmedieval timesspearbattlefieldcombatswordbattlecharacter name in titlenumber in titleviolence …flashbackbased on playhorsemassacreimpalementkingprincesswritten and directed by cast memberdirected by stardirectorial debutreference to william shakespearechild murderroman numeral in titlehonorkingdomaristocratheroismwar violencedead childrencrownunsubtitled foreign languagesword and sandalarcherbritish renaissancebloody body of a childshakespeare play1400simpaled childhundred years wardauphinactor shares first and last name with charactershakespeare's henry vhenry vbattle of agincourt (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com