Please wait - finding best movies...
In the fall of 1976, a small psychology lab in Pennsylvania became the unwitting home to the only government-confirmed case of possession. The U.S. military assumed control of the lab under orders of national security and, soon after, implemented measures aimed at weaponizing the entity. The details β¦ of the inexplicable events that occurred are being made public after remaining classified for nearly forty years. (Read More)
Subgenre: | fake documentary |
Locations: | research laboratory |
Characters: | catholic priest |
Story: | psychic researchparanormal researchresearch institutescientific researchpsychic powerinvoluntary experiment subjectelectrocuted childmilitary intelligencenight terrorstest subjectsensory deprivationdriven madremote viewingclassified informationblack eyes β¦electrical torturehyperventilationsedationsleep deprivationparapsychologydeath by electrocutionemotional manipulationpyrokinesiselectric tortureextrasensory perceptionresearcherdog attackseizureelectric shockkgbmental breakdowndemonic possessionexorcismtelekinesisresearchgas maskmind controlpsychicinterrogationurination (See All) |
Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn β¦'t, and converts him to their cause - to destroy the underground movement. (Read More)
Subgenre: | independent filmcult filmsuspenseconspiracytragedyparanormal phenomenabody horror |
Themes: | murderdeathsurrealismsuicidepregnancytortureescapeinvestigationdeceptionpsychopathbrutalitysupernatural powerterrorismsurveillancehome invasion β¦exploitationregret (See All) |
Mood: | gorecar chasenight |
Locations: | trainhotelhelicoptertaxigas stationschool busart museumabandoned factorycar on fire |
Characters: | doctorbrother brother relationshipartisthitmansecurity guardprofessorself mutilationhomeless mansuicide by gunshotself inflicted gunshot wounddeath of killer |
Period: | 1980s |
Story: | psychic powerextrasensory perceptionseizuretelekinesismind controlpsychicinterrogationbloodviolenceone word titleflashbackbare chested malecigarette smokingphotographtitle spoken by character β¦explosionchasesurprise endingpistoltelephone callfirecorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapshot in the headshotguncomputerwritten by directorfalling from heightshowdownheld at gunpointcar crashhallucinationrevolvertelephonescientistshot in the backsubjective camerafoot chaseassassinterroristsubwayexploding carbrunetteapologyman with glassescigar smokingshot in the legshot in the foreheadon the runduelscreamingperson on firefactorypay phonecharacter's point of view camera shotmissionproduct placementstatuecover upevil manshot in the shoulderinjectionexploding bodyautomobileshot in the armcult directortraitorfalling down stairssabotagedestructionburned aliverevelationassassination attemptelectronic music scorehypodermic needledrugtied to a bedsecurity cameramagazinenosebleedphone boothpress conferencevisitgrindhousedriving a carladderart gallerycrushed to deathreverse footagesurveillance camerablood on facegash in the faceshopping mallsculptureblack and white sceneexploding headlaughterthrown through a windowopening a doormeetingburned to deathholding handspipe smokingtelepathyshot through a windowvillain played by lead actoryellingneedlehit in the facesubway stationarmored cartelephone boothescalatorworld dominationfilm projectormegalomaniachot dogdenialhearing voicesautumncabin in the woodsman kills a womancrashing through a windowlying on bedwoman kills a manshot in the handbullet woundsuper powerburnt bodyshot in the footlighting a cigarettemurder by gunshotman on firehuman experimenttwo brothersmind readingschizophrenicwoman with gunfade to blackdriving at nightfast food restaurantkicking in a doorscience runs amokpackagefratricideman slaps a womanrevolving doormusic storepublic phonethreatened with a gunmegacorporationthreat to killwaiting roomlooking at pictureshaking handstranquilizer dartburned bodyforced suicideclimbing stairscanuxploitationpsionic powerpublic telephonethrown through a wallmelting facesprinkler systemdrill in the headcomputer programpharmaceuticalsbus crashdart gunscannerknocking on a windowside effectcanadian science fictioncar crashing through a windowreference to sleeping beautyburnt corpsehypodermicexploding eyecrashing through glasswhite eyesclimbing ladderraising one's handcain and abelbrother killing brotherdriveby shootingexploding gas stationcomputer roomcomputer operatorcar crashes into buildinglighting pipe (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c β¦olleagues (Read More)
Subgenre: | cult filmblack comedysuspenseslasher flicksurvival horror |
Themes: | murderdeathrevengesurrealismrapedrinkingfearescapevoyeurismangerpsychopathsupernatural powerparanoiainsanitysurveillance β¦evilpanictechnologymadness (See All) |
Mood: | slasher |
Locations: | restaurantswimming poolelevatorlaboratory |
Characters: | boyfriend girlfriend relationshipfemale protagonistreference to godsecurity guardbabe scientistslasher killer |
Period: | 1990s2000s |
Story: | scientific researchtest subjectresearcherseizureelectric shockresearchurinationfemale nuditybloodviolencefemale frontal nuditymale rear nuditydogbare chested malegun β¦kissfightnipplesexplosionchasepantiesshowertelephone callfiredreamcorpseunderwearblood splattermirrorshot in the chestface slappunched in the facecomputerdrinkthongmaskvomitingshowdownsunglassesbombdead bodycafebathroomvoyeursciencescientistsurvivalfoot chasestrangulationimpalementman with glassesanti herounderwater scenedrowningtransformationstalkerdangerstabbed in the backsuburbperson on fireelectrocutioninjectionpursuitstalkingneck breakingratfirst partcult directormonkeywashington d.c.experimenteavesdroppingburned alivekilling an animalwarehousemass murdercagesociopathlifting someone into the airstabbed in the stomachmad scientistpoolcovered in bloodcgipeeping tomrampagetrappedsurveillance camerathirty somethingbody countcharacters killed one by onelasersightkilling spreeflamethrowerburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillabroken windowanimal abusegiving a toasttop secretburnt bodysole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonvillain not really dead clichescience runs amokloss of controltragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insecticiclesprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
Dr. Markway, doing research to prove the existence of ghosts, investigates Hill House, a large, eerie mansion with a lurid history of violent death and insanity. With him are the skeptical young Luke, who stands to inherit the house, the mysterious and clairvoyant Theodora and the insecure Eleanor, β¦whose psychic abilities make her feel somehow attuned to whatever spirits inhabit the old mansion. As time goes by it becomes obvious that they have gotten more than they bargained for as the ghostly presence in the house manifests itself in horrific and deadly ways. (Read More)
Subgenre: | suspenseparanormal phenomenasupernatural horrorgothic horror |
Themes: | suicidemarriageghostlesbianismfearobsessionsupernatural power |
Locations: | new england |
Characters: | female protagonistsister sister relationshippsychiatristbibleanthropologist |
Period: | 1960s1940s19th century20th century1870s |
Story: | psychic powerparapsychologyresearchpsychicbased on noveldancingvoice over narrationcar accidentmirrorbookhallucinationalcoholorphanflashlight β¦mansionhouselibraryprologuestatuehangingloss of motherhaunted housegraffitimaniacexperimentfalling down stairsgothicloss of wifecrushparking garageboston massachusettsbalconygateold dark housespiral staircasemagnifying glassnoisepoltergeistvoice over inner thoughtscountry estateharpnurseryremadehorror movie remadeinternal monologuedeliberate crueltycontemporary settingovernight in a haunted househarbinger of deathprivate libraryfeeling one is being watchedcarriage accident (See All) |
A scientist performs experiments involving intelligence enhancing drugs and virtual reality on a simple-minded gardener. He puts the gardener on an extensive schedule of learning, and quickly he becomes brilliant. But at this point the gardener has a few ideas of his own on how the research should c β¦ontinue, and the scientist begins losing control of his experiments. (Read More)
Subgenre: | independent filmcult filmtragedyb moviecyberpunk |
Themes: | murderdeathfriendshiprevengesurrealismfearescapepsychopathsupernatural powerparanoiainsanitysurveillanceabusecrueltymurder of a police officer β¦artificial intelligence (See All) |
Mood: | nightmare |
Locations: | churchhotelgas stationlaboratory |
Characters: | husband wife relationshipfather son relationshippolicemother son relationshippolice officerpolicemanpriestbullysecurity guardevil priest |
Period: | 1990s |
Story: | scientific researchpsychic powertelekinesisresearchmind controlpsychicfemale nudityviolenceflashbackmale rear nuditybare chested malegunsex scenekissfemale rear nudity β¦cigarette smokingexplosionsurprise endingpistolshowertelephone callfiretopless female nuditydreamshot to deathmachine gunshot in the headshotgunrescuecomputershowdownbombhallucinationreference to jesus christprayerrevolvertelephonescientistbedroomstrangulationmansiondinerinternetchild abusechild in perilnews reporttrainingperson on firebased on short storyrace against timeinjectionexploding bodybasementpremarital sexmercenarysilencerwhippingmonkeywashington d.c.uzianswering machineburned alivekilling an animallooking at oneself in a mirrorcomic booksecurity cameracrucifixexploding buildingbuttocksirishvirtual realitypart animationcgianimal attackschizophreniabald manmechanicwatching televisionrampageexplosiveinsectdelusiongasolinechairabusive fatherburned to deathabusive husbandtelepathycrucifixiontimebombabuse of powercomputer crackerworld dominationmental retardationintelligencebeebully comeuppancemegalomaniacforeplaychimpanzeebeltpart computer animationanimal experimentationcut into piecesmind readingscience runs amokevil corporation555 phone numbermegacorporationcomputer viruslawn mowerwife abusesweatinglemonadechalkboardmentally handicappedbuilding on firecyberspacecd playeranimate objectevil businessmangod complexbeating with a beltreference to the book of jobinsane womanlandscapingbody suitapple macintosh computergas pumpchristian crossbug spraykilled with a lawnmowerbrain capacitycomic book collectormind uploadingobject floats in the aircomic book collectionenhanced intelligence (See All) |
Happily-married couple Dan and Jody begin to notice some bizarre activity once they bring their lost nieces and nephew home. But when the chaos expands into Jody's job as a ballet dancer and Dan's career as an Ape researcher, they realize their family is being stalked by a nefarious demon. Together, β¦ with the advice of a psychic and the aid of numerous surveillance cameras, they must figure out how to get rid of it before it's too late. (Read More)
Subgenre: | supernatural |
Themes: | evil |
Mood: | spoofparody |
Locations: | hospitalswimming poolforestnightclub |
Characters: | babyself mutilation |
Period: | 2010syear 2013 |
Story: | researchergas maskpsychicurinationsequelflashbackmasturbationmale rear nuditydogdancinglesbian kisspistolvoice over narration β¦blondeslow motion scenepunched in the facecar crashvideo cameraexploding carno opening creditsdream sequencechild in perilnews reportcharacter repeating someone else's dialogueperson on fireelectrocutionwigsevered armballetkissing while having sexactor playing himselfkilling an animaltalking animalcrucifixflatulencefalling to deathtime lapse photographyhousekeepersevered legcellarfifth partfemale in showerreference to barack obamamarijuana jointfire extinguisherreference to facebookvomitgerman shepherdblonde womanpregnancy teststonercameo appearanceinterracial kisscabin in the woodsballerinaman punching a womanpool partyapepole dancingguillotineactress playing herselfwoman wearing black lingerietoilet humorwoman punching a manflickering lightfalling off a clifflong blonde hairnews anchorsevered penisincensehit with a frying panouttakes during end creditstwerkingsticking out one's tongueshared dreamwalking on waterhit with a doorslip and fallwalking in the woodsfalling out of bedbitten on the legwriting on a mirrorhit by a falling objectreference to matt damonthrown through the airface on a milk carton (See All) |
When a younger girl called Emily Rose dies, everyone puts blame on the exorcism which was performed on her by Father Moore prior to her death. The priest is arrested on suspicion of murder. The trail begins with lawyer Erin Bruner representing Moore, but it is not going to be easy, as no one wants t β¦o believe what Father Moore says is true. (Read More)
Subgenre: | christian horror |
Themes: | murderdeathreligiondrinkingdrunkennessinvestigationsupernatural powerillnessmental illnessfaitheviltraumastarvationthe devil |
Mood: | rainnightmare |
Locations: | hospitalbarrestaurantchurchsnowrural settingfarmcourtroom |
Characters: | family relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctorteenage girlfemale protagonistpolicemandancerpriestlawyerchristian β¦christianitybiblecatholicanthropologistreligious statue (See All) |
Story: | seizuredemonic possessionexorcismcharacter name in titleflashbackdancingphotographtitle spoken by characterknifesurprise endingbased on true storytelephone callhorsecar accidentwatching tv β¦catdrinklettercafecollegepianodemonhallucinationreference to jesus christprayersciencegood versus evilhalloweenstabbingsnakejudgetrialhit by a carritualgraveyardgravescreamingpay phoneumbrellapossessiondolllightningcourtpianistcrosswitnesssubtitled sceneocculttv newsspiritinjurytape recordertied to a bedjail cellcrucifixpsychologypsychologistschizophreniaclockdebatethunderministerstabbed in the neckbroken glassreference to satanvoice over letterpsychoticreflectiondormitorytestimonytombstonefarmhousejurytape recordinghearing voicesinsane asylumcatholicismcornfieldtavernpsychiatrycoincidencestableprosecutorscholarshipanthropologychapelriteanorexiaspoondetentionreference to the virgin maryschizophrenicmolestationepilepsylocketpsychosisholy watermartinispiritualismburningwomen's bathroomlaw firmforkmoral ambiguitytv cameradorm roomelectroshock therapyverdictsnorricammysticserpenttrick or treatreligion versus sciencefalling out a windowthrown through a windshieldexpertomenmedical examinercrisis of consciencemalnutritiontranquilizerneurologycatatoniafly the insectstigmataneurologistagnosticbarbed wire fencespeaking in tonguesmethodistepitaphreference to neroeating an insectabnormal psychologyhypersensitivityvocal cordsaramaicinitialsreference to belialarchdioceseunseen forcewitching hour (See All) |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
Subgenre: | fake documentaryindependent filmmockumentaryfound footage |
Themes: | murderfearsupernatural powerpanic |
Mood: | nightmarenightdarkness |
Locations: | swimming poolkitchen |
Characters: | boyfriend girlfriend relationshipself mutilationself absorption |
Period: | 2000syear 2006 |
Story: | demonic possessionexorcismpsychicbloodinterviewtwo word titlebare chested malephotographknifesurprise endingfirecomputercamerawritten by directorlow budget film β¦demonguitarf wordsubjective camerabedroomvideo camerahouseno opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguemicrophonescreamingsuburbfirst of seriescollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst partsevered armhaunted houseobscene finger gesturewhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterladdermale underwearbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All) |
In DELIVER US FROM EVIL, New York police officer Ralph Sarchie (Eric Bana), struggling with his own personal issues, begins investigating a series of disturbing and inexplicable crimes. He joins forces with an unconventional priest (Edgar Ramirez), schooled in the rituals of exorcism, to combat the β¦frightening and demonic possessions that are terrorizing their city. Based upon the book, which details Sarchie's bone-chilling real-life cases. (Read More)
Subgenre: | suspensesupernatural |
Themes: | murderdeathsuicidekidnappingfearpsychopathhome invasionpolice brutalitypolice investigationmurder of a police officer |
Mood: | rainneo noir |
Locations: | new york citybardesertelevatorapartmentpolice stationcavetunnel |
Characters: | catholic priesthusband wife relationshipfather daughter relationshipmother daughter relationshiptattoopriesthostagepolice detectivebiblecatholicpolice chaseself mutilationpregnantpregnant wifepolice sergeant β¦self cannibalism (See All) |
Period: | year 2010year 2013 |
Story: | demonic possessionexorcisminterrogationbloodflashbackdogbare chested malecigarette smokingphotographknifesurprise endingpistolbased on true storycell phonebeating β¦corpseshot to deathblood splattershot in the chestslow motion scenepunched in the facewritten by directorbattlearrestheld at gunpointpianohallucinationhandcuffsfoot chaseflashlightaxestabbed to deathstabbed in the chesttied to a chairsnakeno opening creditspainterchild in perilpolice officer killedconfessioncharacter repeating someone else's dialoguebeaten to deathcharacter's point of view camera shotdeath of childlightningbasementthreatened with a knifemonkeychild murdermachismofalling down stairswhat happened to epiloguegothictape recordersecurity camerawalkie talkiecrucifixcovered in bloodanimal attackbroken legiraqmental institutioncrime scenehaunted by the pastitalian americanpartnerpower outagepool tablezoofalling to deathaquariumtime lapse photographylionjumping through a windowassault rifleknife fightbulletproof vesttough copbody landing on a carraised middle fingerabusive husbandbatbaptismplaying poolpistol whipspiral staircasenight visionhearing voicescatholicismlatinstrait jacketbleeding to deathtwo way mirrorsome scenes in black and whiteoverhead camera shotcarouseldead catbronx new york citypool of bloodwanted posterfinger gunhatchetsurveillance footageholy waterinfanticideescaped mental patientex marineexorcistdiscovering a dead bodycrossword puzzleflickering lightbloody facewriting in bloodbandaged handnypdu.s. marinestabbed in the sidechild killerdead babyfire fightwriting on a wallthick accentbitten on the armrottweilerdeath of partnerbad smellnight cityscapewalking in the rainjack in the boxsoccer gamefoaming at the mouthhandcuffed to a pipehearing noisesnight vision binocularshyenairaq veteranattacked from behindstaticdriving in reverseeating an applereference to jim morrisonbiting someonebitten on the legrecovering drug addictdishonorable dischargefalling on a carreference to the doorsafrican lionhome aquariumsecurity videosome scenes in muted colorbandaged armbrown bearwriting on a bodymale african lionhandcuffed to a chairlooking under a bedreference to the addams familygray tabby catswarm of batsreference to larry birdsymbol cut into skinblack mamba (See All) |
Alex is boarding his plane to France on a school trip, when he suddenly gets a premonition that the plane will explode. When Alex and a group of students are thrown off the plane, to their horror, the plane does in fact explode. Alex must now work out Death's plan, as each of the surviving students β¦falls victim. Whilst preventing the worst from happening, Alex must also dodge the FBI, which believes Alex caused the explosion. (Read More)
Themes: | murderdeathfearinvestigationsupernatural powerself sacrificenear death experiencefear of deathcheating death |
Mood: | gorerain |
Locations: | beachparis francebathtubairportairplane accidentbicycle accident |
Characters: | teenagerboyfriend girlfriend relationshipbest friendteacher student relationshipamerican abroaddeath of girlfriend |
Period: | 2000s |
Story: | psychic powerextrasensory perceptioninterrogationbloodtwo word titleexplosionknifesurprise endingfirecorpseblood splatterblondecomputerbathroomfighting β¦decapitationcleavagefoot chasestrangulationdeath of friendimpalementtoiletstabbed in the chestexploding carsevered headscantily clad femalecharacter repeating someone else's dialoguedangerelectrocutionfirst of serieslightningdeath of brothertragic eventhigh school studentdeath of sonsuspicionfirst partdisasterburned alivegroup of friendsfbi agentaccidental deathdead womancrushed to deathwindbroken glasstitle appears in writingsculpturedead boycharacters killed one by onedead woman with eyes openreckless drivingnewspaper clippinghigh school teachershot in the necktelling someone to shut upwetting pantscabin in the woodspremonitiondripping bloodmale protagonistaltered version of studio logofuneral homeexploding housebutcher knifetraumatic experiencereference to michael jacksonexploding airplanejerkgas explosionvinyldead woman on floortitle appears in songmorticianfemale studentlong island new yorkmodel airplanedead teenagerhit by a bushanged boyfreak accidentomenmuscle carfield tripmass deathhead cut in halfmemorial servicehare krishnafalling treecar hit by a trainreference to jeffrey dahmersurvivor guiltjfk international airport queens new york citycar on train tracksbloody footprintclimbing through window (See All) |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β¦p her from constantly getting visions of Jessica's fate. (Read More)
Subgenre: | independent film |
Themes: | murderdeathsuicideinfidelityghostjealousyadulteryinvestigationdeceptionincestextramarital affairdeath of fathersupernatural powerunfaithfulnessmental illness β¦father daughter incest (See All) |
Mood: | rainnightmare |
Locations: | schoolcemeterysmall townbathtubwaterwoodsrural settingwheelchaircourtroomstormbackwoods |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattooboylawyersingle motherlustwitchsheriffsuicide by hanging |
Story: | psychic powerextrasensory perceptionmental breakdownpsychicfemale nudityf ratedbloodviolencefemale frontal nudityflashbackmasturbationmale rear nuditydogtwo word titlebare chested male β¦gunfightdancingphotographexplosionpartyleg spreadingpantiestelephone callfirebeatingdreamcorpsewatching tvthongbare buttsecretliedead bodysex standing uphallucinationhandcuffscleavagecandlestrangulationwomanwidowwhite pantieschild abusetrialscantily clad femaleritualunderwater scenesearchgraveyardgraveperson on fireliarmissing personbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upgrandmotherwhippingcult directortherapygarageheart attackgirl in pantiespickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sextherapistdysfunctional marriageback from the deadchokingmechanicsexual desirecamera shot of feetredneckwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondtow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniamarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All) |
After a car accident in which his wife, Debra, was killed and he was injured, Frank Bannister develops psychic abilities allowing him to see, hear, and communicate with ghosts. After losing his wife, he then gave up his job as an architect, letting his unfinished "dream house" sit incomplete for yea β¦rs, and put these skills to use by befriending a few ghosts and getting them to haunt houses in the area to drum up work for his ghostbusting business; Then Frank proceeds to "exorcise" the houses for a fee. But when he discovers that an entity resembling the Grim Reaper is killing people, marking numbers on their forehead beforehand, Frank tries to help the people whom the Reaper is after! (Read More)
Subgenre: | cult filmblack comedyparanormalsupernatural horror |
Themes: | friendshipghostfuneralsupernatural powerdeath of wifenear death experience |
Locations: | hospitalcemeterymuseum |
Characters: | serial killer |
Story: | parapsychologypsychicinterrogationbloodflashbacktwo word titletitle spoken by charactercar accidentshotgunbedcar crashmansionwidowfalse accusationjudge β¦anti herofbiwidowerhaunted housenerdfbi agentarchitectloss of wifecrying manheavencon artistsoulbulletproof vestfemale doctorfencegun held to headprison visitmatricidegrim reaperscythepoltergeistfemale journalistdefibrillationdefibrillatorafrican american manhuman asheshypothermiaabandoned hospitalghostbusterastral projectionprison visitationnumbersbuilding demolitionreference to ted bundytalking to a ghosteccentric manectoplasmreference to jesse jacksonpassing through a wallforeheaddead husband ashespsychopathic copafro hair stylecold storage roomfear of womenflickering lightsreference to john wayne gacy (See All) |
Six astronauts aboard the space station study a sample collected from Mars that could provide evidence for extraterrestrial life on the Red Planet. The crew determines that the sample contains a large, single-celled organism - the first example of life beyond Earth. But..things aren't always what th β¦ey seem. As the crew begins to conduct research, and their methods end up having unintended consequences, the life form proves more intelligent than anyone ever expected. (Read More)
Subgenre: | tragedy |
Themes: | deathfriendshipfearmonsterbrutalityevilcrueltypanicself sacrifice |
Mood: | gore |
Locations: | outer spacespacelaboratoryspace station |
Characters: | friendalienfemale scientistout of controlevil alienalien monsterevil monsteralien being |
Story: | scientific researchresearchbloodviolencetitle spoken by characterexplosionsurprise endingblood splattercomputersciencescientistsurvivalman with glassescreaturedrowning β¦dangerlong takesacrificeexperimentlifechokingastronautsurpriseextraterrestrialspace shuttletestmonitorfailuremicroscopequarantineparaplegicmistakefrightmarsriskscarespacesuitloss of controlflame throwerruthlessnesszero gravitytrapped in spaceplanet earthbroken handscientific experimentperilescape podcomputer screenspacewalkjeopardyalien life formspace probefemale astronautweightlessnessdeep spaceevil beingfirst contactextraterrestrial lifebiosphereinternational space stationtentaclesextraterrestrial beingspace missionlabevil creaturecoughing up bloodfailprotocolastronaut costumecomputer systemflesh eaterwhite mousecontrol panelspace crewlife on marsplanet marsspace helmet (See All) |
Desirous of starting a family, Rosemary Woodhouse, a young Catholic housewife, and her husband, Guy Woodhouse, a struggling actor, move into the Bramford, a New York building with an unpleasant history of obscure dwellers and ghastly occurrences. Before long, the young couple is befriended by their β¦elderly and somehow eccentric next-door neighbours, Roman and Minnie Castevets, and shortly afterwards, Rosemary finally gets pregnant. However, little by little, as the inexperienced mother becomes systematically cut off from her circle and friends, alarming hints of a well-planned and sinister conspiracy will begin to emerge, enfolding Rosemary in a shroud of suspicion and mental agony. In the end, why is everyone so conveniently eager to help, furthermore, why is Guy allowing this? (Read More)
Subgenre: | paranormal phenomenasupernatural horror |
Themes: | murderchristmassupernatural powersupernatural rape |
Locations: | cemeterycatholic churchcatholic school |
Characters: | catholic priesthusband wife relationshipmother son relationshipbaby |
Story: | psychic powerdemonic possessioncharacter name in titlebased on novelnuditybare chested malesurprise endinggood versus evilwomanchildbirthreference to william shakespearehypodermic needlewitchcraftbirthapartment building β¦reference to satansuperstitiondrugged drinkgiving birthsatanismeating disorderreference to shakespeare's hamletbutcher knifeantichristexpectant motherevil childinquisitionsatanic cultdevil worshipcovendemon rapeincantationwanting a babydrugged foodlucky charmanagramconvent schoolincubuslapsed catholicmislaid trustmutant babyherbalistdemon spawnpregnant woman in jeopardydemonic cultnewborn sonweird pregnancy (See All) |
A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.
Subgenre: | cult filmparanormal investigation |
Themes: | ghostvoyeurismsupernatural powerdysfunctional familyafterlifemissing childscience versus supernatural |
Mood: | moving |
Locations: | swimming poolcemeterykitchen |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlgirlphotographersister sister relationshiplittle girllittle boyemployer employee relationship β¦blonde girl (See All) |
Period: | 1980s |
Story: | psychic powerparapsychologypsychicone word titleinterviewpantiescorpsemirrorblondewatching tvcameralingeriemarijuananeighborhallucination β¦voyeurtelevisiongood versus evilcleavagevideo camerahousewhite pantiesscantily clad femalecoffinchild in perilclownsuburbfirst of seriesskeletonhauntingfirst parthaunted houseobscene finger gesturecult directorgirl in pantiespot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediummiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieverlifting a female into the airsource musicparanormal investigatoranimate objectgiving the fingerburial groundbike ridingparanormal phenomenonanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All) |
THE LAZARUS EFFECT follows a group of researchers led by Frank and his fiance Zoe who've achieved the unimaginable - bringing the dead back to life. After a successful, yet unsanctioned, trial on a newly deceased animal, the team is ready to unveil their breakthrough to the world. When the dean of t β¦heir university learns of their underground experiments, their project is unexpectedly shut down and their materials confiscated. Frank, Zoe and their team take matters into their own hands, launching a rogue attempt to recreate their experiment, during which things go terribly wrong and one of their own, Zoe, is horrifically killed. Fueled by terror and grief, Frank pushes them to do the unthinkable: attempt to resurrect their first human test subject. Initially, the procedure appears a success, but the team soon realizes something is wrong with Zoe. As her strange new persona reveals itself, the team quickly becomes stuck in a gruesome reality. They are no longer faced with the question of whether they can bring someone back to life- but rather, the wrath of her return. (Read More)
Subgenre: | supernaturalteen horror |
Themes: | murdersupernatural power |
Mood: | nightmareslasher |
Locations: | laboratoryapartment fire |
Characters: | doctorteenage girlteenage boysecurity guardcatholicyounger version of character |
Story: | test subjectblack eyespyrokinesistelekinesisflashbackdogsurprise endingfireslow motion scenevomitingcollegeflashlightvideo camerastabbed in the chestdream sequence β¦character repeating someone else's dialogueelectrocutionuniversitypigneck breakingexperimentsecurity cameracrucifixcrushed to deathback from the deadchokingpower outagestabbed in the neckresurrectiontitle at the endlooking at self in mirrorcharacters killed one by oneburned to deathtelepathylevitationblackoutinterracial kisscrushed headclose up of eyephonographtear on cheekvinylwoman wearing black lingeriecaged animalflickering lightstrobe lightserumextreme closeupdead teenagerdefibrillationman carrying a womandiamond ringpharmaceutical companyadrenalineberkeley californiabrain scanelectrocutedfacial cutcrucifix pendantpig maskcollege deanchoked to deathcardiopulmonary resuscitationmriwinkinghound dogdog on bed (See All) |
A visiting actress in Washington, D.C., notices dramatic and dangerous changes in the behavior and physical make-up of her 12-year-old daughter. Meanwhile, a young priest at nearby Georgetown University begins to doubt his faith while dealing with his mother's terminal sickness. And, book-ending the β¦ story, a frail, elderly priest recognizes the necessity for a show-down with an old demonic enemy. (Read More)
Subgenre: | cult filmtragedyparanormalparanormal phenomenaamerican horrorsupernatural horrorparanormal activity |
Themes: | murderdeathsuicidereligionfeardrunkennessfilmmakingangercorruptionbrutalitysupernatural powerdeath of motherparanoiagriefsadism β¦faithevilcrueltypanicself sacrificedevilmurder investigationclaustrophobiamysterious deathsupernatural being (See All) |
Mood: | goredarkness |
Locations: | hospitalbarchurchcarbathtubdesertkitchencatholic churchslum |
Characters: | catholic priestmother son relationshipmother daughter relationshipdoctorteenage girlgirlpriestchristianactresssingle motherpolice detectivepsychiatristcatholicself mutilationself destruction β¦out of controlself injuryevil girl (See All) |
Story: | seizuredemonic possessionexorcismurinationbased on novelbloodviolencepantiesbased on true storyunderwearblood splatterpunched in the facevomitingbed β¦bathroompianodemonhalloweenbedroomdeath of friendhouseaccidentman with glassesdream sequenceritualtransformationpainargumentvirgindangerpossessionstatuescreamthreatbasementfirst partloss of motherprofanityheart attackwashington d.c.occultfalling down stairssyringedestructionelectronic music scorehypodermic needleinjurytape recorderwoman with glassesjoggingragetied to a bedloss of friendcrucifixwitchcraftdesperationhomemovie directoriraqrampagewhiskeymiddle eastvisioninnocencesufferingblood on facediscussionmovie setpsychotronicdespairhypnosismedical examinationmedicationstairsabsent fatherfilm setastronautatticperversioninsultliving roomroombruiseswearingunclelevitationgreekhit in the facecar drivingsubway stationautographstaircaseadvicevulgarityx raysatanisminsomniahearing voicescatholicismconversationautumnteenage daughterpsychiatrypunching bagfamous scorefrightouija boardsuperhuman strengthmenacetormentriterisksleeplessnessanguishreference to the virgin marymedical doctornoiseholy waterblasphemyloss of controlmovie fanexorcistvoicescreenplay adapted by authorexaminationscreaming in fearskepticismsatanmovie makingemaciationbloody mouthheart conditionmousetrapcocktail partyconvulsionloss of innocenceouijaperildemonicpaganismadolescent girldiagnosisscreaming in horrorboxing gymstabbed in the crotchsubliminal messagetrailer narrated by percy rodriguezcrisis of consciencevulgar languagecrisis of faithvirgin mary statueevil forceheresyarcheological diganimate objectfurypsychological tormentskepticsign of the crossbrain scandistorted voicescotchoccupation in titleforces of eviljeopardymysterious noiseneurologistpossessed girlagnosticmedical testdesecrationex boxerinsomniaclast ritesoccultismevil beingjesuitgreek americanfalling from a windowspeaking in tonguessacrilegeritalinslurhead spinmysterious voicevirgin girldiabolicaltroubled teenage girlvirgin blooddirector actor relationshipdemonic voicespinal tapforce of evilgirl in perilnitroglycerineneurological disordersleeplessquestioning beliefsradiographytalking backwardstwisting one's head completely aroundbaffled doctordiabolical possessionpassing through a wallphysical tormentfollow shotgeorgetown washington d.c.sexual insultgeorgetown universityiv linejesuit priestrough neighborhoodrunning trackspinning headagnosticismcrab walkdemonic forcethorazine (See All) |
John and Laura Baxter are in Venice when they meet a pair of elderly sisters, one of whom claims to be psychic. She insists that she sees the spirit of the Baxters' daughter, who recently drowned. Laura is intrigued, but John resists the idea. He, however, seems to have his own psychic flashes, seei β¦ng their daughter walk the streets in her red cloak, as well as Laura and the sisters on a funeral gondola. (Read More)
Subgenre: | independent filmcult filmsuspensesupernaturalbritish horrorcult classic |
Themes: | murderdeathsurrealismmarriagedrinkingdrunkennessfuneralsupernatural powerguiltgriefmental illnessblindnesswritingdeath of daughterafterlife β¦death in childbirth (See All) |
Mood: | gorerain |
Locations: | hospitalrestaurantchurchhotelboatbicyclewaterairportrural settingpolice stationcityitaly |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipchildrenboygirlpolice officerserial killerpolicemanpriestsister sister relationship β¦villainmaid (See All) |
Period: | 1970s |
Story: | psychic powerseizurepsychicfemale nuditybloodmale nuditybare breastsfemale frontal nudityflashbackmale frontal nuditysex scenekisscigarette smokingnipples β¦photographknifechasethree word titlesurprise endingshowertelephone calltopless female nuditypunctuation in titlecorpseunderwearfoodhorsemirrorslow motion scenecatarrestbare buttlettervomitingapostrophe in titledead bodycafehallucinationprayermale pubic hairsubjective cameracandleold manambulancewomanbridgeeatingwidowfemale pubic hairnunbathpantyhoseold womandrowningflash forwardbased on short storycharacter's point of view camera shotsuitcasedollstatuereadingdeath of childcity name in titlepursuitsadnessratitalianoccultfaintingarchitectureloss of loved onebuttocksaccidental deathlossladderfatewhiskeydwarfhaunted by the pastnipplelostdeath of protagonistdead childpolice inspectorbrushing teethriding a bicyclemale objectificationapparitionimperative in titleseanceloss of daughterbroken mirrormarried couplestretchervenice italypremonitionloss of childblind womanmediummotorboatbishopcowgirl sex positionpondbleeding to deathorchestral music scorebriton abroadbloody violencedeath by drowningpsychotronic filmchance meetingdressinggrindhouse filmmurder victimtrancecanalmosaicmental instabilitybritish accentgrievingunhappy endingraincoatgondolastained glass windowfemale star appears nudegiallo esquenude pantyhosescaffoldsibling relationshipmale in a showerdeliberate crueltygrieving mothermusic score features pianoprecognitiondead daughterthe color redtalking with the dead5 year oldartificial respirationspilled drinkstray catgrieving fatherchild drowningringing a bellsleazy giallodyetalking dollwomen's restroomreference to john miltonslashed to deathaccidental drowningmale star appears nudebegins with deathmultiple sex positionsprimal screamsaint nicholasboeing 727woman faintingexsanguinationgrieving parentdrowned bodysecond sightwoman getting dressedapplying mascaraitalian flagrefusing to believechurch restoration (See All) |
Robert and Katherine Thorn seem to have it all. They are happily married and he is the US Ambassador to Great Britain, but they want nothing more than to have children. When Katharine has a stillborn child, Robert is approached by a priest at the hospital who suggests that they take a healthy newbor β¦n whose mother has just died in childbirth. Without telling his wife he agrees. After relocating to London, strange events - and the ominous warnings of a priest - lead him to believe that the child he took from that Italian hospital is evil incarnate. (Read More)
Subgenre: | paranormal phenomenasupernatural horrorchristian horror |
Themes: | murderdeathsuicidereligionfearfuneralinvestigationsupernatural powergriefadoptiondeath of wifedevildeath in childbirththe devil |
Mood: | gore |
Locations: | hospitalchurchcemeterylondon englandkitchencavegas stationstormcatholic churchairplane trip |
Characters: | catholic priestfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipchildrenboypolicemanphotographerbabypriestchristianitylittle boybible β¦american abroadsuicide by hanging (See All) |
Period: | 1970s |
Story: | dog attackdemonic possessionexorcismbloodviolencedogtwo word titlegunphotographknifesurprise endingslow motion scenefalling from heightdemonreference to jesus christ β¦decapitationgood versus evilorphanimpalementsevered headnuncoffinchild in perilbirthday partygraveyardgravestalkerfirst of seriespossessionlightningu.s. presidentskeletonhangingamerican flagfirst partnewspaper headlinechild murderoccultfireplacebulletgothicrome italylifting someone into the airloss of wifevillainessblockbustermonkanimal attackreincarnationstabbed in the throatmillionairezoobroken glassreference to satanbible quotedeath of protagonistbody landing on a cardead woman with eyes opendaggernewspaper clippingmiscarriagenannygothbeheadingmysticismmonasteryjerusalemambassadorunsubtitled foreign languagemoving infamous scoredarkroomdisfigured facedead wifealtardiplomatburn victimantichristcasketevil childexorcistbirthmarkdeath by hangingarmageddonluciferbible prophecygovernesstricyclerottweilerchild murdererlifting male in airdevil worship666english accentomentrailer narrated by percy rodriguezdeath by impalementhorror movie remadearcheological digbaboonbook of revelationpushed down stairscharacter appears on front page of a newspaperfacial disfigurementswitched at birth5 year oldends with funeralstillborn childphotograph in newspaperevil dogbaby switchjackalflatbed trucklightning rodends with a quotepaternosterreligious sacrificeamerican ambassadorphotography darkroompublic suicide (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | independent filmcult filmsuspensesupernaturaltragedyparanormalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror |
Themes: | murderdeathlovesurrealismsuiciderapechristmasfearinvestigationdeceptionpsychopathsupernatural powerdeath of motherparanoiablackmail β¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All) |
Mood: | neo noirslasher |
Locations: | hospitalschoolchurchsnowwheelchairpolice cartrucktunnelschool teacherfire truck |
Characters: | husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officerserial killernursephotographerbabylittle boyvillainpsychiatrist β¦snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All) |
Period: | world war two1980s1970swinterseeing the future |
Story: | psychic powerextrasensory perceptionpsychicfemale nuditybased on novelbloodflashbackkissphotographtitle spoken by characterexplosionchasesurprise endingpistolfire β¦shootoutdreamcorpseshot to deathblood splattercar accidentshot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffsrevolvertelephonef wordreportergood versus evilflashlightambulancemansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestcult directorsacrificenewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmanmaniaccold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomamutilationexploding buildingloss of wifepress conferencesevered handgrindhouseambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerbad guyteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingoverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
In October 2012 a video footage is found at the home of Malcolm Johnson and the recordings are still unexplained. Past this prologue a story in flashback form unfolds. During the summer of 2012, Malcolm and Kisha move in together and start a happy life. One night Kisha notices a few unexplained phen β¦omena that convince her their house is haunted by ghosts. To allay her fears Malcom hires a camera crew to film inside the house day and night. A few nights later Malcom and Keisha have sex on camera, despite Keisha's protests at being filmed. Upon reviewing the sex tape the next day, Malcom and Keisha notice a few paranormal phenomena caught on tape. Malcom wants to sell the house but the housing market is slow. Therefore, Malcom decides to hire a psychic to come to the house and investigate. After Kisha confesses to making a deal with the devil for a pair of shoes things start to make sense but it doesn't solve the problems caused by the paranormal phenomena. (Read More)
Subgenre: | supernaturalfound footage |
Themes: | ghost |
Mood: | spoofparody |
Locations: | swimming poollos angeles california |
Characters: | boyfriend girlfriend relationshippriestyounger version of charactersex with a ghost |
Period: | year 2012year 1988 |
Story: | demonic possessionpsychicurinationfemale nudityflashbackmasturbationmale rear nuditybare chested maleinterracial sexpistolbeatingshot to deathshot in the chestface slap β¦punched in the facebikinisubjective cameravideo cameracocainehit by a carbirthday partycharacter repeating someone else's dialoguecharacter says i love youfalling down stairskilling an animalkicked in the stomachflatulencerear entry sexswitchbladetitle at the endhousekeeperwritten by stardead dogmarijuana jointstuffed animalwebcamnight visionanal rapemale rapehamburgerman punching a womanouija boardwoman in a bikiniwoman slaps a manfemale sitting on a toiletbegins with textwriting in bloodsex on a tabletime stamp (See All) |
Reiko Asakawa is researching into a 'Cursed Video' interviewing teenagers about it. When her niece Tomoko dies of 'sudden heart failure' with an unnaturally horrified expression on her face, Reiko investigates. She finds out that some of Tomoko's friends, who had been on a holiday with Tomoko the we β¦ek before, had died on exactly the same night at the exact same time in the exact same way. Reiko goes to the cabin where the teens had stayed and finds an 'unlabeled' video tape. Reiko watched the tape to discover to her horror it is in fact the 'cursed videotape'. Ex-Husband Ryuji helps Reiko solve the mystery, Reiko makes him a copy for further investigation. Things become more tense when their son Yoichi watches the tape saying Tomoko had told him to. Their discovery takes them to a volcanic island where they discover that the video has a connection to a psychic who died 30 years ago, and her child Sadako... (Read More)
Subgenre: | cult filmsuspensemurder mysteryjapanese horror filmsupernatural horrorasian horrorparanormal investigation |
Themes: | murderfriendshipsurrealismghostfearinvestigationcorruptionsupernatural powerparanoiasadismcrueltypanicmysterious death |
Mood: | gorenightdarknesshorror movie remake |
Locations: | carjapanlog cabin |
Characters: | father son relationshipmother son relationshipfather daughter relationshipfriendteenage boyfemale protagonistteachersingle motherjapanesecousin cousin relationshipghost girlmysterious girlghost in mirror |
Period: | 1990s1950s |
Story: | extrasensory perceptionpsychicinterrogationbased on novelone word titleinterviewflashbackphotographsurprise endingtelephone callfiremirrorface slapremakedead body β¦hallucinationtelevisiontelephonescientistreportergood versus evilflashlightjournalistaxedeath of friendbrunettefishingchild in perilsearchpaincursescreamingumbrellaskeletonstalkingfirst partkillingundeadmass murdervideotapedesperationpsychologistorphanagedead womanhomicidetokyo japansufferingpastmutevolcanodead manrainstormdisfigurementdead woman with eyes opendivorceepsychoticdead girlasiasuffocationconfusiondark secreturban legendlong hairpictureloss of daughterpolaroidsilentwellfalling into waterschoolboyflydying manroad accidentbody bagmurder witnessmacabreflamewakefather son estrangementmultiple murderwatching a videofemale victimoff screen murdercrime investigationhoodmurder victimdeeply disturbed personevil childexaminationburnmultiple homicideferry boathusband wife reunionfamily in dangerevil powervhs taperemadesubliminal messagemass deathhorror movie remadepsionic powerstrange personburn injurychopstickfear of ghoststicking clockendless loopwoman journalistdeath starefractured skullvolcanic islandtelevision as portal (See All) |
On their way back home during the spring break, Darry and Patricia Jenner witness a mysterious person dumping something down a tunnel. Deciding to discover what was dumped down there, Darry discovers a huge disturbing hideout full of modified bodies. Darry and Patricia set off to get help, unaware t β¦hat the individual is now aware of who has been down the tunnel. Darry and Patricia soon realizes that their pursuer is not just a mysterious person, but something even more horrifying, who has more in store than they could possibly imagine. (Read More)
Themes: | murderdeathfeartorturemonstermurder of a police officer |
Mood: | gorecar chase |
Locations: | churchsmall townpolice stationroad tripsinging in a car |
Characters: | policetattoobrother sister relationshipserial killer |
Period: | 2000s |
Story: | psychic powerpsychicurinationcharacter name in titlebloodtwo word titlebare chested maletitle spoken by charactersurprise endingpantiespistolcorpseunderwearblood splatter β¦car accidentcatwritten by directorthongfalling from heightdemondecapitationaxedinersevered headno opening creditshit by a carpolice officer killedblack pantiesscarfirst partsevered armrecord playermass murdertitle based on songfloridaeaten alivehit in the crotchjumping through a windowblood on shirtone dayeye gougingbody landing on a cardead boybriefsloss of brothersurprise after end creditscrowbandageselfishnessdouble barreled shotgunrhyme in titlepipescarecrowtwo way mirrorheart ripped outnight timebreaking through a doorcut handsevered footvillain not really dead clichewingslifted by the throatrun over by a carsevered tongueskinned alivelicense platejump scaretitle mentioned in songclimbing up a wallhole in chestscaredman eating monstergrabbed by the throattongue rippingindestructibilitywrapped in a bedsheetlights suddenly go outrunning a car off the roadcat ladyteenager in dangerramming a carpurposely hit by a carwinged creatureprophetic dreambat wingsstartled by phonewinged demon (See All) |
Something has gone wrong at a remote scientific research station on Mars. All research has ceased. Communication has failed. And the messages that do get through are less than comforting. It's a level 5 quarantine and the only souls allowed in or out are the Rapid Response Tactical Squad - hardened β¦Marines armed to the teeth with enough firepower to neutralize the enemy...or so they think. (Read More)
Subgenre: | martial artssuspense |
Themes: | murdersuicidemonsterheromilitarybrutalitywrestlingfuture war |
Mood: | gorebreaking the fourth wall |
Locations: | wheelchairbaseballouter spacelaboratorysewer |
Characters: | tattoobrother sister relationshipzombiesoldieralientough guyaction heroself mutilationbabe scientisthuman versus monster |
Period: | 21st century2020s |
Story: | scientific researchelectric shockresearchbloodviolenceone word titlegunfightknifechasesurprise endingpistolshootoutcorpseshot to death β¦blood splatterfistfightmachine gunshot in the chestblondeshot in the headslow motion scenegunfightbrawlfalling from heightvomitinghand to hand combatcombatscientistshot in the backsubjective cameradecapitationgood versus evilsurvivalfoot chaseambushmassacreimpalementmixed martial artsaccidentsevered headanti herodisarming someonefictional warcreatureshot in the foreheadduellocker roomelectrocutionmissiontough girlopening action sceneexploding bodydie hard scenariomercenarysevered armbare chested male bondagemonkeychainsawmachismogrenadekilling an animalmousesergeantsevered handmexican standoffback from the deadgun battlealien invasionbased on video gameescape attemptspecial forcesexploding headdark heroautopsywisecrack humorcommandoslaughtersevered leggatling gunteleportationlaser gunmain character diestorso cut in halfclose up of eyesvillain played by lead actorstabbed in the handfirst person shooterbullet balletcommando unitcommando missionbehind enemy linesgun duelbitten in the neckaltered version of studio logotop secretshot through the mouthquarantineshot in the throatparaplegiccommando raidcut into pieceselevator shaftimmolationmars the planethatchetstarts with narrationcaged animalcorporate crimesevered earaxe in the headstudio logo segues into filmarsenalsuperhumanhero kills a womanmartiansuper soldierdefibrillationfirst person perspectivespace marine2040smultiple monstersshot in the buttsign of the crossminigungenetic mutationportal to hellhigh tech weaponshumanoid monsterattack helicoptersearch and destroy (See All) |
After causing an accident that left his daughter Christiane severely disfigured, the brilliant surgeon Dr. Genessier works tirelessly to give the girl a new face. He does so however by kidnapping young women and attempting face transplants. He has been woefully unsuccessful to date. The doctor's wor β¦ld begins to collapse around him when his daughter realizes just what he has been doing. (Read More)
Themes: | murderdeathlovesuicidekidnappingescapefuneralinvestigationlonelinessdepressionguiltfaithhopedeath of wifetrauma β¦police investigationradiation (See All) |
Mood: | goreraineuro noirnoir |
Locations: | hospitalrestauranttraincemeteryairplaneparis francebuspolice stationfrancelaboratory |
Characters: | policefather daughter relationshipdoctorboyserial killernursestudentdetectivepriestprofessorsecretaryfrenchdaughtersuicide by jumping |
Story: | researcherdog attackelectric shockresearchbased on novelblooddogkisscigarette smokingphotographtelephone callcorpsefoodcar accidentmirror β¦face slapsecretfalling from heightmaskpaintingliecafesciencescientistsubjective camerawinecandlemansionstabbingeatingaccidentdrivingtrialbirdradiocontroversygraveyardnecklacedrowningscreamingsuburbliarcharacter's point of view camera shotmistaken identitysuitcasemissing personcollege studentscardisappearancecountrysidestalkingratfreeze framemaniacsurgeryexperimentapplausewaiterwoundlistening to musicfaintinghatmorguepress conferencefollowing someoneshopliftingstabbed in the throatstabbed in the neckmedical examinationhit on the headbookstoredisfigurementsurgeonreckless drivingchloroformmoral dilemmatombbarking dogface maskplastic surgerybandageschemeeiffel tower parislecturestairwayestateinventiondisposing of a dead bodyx rayburnt faceunconsciousnessscalpelkidnapperpearl necklacecountry housedisfigured faceoperationbechdel test passedtraumatic experiencepencilpart of the body in titleswindledovemedical professionmad doctorcryptman slaps womansurgical operationmissing girlweepingcaged animalportrait paintingsecret doorhidden roompick axereference to pablo picassosecret passagewayskinhospital gownrailroad crossingobituaryoperating roomscarred faceseine riversidewalk cafetransplantbirdcagemedical clinicsecret laboratorydragging a dead bodyguinea pigrejuvenationdead body in a car trunkcarrying a dead bodycaptive womansanatoriummigrainewreathgrand guignolidentificationface woundbitten by a dogdoctor nurse relationshipulcerwanting to diekilled by a doghemorrhageweeping womanrotting fleshfuneral wreathtransplantationexsanguinationfalse identificationantibodycombing one's hairelectroencephalogramnecrosisface bandageskin graftstabbed with a scalpelface transplantyoung women (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensedark fantasychristian horrorreligious horror |
Themes: | murderdeathsurrealismkidnappingreligionbetrayaljealousyfearescapefuneralinvestigationdeceptionpsychopathbrutalitysupernatural power β¦paranoiadepressioninsanitysadismevilhopepanicdyingapocalypsecannibalismhomelessnessdevilmurder of a police officernear death experienceghost townreligious conflict (See All) |
Mood: | neo noirarchive footagedarkness |
Locations: | hospitalschoolchurchcemeterysmall townlos angeles californiadesertapartmentpolice stationpolice carrooftopcatholic churchschool busschool teacher |
Characters: | catholic priestpoliceteacherzombiegirlsoldierpolice officernursedetectivepolicemanpriesthostagechristianlittle girlnative american β¦waitresschristianitypolice detectiveteacher student relationshipbiblesheriffgrandmother granddaughter relationshiphomeless mancoronerdeath wish (See All) |
Period: | 1990s |
Story: | pyrokinesisdemonic possessionexorcismmind controlbloodviolenceflashbackgunkissfightcigarette smokingphotographtitle spoken by characterexplosionknife β¦surprise endingfirevoice over narrationcryingbeatingcorpseshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewritten by directorbrawlfalling from heightshowdownheld at gunpointsunglassesdead bodydemonhallucinationhandcuffsprayerrevolvershot in the backgood versus evilsurvivalorphanflashlightcaliforniaambulanceimpalementsuicide attemptdinerdisarming someonecoffinnarrationchild in perilhit by a carfictional wardouble crossritualpolice officer killedgraveyardshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerperson on fireliarfirst of seriesmissionpossessionangelrace against timestatuecover upevil manknocked outskeletonmanipulationexploding bodyfirst partprofanitygrandmothernewspaper headlinekillingundeadhenchmanpizzamaniacpickup truckburned aliveelectronic music scoregothicshot in the stomachsociopathscene during opening creditsmorgueskullcolonelback from the deadcrime scenevisioncynicismcannibalmercilessnessresurrectionprophecyreference to satanbible quoteheavenhit on the headpunched in the chestjumping through a windowthrown through a windowautopsyaerial shotarizonachoirsoulhealingeye gougingtribebody landing on a carkilling spreeburned to deathnewspaper clippinglyingarrogancetelepathyclose up of eyesgothporn magazineliving deadlevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyshamanburnt bodybadgemaggotsymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingchantingtauntingchild with a gungrand canyoncourt martialluciferinvulnerabilitysatanhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithkorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintpersonification of satandark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All) |
In Baton Rouge, Louisiana, the evangelical Reverend Cotton Marcus was raised by his father to be a preacher. He agrees that the filmmaker Iris Reisen and the cameraman Daniel Moskowitz make a documentary about his life. Cotton tells that when his wife Shanna Marcus had troubles in the delivery of th β¦eir son Justin, he prioritized the doctor help to God and since then he questions his faith. Further, he tells that exorcisms are frauds but the results are good for the believers because they believe it is true. When Cotton is summoned by the farmer Louis Sweetzer to perform an exorcism in his daughter Nell, Cotton sees the chance to prove to the documentary crew what he has just told. They head to Ivanwood and they have a hostile reception from Louis's son Caleb. Cotton performs the exorcism in Nell, exposing his tricks to the camera, but sooner they learn that the dysfunctional Sweetzer family has serious problems. (Read More)
Subgenre: | cult filmmockumentaryfound footagedocumentary filmmaking |
Themes: | murderdeathreligionpregnancyfeardeceptiondeath of motherdeath of wife |
Mood: | gorerain |
Locations: | hospitalchurchhotelrural settingfarmroad triptruck |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipbrother sister relationshipbiblegay teenagerself mutilationpregnant teenagerevil priest |
Story: | demonic possessionexorcismbloodinterviewphotographknifesurprise endingfirecatlettervomitingheld at gunpointbedcafedemon β¦subjective cameradecapitationgood versus evilfoot chasebound and gaggedcandleaxethroat slittingmodeldrivingno opening creditsdrawingchild in perilvantalking to the cameragravecharacter repeating someone else's dialoguebeaten to deathwidowerdollactor shares first name with characterthreatsuspicioncharacter says i love youblindfolddismembermentanswering machinekilling an animallooking at oneself in a mirrorbarncrucifixfraudcovered in bloodpreacherbootscynicismgash in the facehandheld camerapastornewspaper clippinglyingblood on camera lensteenage pregnancymagic tricklouisianadead animalflutehuman sacrificesouthern u.s.farmhouseno title at beginningdouble barreled shotgunstethoscopelatinreverenddead catpentagramlocked in a roomcut handscythefetusdocumentary crewexorcistcard trickdocumentary filmmakershacklesbroken fingersatanic cultsatanic ritualoverprotective fatherloss of faithhearing aidsouthern gothickilling a catcrisis of faithhome schoolinglivestockboiling waterfarm liferecorderno background scorechained to a bedrare bookbaton rouge louisianaqueen of heartssecret pregnancyquestioning beliefs (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
Themes: | murderdeathsurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigationangercorruptionpsychopath β¦death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
Mood: | gorenightslasherdarkness |
Locations: | hospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car β¦cityitalytruck (See All) |
Characters: | homosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlserial killerpolicemanmusicianactress β¦killervillainpsychiatristmaidprofessorjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All) |
Period: | 1970s |
Story: | psychic powerparapsychologyextrasensory perceptionpsychicbloodviolenceflashbacktwo word titlegunkisscigarette smokingphotographsingingknifechase β¦surprise endingtelephone callfiresongshootoutbeatingcorpseblood splattermirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective cameradecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxestabbingimpalementstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directoreuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrebourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeigncult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
In December 1975, George and Kathy Lutz along with their three children move into an elegant Long Island house. What they don't know is that the house was the site of a horrific mass murder a year before. They decide to keep the house and attempt to keep the horror in the past, but are now haunted b β¦y a murderous presence. This is until, George starts to behave weirdly and their daughter, Chelsea starts to see people. What follows is 28 days of sheer, unbridled terror for the family with demonic visions of the dead. Based on the true story of George and Kathy Lutz, The Amityville Horror remains one of the most horrifying haunted house stories ever told - because it actually happened. (Read More)
Subgenre: | ghost story |
Themes: | murderdeathsuicideghosttortureparanoiainsanitymurder of family |
Mood: | nightmarearchive footagehorror movie remake |
Locations: | restaurantbathtubkitchenrooftop |
Characters: | catholic priestfamily relationshipshusband wife relationshipmother son relationshipmother daughter relationshipteenage girlteenage boypriestlittle girllittle boystepfather stepdaughter relationshipstepfather stepson relationship |
Period: | 1970s |
Story: | demonic possessionurinationsexbased on novelblooddogbare chested malegunchasepantiesblood splatterremakeshot in the headshotgunslow motion scene β¦falling from heightvomitingrifleplace name in titlemarijuanashot in the backaxethroat slittingsuicide attemptchild in perilshot in the foreheadattempted murderpossessionscreambasementunderwaterhaunted housenewspaper headlinechild murderoccultpot smokingkilling an animalbabysittercovered in bloodteddy bearfamily dinneraxe murderalarm clockdead dogdead girlreal estate agentbonghead woundmotorboatpotbullet woundmoving inrealtorholy waterbloody body of a childchild killedtortured to deathtorture chamberfamily in dangerbased on supposedly true storyabusive stepfatherable to see the deadwood choppinglocked in a closetchild shotmeat hookburial groundchild shot in the headboathousechild knocked unconsciouslakesidehole in the wallhanged childvillage name in titlebackwardsdeath of a petinsect attackwalking on a roofancient burial groundrefrigerator magnetmonster in mirrorupside down crucifix (See All) |
Archeologist Lankester Merrin is asked to go to East Africa to excavate a church that has been found completely buried in sand. Merrin is also an ordained Roman Catholic priest who, still haunted by what he was forced to do during World War II in his native Holland, eschews any religion or belief. H β¦e's fascinated by what he finds and that it dates hundred of years before Christianity was introduced to the area. Accompanied by a young priest, Father Francis, to keep an eye on the religious elements of what they find, Merrin makes his way to the camp. There he meets a young doctor, Sarah and soon realizes there is an air of gloom that envelops the entire site. Workmen go mad and a young boy is mauled by a pack of hyenas while completely ignoring his younger brother Joseph. Inside the church itself they find signs of desecration. Merrin is forced to re-examine his lack of faith and come face to face with the devil. (Read More)
Subgenre: | psycho thriller |
Themes: | murdersuicidereligionfaith |
Mood: | gore |
Locations: | churchcemeterytunnelcatholic church |
Characters: | tattoopriestchristianityself mutilationmilitary officerex priest |
Period: | 1940s |
Story: | seizuredemonic possessionexorcismpsychicbased on novelbloodflashbacksurprise endingshowercorpseshot in the headswordcafedemongood versus evil β¦candlemassacrethroat slittingimpalementstabbed in the chestsubwaysevered headdream sequencechild in perilgraveyardattempted murderstabbed in the backprologuetentmonkeychild murderoccultfalling down stairsmass murdercrucifixfourth partanimal attackbroken legclockiraqeaten aliveloss of sonstabbed in the throatshovelstabbed in the headreference to satanbutterflyatticeye gougingdisfigurementlanternbroken armloss of husbandprequelcrowgothgiving birthdonkeycrucifixiongun in mouthlighterplaguehanging upside downmind gameholocaust survivorflyartifactinfertilitypunching bagatrocityhanged manmaggotarcheologistidolkenyasubterraneandogfightsecret passagerelicholy watergrave diggingexorcisttarot cardhorse drawn carriagealternate versionholy communionpick axecairo egyptpaganexhumationbroken fingerfuneral pyresandstormdevil worshipleechpaganismloss of faithexcavationsanitariumclergyarcheological dignative tribeanimate objectfoaming at the mouthhyenaprojectile vomitingyear 1949horror movie prequelphysical examrope ladderstillborn childacting outforgecgi animal in live action filmdrawing bloodshooting movielepidopteristanimal senses evil (See All) |
Christine Brown is a loans officer at a bank but is worried about her lot in life. She's in competition with a competent colleague for an assistant manager position and isn't too sure about her status with a boyfriend. Worried that her boss will think less of her if she shows weakness, she refuses a β¦ time extension on a loan to an old woman, Mrs. Ganush, who now faces foreclosure and the loss of her house. In retaliation, the old woman place a curse on her which, she subsequently learns, will result in her being taken to hell in a few days time. With the help of a psychic, she tries to rid herself of the demon, but faces several hurdles in the attempt. (Read More)
Subgenre: | cult filmdark fantasygross out comedysupernatural horror |
Themes: | revengefearfuneralangersupernatural powerevilpanictrauma |
Mood: | rainnightmare |
Locations: | cemeterylos angeles californiakitchen knife |
Characters: | father son relationshipmother son relationshipboyfriend girlfriend relationshipfemale protagonistsecurity guardwitchyounger version of charactercountry girl |
Period: | 1960s2000s20th century21st centuryyear 1969year 2009 |
Story: | demonic possessionexorcismpsychicbare chested malefightsurprise endingcell phonedreamcorpseblood splatterblondecatfalling from heightcar crashdemon β¦hallucinationmansiondinerchild in perilritualgraveyardgravecurseprologuedeath of childbankcult directorsacrificesubtitled scenespiritkilling an animalmachetecakelifting someone into the aircrucifixwitchcraftdesperationcovered in bloodpsychologistrailway stationparking garagegoatambitiongypsybloody nosestabbed in the throatdark humorco workerhit on the headdeath of protagonistexploding headshadowtitle at the endvegetarianeye gougingwedding ringstabbed in the eyefortune tellerengagement ringshamejewelrylevitationinsecurityhit in the faceimperative in titleseancebeggaranimal abusekittenflyeyeballcrushed headmediumcollege professorhumorpawnshopeating disorderhit with a shoveldigging a gravebeggingweight losshungarianextreme close uppoltergeistthrown from a carenvelopedutch anglejob promotionmortgagespaniardskepticismbitten handhandkerchieffalse teethentityobituarybreaking a car windowlifting a female into the airrich familystartledwind chimeanimal sacrificevomiting bloodpossessed humananvilsplit lipstaplerchoke holddenturesespdefenestrationseven deadly sinspasadena californiabank employeesleeping womanclosing eyes of dead persongross outillustrationseerhand through headpush buttonloan officerunderground parking garagepulling hairovercoatpalm readervisual impairmentcoin collectionorgan musiciron gatelevitatingfalling onto train tracksmexican womanbank officersteamer trunkassistant managerdigging up a dead bodyforced decisionphysical assault (See All) |
Rose Hathaway is a dhampir, half-vampire and half-human, who is training to be a guardian at St Vladimir's Academy along with many others like her. There are good and bad vampires in their world: Moroi, who co-exist peacefully among the humans and only take blood from donors, and also possess the ab β¦ility to control one of the four elements - water, earth, fire or air; and Strigoi, blood-sucking, evil vampires who drink to kill. Rose and other dhampir guardians are trained to protect Moroi and kill Strigoi throughout their education. Along with her best friend, Princess Vasilisa Dragomir, a Moroi and the last of her line, with whom she has a nigh unbreakable bond, Rose must run away from St Vladimir's, in order to protect Lissa from those who wish to harm the princess and use her for their own means. (Read More)
Subgenre: | martial artscoming of ageblack comedyteen romancevampire comedy |
Themes: | murderdeathlovefriendshiprevengesurrealismkidnappingbetrayalfeartorturedancedeceptionmagicsupernatural powerparanoia β¦redemptionsurveillancerivalry (See All) |
Mood: | high schoolnightmarehalf vampire |
Locations: | hospitalschoolchurchhelicoptermotorcyclecemeterybuswoodscaveschool teachersuv |
Characters: | father daughter relationshipteenagerfriendboyfriend girlfriend relationshipteenage girlteenage boyfemale protagonistteacherpriesttough guylove trianglevampirewarriorbest friendbully β¦villainteacher student relationshipolder man younger woman relationshipvampire girl (See All) |
Period: | 2010s |
Story: | psychic powerpyrokinesismind controlinterrogationbased on novelbloodviolenceflashbacktwo word titlekissfightphotographtitle spoken by characterpartyknife β¦surprise endingpistolvoice over narrationdreamshot to deathfistfightcar accidentshot in the chestrescueslow motion scenecatarrestkissingbrawlhand to hand combatcar crashhandcuffsclassroomgood versus evilstrangulationmountainmansionmontagestabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequencedouble crosscreatureroommatefemme fatalepantyhoseprincessnecklacetransformationon the runtraininglibrarycharacter repeating someone else's dialoguedangerstabbed in the backperson on firecover uptough girlgymdeath of brotherbodyguardbasementlaptopneck breakingqueenpowerstylized violencerunawaysisterundergroundsabotagesyringewolfloyaltyhypodermic needlesecurity camerajail cellaction heroinefemale warriorgirl with glassesbackpackstabbed in the throatshopping mallescape attemptmentorschool uniformlaughterwisecrack humoryoung loveprison cellgeekcrowpractical jokespelldead animalfemale teachertwist endingblack pantyhosefemale friendship17 year oldstabbed in the armfemale vampireschool principalbitten in the neckmonitorguardianoregonopen endedcurecelldead cattwistlesbian subtextvampirismblack dressmind readingpet catanti heroineglowing eyesmontanastrengthmagical girlmagical powerblood drinkingwriting in bloodacademyjudo throwhigh fivestakeblood transfusionrepressed memoryhidden doornunchucksexploding motorcycledeath of petstained glass windowbased on young adult novelsedativeheadmistressvampire bitecomputer discadrenalinetightshealing powerreference to jimmy carterrunaway teenfemale narratorhalf humanvampire versus vampirechild vampirepsychic linkwrist bandageblack tightspsychic visionroyalwriting on walltattoo on neckvampire teethlicking bloodstake through the heartvampire stakedcamera footagedrinking fountainanimal on fireteenage vampiredhampirneck bitepsychic girl (See All) |
An American girl, Isabella, sets out to make a documentary to understand what happened to her mother who murdered three clergy people. She was not convicted due to insanity and was sent to a mental hospital in Italy. Isabella meets with some priests in Italy who explain that her mother's condition m β¦ay not be medical, but could be an extra-human possession. (Read More)
Subgenre: | mockumentaryfound footage |
Themes: | murderdeathsuicide |
Locations: | hospitalchurchairportcatholic church |
Characters: | catholic priestmother daughter relationshippriestprofessoramerican abroadself mutilation |
Period: | year 1989year 2009 |
Story: | demonic possessionexorcismbloodthree word titlesurprise endingpistolcorpseblood splattercar accidentcar crashprayersubjective cameraflashlightvideo cameranun β¦no opening creditschild in periltalking to the cameracharacter repeating someone else's dialoguepossessioncrossbasementsubtitled scenefreeze frameitalianrome italytied to a bedcrucifixmental institutioncrime scenemental hospitalplaneasylumblood on camera lensvideo surveillancegun in mouthbaptismfilm starts with textpsychiatric hospitalshot through the mouthnewscastvaticanholy waterends with textno endingdocumentary crewexorcistno survivorsthroat rippingmental asylumskepticvatican citymurdered priestattempted drowningcontortionistcrucifix pendantbanging head against walldislocated shoulderrope around neckinjected in neckbroken chairdilated pupil (See All) |
It's a drug that promises an out-of-body experience with each hit. On the street they call it Soy Sauce, and users drift across time and dimensions. But some who come back are no longer human. Suddenly a silent otherworldly invasion is underway, and mankind needs a hero. What it gets instead is John β¦ and David, a pair of college dropouts who can barely hold down jobs. Can these two stop the oncoming horror in time to save humanity? No. No, they can't. (Read More)
Subgenre: | cult film |
Themes: | ghostmonster |
Mood: | gore |
Locations: | restaurantchinese restaurant |
Characters: | police |
Story: | psychic powerpsychicfemale nuditycharacter name in titleblooddogcell phonef wordjournalistaxesnakeclaim in titledrug β¦friendship between menspidermale underwearinvasionalternate realityslackerwilhelm screambullet timebeheadingmeatmale friendshipportalbugmale in underwearable to see the deadalternate universeout of body experienceprosthetic handhelping a friendmultiple dimensions (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
Subgenre: | independent filmsuspense |
Themes: | murderdeathlovesuicidekidnappingghostpregnancydrinkingfeardrunkennessfuneralmemoryobsessionsupernatural powerparanoia β¦drug usedysfunctional familyguiltafterlife (See All) |
Mood: | rainnightmaremurder suicide |
Locations: | cemeterybathtubchicago illinois |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipchildrenboyteenage girlteenage boypolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationshipsuper hero β¦seeing a ghost (See All) |
Story: | psychic powerextrasensory perceptionpsychicsexbased on novelbloodbare chested malegunfemale rear nudityfightpartyknifeerectioncryingsong β¦woman on topcorpseshot to deathblood splattershot in the chestwatching tvdrinksecretshootingvomitingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backsubjective cameraflashlightbandambulancesuicide attempthousenonlinear timelinecoffinsearchgraveyardtalking to the cameragraveproduct placementmissing personcover upattempted rapedisappearancesleepinghaunted housegamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewblood on faceunderage drinkingshoveldelusionhypnosissuperstitionfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismbreaking a windowhearseloss of sisterfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
In 1977, paranormal investigators Ed and Lorraine Warren travel to London, England, where single mother Peggy Hodgson believes that something evil is in her home. When Peggy's youngest daughter starts showing signs of demonic possession, Ed and Lorraine attempt to help the besieged girl, only to fin β¦d themselves targeted by the malicious spirits. (Read More)
Subgenre: | supernaturalparanormalparanormal phenomenaparanormal investigationparanormal activity |
Themes: | lovechristmasghostfeardeception |
Locations: | london englandengland |
Characters: | husband wife relationshipteenage girlpriestlittle girlsingle mothercatholicterror |
Period: | 1970syear 2003year 1976 |
Story: | demonic possessionpsychicsequelinterviewbased on true storyshot to deathpaintingsecond partdemonaxehousenunno opening creditschild in periltransformation β¦screamingpossessiontentchristmas treescreamcrossbasementhauntinghaunted houserecord playertape recorderrecordingtied to a bedcrucifixnosebleedwatching televisionarchival footagethunderstormchairteleportationreference to elvis presleynarrated by characterlevitationseancebroken windowcatholicismpremonitionsoccer ballouija boardwoman smokerphonographends with biographical notesstarts with narrationrosaryjumping out a windowsing alongarchival photographscreaming in fearfalse teethmale singerjumping ropebreaking down a doorbased on supposedly true storyvideo recordingstutterconvulsiontalking to the deadspeech impedimentdriving in the rainswing setparanormal investigatorjump scareskepticdenturespsychokinesisvoice recordingsprayed with watercrucifix pendantbite markfalling out of bedblurry visionhiding under the coverslocked in jailwoman screamingbegins with historical notesrosary beadsspecterhavocstuttering charactertelevision statictoy truckchild shot in the backparanormal experthyperventilatingbrick thrown through a windowdownpourflooded basementupside down crossamityvillesitting on a swingzoetropepulled underwaterspeaking in another voiceupside down crucifixflickering lightstalkshow (See All) |
After trying to connect with her dead mother, teenager Quinn Brenner, asks psychic Elise Rainier to help her, she refuses due to negotiate events in her childhood. Quinn starts noticing paranormal events happen in her house. After a vicious attack from a demon her father goes back and begs Elise Rai β¦nier to use her abilities to contact the other side in hope to stop these attacks by this furious demon content for a body. (Read More)
Subgenre: | supernatural |
Themes: | ghostgrieftheatredeath of wifenear death experience |
Locations: | hospitalwheelchairapartment |
Characters: | father son relationshipfather daughter relationshipteenagerbrother sister relationshipneighbor neighbor relationshipactor director writer |
Story: | demonic possessionpsychicflashbackdogphotographsurprise endingwritten by directordemonflashlightstrangulationsuicide attemptno opening creditshit by a carthird partcharacter repeating someone else's dialogue β¦auditionpossessiondiarydirectorial debuthead buttapartment buildingbloody nosepet dogvegetarianlanterndeath of loved oneprequelseancenight visionbellmediumneck braceblogfootprintfalling through the floorghost hunteroxygen maskwoman in a wheelchairhelium balloonmohawkbox cutterleg casthit with a wrenchupside downleg in castfractureemergency surgeryhanging out a windowmalevolent entityvacant apartmentknocking on a wall (See All) |
A sinister secret has been kept in the basement of an abandoned Los Angeles church for many years. With the death of a priest belonging to a mysterious sect, another priest opens the door to the basement and discovers a vat containing a green liquid. The priest contacts a group of physics graduate s β¦tudents to investigate it. Unfortunately, they discover that the liquid contains the essence of Satan himself, and they also discover that he will release HIS father - an all-powerful Anti-God! The liquid later comes to life itself, turning some of the students into zombies as the Devil comes forward to release his father. Will these students be able to stop him? (Read More)
Subgenre: | cult filmblack comedysuspensesupernaturalsupernatural horrorchristian horror |
Themes: | murderdeathsurrealismsuicidereligionpregnancyfearescapedeceptionsupernatural powerparanoiafaithunrequited loveapocalypsephilosophy β¦self sacrificedevilnear death experiencescience versus supernatural (See All) |
Mood: | nightmareambiguous ending |
Locations: | churchlos angeles californiapolice carcatholic church |
Characters: | catholic priestfather son relationshipafrican americanboyfriend girlfriend relationshipdoctorzombiestudentpriestbibleprofessorcatholicasian americanself mutilationengineerhomeless man β¦babe scientistreligious icon (See All) |
Period: | 1980s1990s |
Story: | demonic possessiontelekinesismind controlbloodbare chested malefightcigarette smokingsingingknifechasethree word titlesurprise endingbeatingdreamcorpse β¦blood splatterfistfightmirrorrescuepunched in the facecomputerbrawlsecretfalling from heightcollegedemonclassroomsciencescientistdecapitationgood versus evilsurvivalflashlightcandleaxeambulancethroat slittingimpalementstabbed to deathstabbed in the chestsevered headnundream sequencenews reporttransformationracial slurlimousinestabbed in the backkeypay phonepossessionrace against timecover upcollege studentlightningdiarydisappearancedeath of sonbasementneck breakingpremarital sexsevered armcult directortypewriterdismembermentundeadpizzaoccultcard gameelectronic music scorelooking at oneself in a mirrorcrucifixkicked in the stomachsevered handend of the worldfull moonwatching televisioncrime scenevisionblood on facestabbed in the throatpower outagegash in the faceinsecttitle appears in writingescape attemptreference to satanthrown through a windowdisfigurementsiegestabbed in the eyelooking at self in mirrorsevered legbruiseethnic slurplaying cardstranslatorliving deadcartoon on tvhiding in a closethit in the facedefecationcomputer crackerportalbugcomic reliefsecret societybroken mirrorinsomniainterracial kisslatinwormantphysicsstabbed in the shouldertitle in titlemaggotparasitehomeless persondead birdsymbolarm cut offhoboimprovised weaponbreaking through a dooralternate dimensionsectliquidantichristclimbing out a windowsocial decayregenerationstabbed with scissorsbeetlecard trickphysicisttranslationinvulnerabilitygraduate studenthomeless womantelling a jokequantum physicsmusic score composed by directorentrapmentsubliminal messagebroadcastevil godstabbed through the chestvagrantrecurring dreamabandoned churchdream within a dreampessimismtrapped in a buildingcontainerastral projectionshared dreamlovecraftianclaustrophobicreanimated corpsesupernovabreaking through a wallunicyclehit with a brickchinese takeoutuniversity campustheoretical physicsmarkresearch scientistcylinderyawntachyonradiologistscience vs religiondefying gravity (See All) |
In 1971, Carolyn and Roger Perron move their family into a dilapidated Rhode Island farm house and soon strange things start happening around it with escalating nightmarish terror. In desperation, Carolyn contacts the noted paranormal investigators, Ed and Lorraine Warren, to examine the house. What β¦ the Warrens discover is a whole area steeped in a satanic haunting that is now targeting the Perron family wherever they go. To stop this evil, the Warrens will have to call upon all their skills and spiritual strength to defeat this spectral menace at its source that threatens to destroy everyone involved. (Read More)
Subgenre: | paranormal investigationparanormal activity |
Themes: | suicidemarriageghostsupernatural powernear death experience |
Locations: | motelsinging in a car |
Characters: | catholic priesthusband wife relationshipfather daughter relationshipmother daughter relationshipteenage girlpolice officersister sister relationshiplittle girllittle boymaidwitchtruck driversuicide by hangingghost in mirror |
Period: | year 1968year 1971 |
Story: | demonic possessionexorcismflashbacktwo word titlebased on true storyshotgunvideo cameratied to a chairno opening creditschild in perilattempted murdercharacter repeating someone else's dialoguecharacter's point of view camera shotpossessiondoll β¦prankblindfoldhaunted houseelectronic music scorecrucifixpump action shotgunvisionscissorslaughingbruisepigeondead doglevitationapparitionblindfoldedlecturefarmhousenoosestation wagonmusic boxdead birdlocketsleepwalkingclairvoyantflash cameraends with textrocking chaircutting hairpancakefalling through the floornew housesailor suitghost hunterfilicidewardrobedeath of pethanged womanlaundry drying on clothes lineclotheslinehanged by the neckwind chimerhode islandblood vomitingmatchesparanormal investigatorvolkswagen busbitten in the facemusic score features pianosideburnsloss of petupside down camera shotchild sacrificeultraviolet lighthand clapping gamespiralanimate dollpsychic visionboat dockslit wristscrawl spacehole in a walllocked in a cellarrevealing the truthdybbuk boxgenuflectingdybbukdriving at night in the rainbumping headends with quotationhiding in cupboardhouse by a lakehung from tree (See All) |
It's nearing the end of the school year. High school senior Carrie White is a social outcast, largely due to being unwise to the ways of the world based on her upbringing. Her mother, Margaret White, is a religious fanatic, her extreme views primarily targeted against sex, which she believes is a si β¦n. She even believes natural associated processes such as menstruation are a sin, about which she has refused to mention to Carrie. Mrs. White's beliefs were taken to that extreme largely because of her own failed marriage and her husband Ralph long ago having run off with another woman. The only adult authority figure who tries to help Carrie with her life is her phys ed teacher, Miss Collins, who is nonetheless warned not to get too close to go against how Mrs. White chooses to raise Carrie, Mrs. White whose beliefs are well known in the community. An impromptu event that happens among Carrie's phys ed classmates against her leads to her classmates being punished. One of those students, self absorbed Chris Hargensen, vows revenge against Carrie for that punishment, the method of the revenge associated to the phys ed class incident. Another student however, the popular Sue Snell, begins to feel sorry for Carrie. In wanting to help her get out of her shell, Sue asks her boyfriend, the equally popular Tommy Ross, to take Carrie to the senior prom instead of her. This move does not sit well with Mrs. White, who in her extreme view believes Carrie will fall prey to sin. All these compβ¦ (Read More)
Subgenre: | independent filmcult filmcoming of ageblack comedysuspensetragedyfairy taleteen movieteen romanceteen horroramerican horrorcoming of age film |
Themes: | murderdeathfriendshiprevengereligionfeardanceangersupernatural powerdeath of motherparanoiadepressiondysfunctional familyredemptionguilt β¦insanitysexualitydatinghumiliationpoetrysadismevilbullyingunrequited lovecrueltypanicdyingtraumavengeancefirst lovepsychological trauma (See All) |
Mood: | high schoolnightmarenight |
Locations: | schoolcarcemeterysmall townbicyclewaterschool busschool teachersex in a carschool danceoral sex in a car |
Characters: | teenagermother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyfemale protagonistteachergirlstudentchristianreference to godbullysingle motherteacher student relationshipbible β¦terrorreligious fanaticself confidenceout of controlreligious zealotmean girlmother versus daughterevil student (See All) |
Period: | 1970sfuturenear futureyear 1979 |
Story: | psychic powerextrasensory perceptiondemonic possessiontelekinesispsychicsexfemale nuditycharacter name in titlebased on novelbloodviolenceone word titlefemale frontal nudity β¦kissfemale rear nudityfemale full frontal nuditycigarette smokingdancingtitle spoken by characterknifesurprise endingpantiesshowerfirecryingbased on bookdreamunderwearcar accidentblondeface slapslow motion scenewatching tvbare buttbathroomreference to jesus christclassroomprayerf wordbedroombracandlestabbingdeath of friendmontageimpalementstabbed to deathstabbed in the chesthouserock bandchild abuseexploding carbrunettedream sequencegraveyardgravelibrarydangerstabbed in the backscreaminglocker roomelectrocutionknocked outpranklong takeconvertiblegymhigh school studentcrosssplit screenisolationpigsadnessschoolgirlstagefirst partthreatened with a knifecult directorclass differencesgraffitikillingteenage sexsingle parentpoemnerdundergroundfalling down stairsteen angstdestructiondesirestreetdressgothicsexual attractionragecrucifixhammerbuttocksblockbustergossipcovered in bloodgrindhousecrushforbidden lovecompassiondead womanfemale killercrushed to deathhomicidesexual desirerampagereverse footagerejectionballreference to satanbible quotehit on the headsibling rivalryrosesurpriseatticlonerattractionclassmatebody countpublic humiliationstadiumjuvenile delinquentlaughingalienationdead woman with eyes opennewspaper clippingcrowdmusic bandphysical abusesinsouthern accentt shirttorso cut in halfjoypractical joketombgothprayinghysteriaforename as titleshynessstabbed in the handmenstruationoutcasthigh school teacherkillshortsteenage lovelong hairabuse of powerfemale teacherdoubtadolescencealonebitternessrepressionbully comeuppancefemale psychopathoutsidercrowndomineering motherredheaded womanschool principalknocked unconsciousmisfitjacketprincipalvolleyballgeneration gapteenage daughterteenage sexualitypopularitydisappointmentwrathlocked doorpromshirtsewing machineevil womancar set on firegraphic violencefrightsexual repressiondisillusionmentmenacestarsgravestoneopposites attractmatricidedeath of title characterbloody violencehit with a hammersymbolteenage girl in underwearabusive boyfrienddetentioniconnight timewhite dressanimal killingtreesvillain not really dead clichedisturbed individualgrindhouse filmsexual humiliationschool lifesinisterreference to the devilloss of controlabusive motherburningtauntingdeeply disturbed persondance contestbuckettamponwashingfemale studentcliquedesolationdark heroinehostilitywork outburning househigh school dancehigh school principalwoman kills womanslumber partyfire enginedead teenagerdisturbingfanaticismgym classgym teachervillainess played by lead actressmass destructionbad motherremadedrive in classictrousersyearbookbased on the works of stephen kingquarterbackmass deathridiculereference to the antichristashtrayhorror movie remadeteasemenstrual bloodjuvenilepsionic powerbad girlhigh school prommenarchefurystrange personwoman stabbedteen lovefemale bullyflipping carunderageparty dressmultiple stabbingoverprotective parentwrong side of the trackslast supperparanormal phenomenonpink dresspopular girlfitting inshy girlprincipal's officeschool yearbookcruel jokebackwardsinferiority complexmaniaprom nighthigh school sweetheartsprom queenprom dressfiretruckhigh school lovecracked mirrortroubled teenage girlhand from graveoddballteenage pranksterburned up caradolescent romancecollapsing housedeath by falling objectfemale slaps femalefirestormprom kingfirestarterclosed doorspig bloodteenage alienationbucket of bloodmultiple viewsindex cards (See All) |
Set in contemporary New York City, a seemingly ordinary teenager, Clary Fray, discovers she is the descendant of a line of Shadowhunters, a secret cadre of young half-angel warriors locked in an ancient battle to protect our world from demons. After the disappearance of her mother, Clary must join f β¦orces with a group of Shadow Hunters, who introduce her to a dangerous alternate New York called the Shadow World, filled with demons, warlocks, vampires, werewolves and other deadly creatures. (Read More)
Subgenre: | independent filmmartial artscoming of agefish out of waterdark fantasy |
Themes: | murderdeathfriendshiprevengesurrealismsuicidekidnappingbetrayaltortureescapemonsterdeceptionmagicsupernatural powerdeath of mother β¦abductionhome invasion (See All) |
Mood: |
Locations: | new york citychurchhotelmotorcyclecemeterynightclubbicyclewaterrooftop |
Characters: | homosexualteenagermother daughter relationshipboyfriend girlfriend relationshiptattooteenage girlhostagetough guyartistlove trianglevampirewarrioraction herosecurity guardwitch β¦suicide by poison (See All) |
Story: | demonic possessiontelekinesismind controlinterrogationbased on novelbloodviolenceflashbackdogbare chested malegunkissfightexplosionparty β¦knifechasesurprise endingcell phonefistfightrescueslow motion scenebattleswordbrawlsecretfalling from heightletterpaintingshowdownhand to hand combatplace name in titlebirthdaypianodemoncombatgood versus evilfoot chasecandlesword fightambushthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chesttied to a chairanti herobirdpainterdrawinghit by a carfictional warcreaturenecklacetransformationlibrarystabbed in the backmini skirtangelstatuetough girllightningskeletonscarexploding bodybasementgardenthreatened with a knifeflowerbattlefieldstylized violencehenchmanwerewolfspearheroineheavy rainphone boothirishskullbrooklyn new york cityfaked deathmonkaction heroinefemale warriormechaniccamera shot of feetvisiondual wieldimmortalitybutterflysketchdungeonrainstormrefrigeratorsecret identityflamethrowerplaying pianodaggerstick fightteleportationtelepathycrowdrugged drinkenglishman abroadimpersonating a police officergothfire extinguisherfemale fighterteenage lovespiral staircasestairwayportalworld dominationbrooklyn bridgemegalomaniacgreenhousereluctant heromacguffinsunriseravehit with a shovelshapeshiftingsymbolcockney accentmind readingpentagramteenage herogas explosionchrysler building manhattan new york citycuptarot cardmidnightflame throwerbody part in titlearsenalmausoleumman fights a womanbarefoot womanwarlockrottweilerfrying panturned to stonecaught in the rainsanctuarybased on young adult novelfireflyhit with a frying panpoetry readingalternate worldpoisonedlittle black dresslancefake deathsecret tunnelaccidental incesthealing powersecret compartmenttarot cardshalf humandemon huntersurroundedabandoned hotelsecurity officerbead curtainadult as childcappuccinohiding under a tablehit with a fire extinguisherinstitutereference to johann sebastian bachpsychic readingreplica16th birthdayupright pianowoman changing clothesnephilimwoman wearing a little black dressbreak door inhalf brother half sister incestrecovered memoryleg hold trappost it notevampire versus werewolfantique storewoman faintingnew york cityscapehooded manbarricading a doorbeam of energyred ballauto repair storechained to a chair (See All) |
Michael, the son of a funeral director grows indifferent to his father and joins a Seminary. On his way to the course completion, he is overwhelmed by a strong lack of faith. His religious beliefs are further jolted when he sees a young girl haplessly dying in a road accident for whom he reluctantly β¦ performs the ritual to absolve her sins. His mentor still believes in him and urges him to go to Italy to take an exorcism course hoping that he it would strengthen his faith in Christianity. In Italy he attends a session from Father Xavier who soon becomes aware of his skepticism. As a result he sends him to an eminent Jesuit exorcist, Father Lucas, whose ways though questionable are quite effective. He witnesses the exorcism of a sixteen year old girl but still seems unconvinced. Father Lucas explains to him that it takes multiple sessions over a long stretch of time to completely free a victim from the demon. Despite witnessing some supernatural occurrences during the aforesaid exorcism, Michael is as skeptical as ever. After the second exorcism, the girls condition becomes quite critical as she is moved to a hospital. She soon dies and the demon finds a new victim. As the moment of reckoning draws near, Micheal may be the only hope left but first he must overcome his own doubts and apprehensions in order to fight and destroy the ominous forces. (Read More)
Themes: | deathsuicidereligionpregnancyfuneralinvestigationincestdeath of fatherdeath of mothergrieffaith |
Mood: | nightmare |
Locations: | hospitalbarchurchcemeteryreligious school |
Characters: | father son relationshipdoctortattooteenage girlpolice officerstudentdetectivepriestwaitresslittle boyamerican abroadself discoveryreligious icon |
Story: | demonic possessionexorcismurinationbloodflashbacktwo word titlephotographtitle spoken by characterbased on bookcorpsewatching tvsecretlettertearscafe β¦demonhallucinationprayerjournalistcandleambulancenuncoffinhit by a carritualconfessiongravegymchildbirthshavingspiritrome italycrucifixpsychologyplaygroundmiscarriageviolinistlaptop computervideo tapesubtitlesbicyclingtraffic jamhearing voicescatholicismstrokepunching bagfuneral homeritelimphorse and wagonvaticanholy waterchurch serviceworking outslide showtoadexorcistmorticianloss of faithwalking caneclergyroman catholicvowvatican cityseminaryabsolutionnewcomerhit by a vansacred objectcolosseum rome (See All) |
The skeptical psychologist Dr. Margaret Matheson and her assistant, physicist Tom Buckley, are specialists in disclosing fraudulent paranormal phenomena. When the famous psychic Simon Silver reappears to his public after many years of absence, Tom becomes singularly obsessed in determining whether S β¦ilver is a fraud or not. (Read More)
Themes: | prisoninvestigationdeceptionobsessionsupernatural power |
Mood: | rainnightmare |
Locations: | hospital |
Period: | year 2011 |
Story: | psychicurinationbloodflashbacktwo word titlebare chested malefightphotographtitle spoken by charactersurprise endingbeatingdreampunched in the facewritten by directorcollege β¦color in titledeath of frienddinernews reportcharacter repeating someone else's dialogueattackumbrellacollege studentmanipulationthreatheart attacksurgeryexperimentrevelationfraudwristwatchcovered in bloodcamera shot of feetcon artistlens flareclose up of eyesmagic tricklevitationcremationspit in the faceseancelecturewatchyoung version of charactercollege professorprison visitsleeping in a carnewscastreference to shakespeare's hamletdead birdspoonpolaroid cameraprivate jetbreaking a mirrorclairvoyantstairwellphysicisttalk show hostflickering lighttalent agentdigital camerapublic toiletwoman in a wheelchairwall safeskepticreference to vincent van goghdrawingscolumbus ohiocomatosehead in a toilettv talk showstanding in the rainpretending to be blindred curtainreference to galileoshort circuitcoin trickspitting in faceconstruction crewfake psychicstepping on glassfake blindnessman on the street interviewman using crutchesstomach cancertailingfinger ringoccam's razorschool lecturebroken toilet (See All) |
Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl β¦osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)
Subgenre: | independent filmcult filmparanormal phenomenasupernatural horror |
Themes: | murderlovemarriageghostfearweddingtheftsupernatural powerparanoiasurveillanceevilpanicpolice investigationmurder of family |
Mood: | nightmare |
Locations: | barchurchmotorcyclecatholic church |
Characters: | catholic priesthusband wife relationshippriestterror |
Period: | 1970s |
Story: | demonic possessionexorcismsexfemale nuditybloodflashbackdogthree word titlepantiesbased on bookdreamshotgunvomitingbeerplace name in title β¦demonriverbedroomaxeambulancetoiletwhite pantiesnunvanparktreelibrarycurseattacklightningscreamcrosshauntingfirst parthaunted housechild murderoccultfireplacegothicbabysitterlifting someone into the airagingcrucifixbeardblockbustergrindhousemale underwearreincarnationstairsthunderstormbriefswedding receptionblindsuffocationreal estate agentclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwhite briefswoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgirl stripped down to pantiesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storycamel toeremadetrailer narrated by percy rodriguezbare midriffevil forcehorror movie remademicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All) |
True-crime writer Ellison Oswalt moves himself and his family into a house where a horrific crime took place earlier, but his family doesn't know. He begins researching the crime so that he can write a new book about it to help his flailing career. He uses some "snuff" film footage he finds in the h β¦ouse to help him in his research, but he soon finds more than he bargained for. There is a figure in each of the films but who or what is it? As a result, his family start to suffer (as does he) and things take a turn for the worse. Will they survive? (Read More)
Subgenre: | supernaturaltragedyfound footagesupernatural horror |
Themes: | murderdeathghostfearinvestigationobsessionsupernatural powerevilpanicwritingmurder of familymissing childnovel writing |
Mood: | nightdarkness |
Locations: | swimming poolsmall townpennsylvaniacar fire |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipwritersheriffterror |
Story: | night terrorsresearchbloodviolencedogcigarette smokingphotographknifecell phoneblood splatterwritten by directorpaintingbookalcoholbedroom β¦bound and gaggedmassacrethroat slittinghousetied to a chairmapsnakeman with glassesdrawingchild in perildrowningcoffeetreeargumentdeath of childbaseball bathangingdisappearancelaptopfirst partkillingchild murderoccultburned aliverevelationtied to a bedwatching a moviepoolhomeduct tape over mouthwhiskeypower outagenovelistatticfamily dinnerlens flareaxe murderboxdrugged drinkbag over headdark secrettrue crimewebcamfilm projectordeputyscorpionpatricideheld captivebloody body of childsnuff filmcollege professorvhshanged manmoving inbackyardkiller childcar set on firefilmed killingmultiple murdermatricideknife murdersuper 8tapegrindhouse filmsleepwalkingsleeping on a couchfratricidesinisterfalling through the floormystery killernew housemovie projectorsuper 8mmst. louis missourighost childfilm reelhanged womangooglesingle locationnew homefoaming at the mouthsacramento californiafilm editingorange county california8mm filmhanged childpov shotkilled with a lawnmowerax murdershushing someonecrime novelist (See All) |
It's the late 1960's. Just for a lark, graduate student Eddie Jessup, known for being unconventional, brilliant and slightly mad, conducts experiments with an isolation chamber, using himself as the subject. His experiences in the chamber cause him to hallucinate, much of the imagery being religious β¦-based despite he not being a religious man. Seven years later, he is a respected full professor in the Harvard Medical School. Believing he has lost his edge and has fallen into an unwanted state of respectability, Eddie decides to resume his work with sensory deprivation, this time using hallucinogens, specifically untested ones used in mystical Mexican rituals, to enhance the experience of being in the isolation tank. After initial tests, he claims he entered an alternate physical and mental state. Although unbelieving of Eddie's claims, his colleagues Arthur Rosenberg and Mason Parrish, as well as Eddie's wife, Emily, who is in her own right a respected academic, are concerned for Eddie's well being. However, if Eddie's claims are indeed true, he could do irreparable harm to himself and others around him, especially if his altered states are uncontrollable. (Read More)
Subgenre: | cult filmsuspenseallegory |
Themes: | surrealismdrugsreligionpregnancydrunkennessdancememorynatureangercancerpanicevolution |
Mood: | gorenightmare |
Locations: | barairportvillagewheelchairpolice stationafricaspacecavemexicocampfirestormsan francisco california |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipdoctorpolice officerstudentmusicianreference to godlittle girlbibleprofessorterrorwitch doctoranthropologist |
Period: | 1970syear 1967 |
Story: | sensory deprivationseizureresearchsexfemale nuditybased on novelnuditybloodmale nuditymasturbationmale rear nuditydog β¦explosionpartyknifeshowercryingdreamcorpsemaskpaintingtearsmarijuanademonhallucinationreference to jesus christsciencescientistsurvivalflashlightnew yorkcaliforniamountainsubwaysnakeritualsearchvoice overtransformationmicrophonetankscreamuniversitypursuitisolationbasementfireworkssacrificeexperimenttraditionfireplacehypodermic needlejeepdrugtape recorderfaintingrecordingcomadiseaseelephantjail cellpatientwalkie talkiebuttockstimesheepschizophreniagoatrealityindianguardface paintspanishboston massachusettszoodelusionlaughterevidencevolcanosoulalternate realitytigernotecasual sextripsymbolismseparationplaying cardsceremonyenergyhysteriatruthmysticismkillbandagemetaphorhikingfreaklizardgorillax raysecurityhuntchangelsdlavasweatstonedmetamorphosisuniverseleukemiadnamushroompotionaudio cassettemonitorshockanthropologyconsciousnessapegeneticsritemonumentcavemandeformityicongogglessmoking potdrug tripcustommindcustomssexual intercourserhinocerosexaminationsubconsciousmusclevisionsweirdoperceptionhumanoidcribchemicalreconstructionawarenessboiler roomfemale star appears nudeobservationreptilescavengerbackpackingmentalfurnacemagic mushroomelectric fencedimensiontechniciansleeping nudebaboonmachinerycarcasstoxicinstinctvoidpathologyraw meatblack outexperienceholyoriginsdeprivationdrug culturechartprimitiveimageryregressionatomsacredfrenzyindian tribemescalineexistencequantumape manmoleculespasmgraphpsychedelicsexpansionquest for knowledgegenesmattermetabolismradiologyimpulsereference to timothy learysensesbeating a dogcontractionisolation tankmind alterationpsilocybinsimianprimordialscreenwriter credited under pseudonym (See All) |
A blind girl gets a cornea transplant so that she would be able to see again. However, she got more than what she bargained for when she realised she could even see ghosts. And some of these ghosts are down right unfriendly. So she embarks on a journey to find the origins of her cornea and to reveal β¦ the history of the previous dead owner ... (Read More)
Subgenre: | supernatural horrorasian horror |
Themes: | deathsuicideghostsupernatural powercancerblindnessforgiveness |
Mood: | nightmare |
Locations: | hospitalcemeteryelevatorkitchen |
Characters: | mother daughter relationshipboygirlsister sister relationshipuncle nephew relationshipgrandmother granddaughter relationshipdoctor patient relationship |
Story: | psychic powerexorcismflashbackexplosionbased on true storyfirevoice over narrationmirrorremakehallucinationbedroomconcertexploding carperson on firehanging β¦tragic eventsurgeryslow motionjumping from heightfatewoman in jeopardytensionvisiondead childalternate realitydisfigurementviolinistblindcroweyetraffic jamhallwaytraffic accidentbus rideconductorburn victimimmolationblind girlclairvoyanceable to see the deadhorror movie remadechild suicidevirtualityprecognitioneye surgeryloss of eyesightgas leakeye transplantchain reactiontransplantationcorneal transplantstring ensembleeye operation (See All) |
A priest from the Vatican is sent to Sao Paulo, Brazil to investigate the appearance of the face of the Virgin Mary on the side of a building. While there he hears of a statue of the Virgin Mary bleeding tears in a small town outside of the city. Meanwhile, a young woman in the U.S. begins to show s β¦igns of stigmata, the wounds of Christ. The priest from the Vatican links up with her and cares for her as she is increasingly afflicted by the stigmata. Her ranting and raving finally begins to make sense to the priest who starts to question what his religion has stood for for the last 1900 years. (Read More)
Subgenre: | cult filmblack comedyconspiracypunkparanormal phenomenasupernatural horrorchristian horror |
Themes: | friendshipsurrealismreligionfearfuneralinvestigationsupernatural powerparanoiainsanitypanic |
Mood: | gore |
Locations: | hospitalnew york citychurchbathtubnightclubwatervillagewheelchairapartmentusabrazilcatholic churchtrain accident |
Characters: | catholic priestdoctortattooprostitutepriestchristianitysecurity guardbiblecatholicself mutilationtattoo artistreligious symbolism |
Period: | 1990s |
Story: | demonic possessionexorcismfemale nuditynuditybloodviolenceone word titlebare chested malecigarette smokingphotographtitle spoken by characterknifechasesurprise endingshower β¦firecorpsecar accidentrescueslow motion scenecomputercameracar crashdemonhallucinationreference to jesus christf wordcandlestrangulationambulancemansiondinersubwayfalse accusationnuncoffinunderwater scenelatex glovesattempted murderlibrarydangerprologuepossessionrace against timestatuecover uplightningscarpremarital sexthreatened with a knifeflowerwhippingsubtitled scenetwenty somethingoccultrevelationwoundgothicheavy raintape recorderscene during opening creditsrome italycaucasianirishinterracial friendshipvisionblood on facethrown through a windowdrunkaerial shote mailrainstormfemale doctornewspaper clippingatheistfast motion scenehairdressertranslatorprayingyellinglevitationalleycrucifixionbandagecatholicismcrashing through a windowfeathervaticandovesurveillance footageextreme close uppittsburgh pennsylvaniagospelrosaryscrolltranslationcardinal the priestmessengerfax machinegoateeblood samplebeauticiansuppressioncrisis of faithvirgin mary statuevatican citybrain scanstigmatacorrupt priestwriting on wallancient manuscriptanti clericalismapocryphaanti catholicfilm ends with text (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | martial artscult filmcoming of ageblack comedysuspensesupernaturalheist |
Themes: | murderdeathfriendshiprevengesurrealismsuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of fathersupernatural power β¦paranoiasurveillanceevilhome invasionpanic (See All) |
Mood: | gorenightmare |
Locations: | schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church |
Characters: | catholic priestfather daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholic |
Period: | 2000s |
Story: | mind controlinterrogationsexcharacter name in titlenumber in titlebloodviolenceflashbackbare chested malegunfightphotographexplosionpartyknife β¦lesbian kisschasesurprise endingpistoldreamcorpseshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
The basketball coach Clyde and his wife Stephanie divorced a couple of months ago and their teenage daughter Hannah and the girl Emily 'Em' live with their mother and spend the weekends with their father. One day, Clyde stops his car in a yard sale and Em buys an antique carved box and becomes obses β¦sed with it. Em finds the hidden lock and releases an evil spirit that possesses her. Soon Clyde discovers that Em has a problem, but his annoying ex-wife and her boyfriend Brett do not pay attention to him and get a restraining order against Clyde. Clyde seeks out Professor McMannis and when he sees the box, he explains that it is a Dibbuk Box, where a fiend is trapped inside. He also explains that the box should not be open; otherwise the person will be possessed by the spirit. Now Clyde travels to a Jewish community in New York and the rabbi's son Tzadok returns with him expecting to exorcise Em to save the girl. (Read More)
Subgenre: | supernatural horror |
Themes: | deathdivorcebrutalityobsessionsupernatural power |
Locations: | hospital |
Characters: | father daughter relationshipmother daughter relationshipteachergirldancersister sister relationshipjewishpsychiatristjewfather |
Story: | seizuredemonic possessionexorcismbloodviolencetwo word titledancingsurprise endingcryingcar accidentface slaphallucinationclassroomeatingdiner β¦child in perilritualold womancursescreamingsuburbscreamringgymamerican flaggaragehatesistereyeglassesspiritlooking at oneself in a mirrormorguehammercgibarefootaerial shote mailswingrefrigeratorboxdivorceebrushing teethposterstabbed in the handrunning awayreading aloudshoutingrabbifilm starts with textcoughingcrashing through a windowdripping bloodroad accidentcollege professorhome videoorchestral music scoredivorced parentsoverhead camera shotdumpsterpsychotronic filmclose up of eyeslapgrindhouse filmex wifeholy watertear on cheektrancehebrewpancaketoothflickering lightfingercassette tapelocked inscrewdriverbasketball courtyoung girlmothwood carvingschoolmatetearfemale psychiatristloosely based on real eventsunconsciousgaggingswarmhair lossglass shardyard saleinfestationstabbed with a forkgarbage binbasketball coachmusic score features pianopossessed girlmona lisashadow puppetworking latemriolive oilkilled in car accidentmagnetic resonance imagingtree swingeating raw meatball peen hammerauditory hallucinationbare foot womansitting on stepscar truck crashdybbuk boxhair falling outhasidicvehicular accidentcgi animal in live action filmexit signfood allergygust of windbasketball practicecrawldybbukscanthrown through the airtooth falling outkilled in carscream off camerainvisible friend (See All) |