Please wait - finding best movies...
A janitor at a summer camp is accidently burned severely from a prank. Years later, he is released from an institute, and returns to the camp with a pair of hedge clippers to take revenge on the campers.
| Subgenre: | slasher horrorslasher flickcanadian horrorbritish horrorindependent horroramerican horrorteen horrordisneyteen movieb horrorb moviedark comedysuspenseblack comedycult film …independent film (See All) |
| Themes: | bullyingevilsadisminsanitypsychopathvoyeurismmurderdeathrevenge |
| Mood: | slashergore |
| Locations: | by the searunning through the woodssex outdoorsbackwoodsstormcampfireoceanbaseballlakeseawheelchairwoodsboathelicopterforest …hospital (See All) |
| Characters: | slasher killermysterious villainserial killerout of controlterrorvillainkillerbullyteenage boyprostituteteenage girlboydoctorboyfriend girlfriend relationshipfriend …teenager (See All) |
| Period: | summer1980s |
| Story: | summer holidaysummer camproommate roommate relationshippsycho killerlost in the woodsswimming in a laketeenage pranksterburning fleshsocial outcastfacial disfigurementdrilling for oiloil rigstabbed with scissorsreference to playboy magazinehustler magazine …camp counselorporn magazineprank gone wronghomicidal maniacsexual attractionplayboy magazinecampfire storycigarette smokingocean floorsexual desireunderage smokingplaying baseballmurder by stabbingbaseball gameaxe in the headpsychopathic killermasked killeraxe murdernude swimmingevil mansadistic psychopathgood versus evilcrying for helpcrying femalesetting a firehouse on fireman on firecrying womanshower curtainshower roomtaking a showerperson on firenipples visible through clothingfoot chasevoice over flashbackserial child murderpellet gunmale female fightspurting bloodforced kissnon disclosure agreementmistaken belief that someone is deadsleeping fully clothedmasturbation gesturehiding behind a treesleeping in underweartalking to a dead bodyserial child murdererhedge trimmerslapped in the facereference to penis sizefinger injuryday for nightobscene hand gesturesexual urgeburned handtalking about masturbationthroat slitnaked bathingbluegrass musicpretending to sleepinsane mansleeping shirtlessviolent manscissorfacial injurystolen clothespushed into waterleavingweirdpost coital sceneseductive manarm injurywatching someone sleepmalicegarden shearspointing a gun at someonevitaminsupervisorvideo nastyscreaming manplan gone wrongdisbeliefover the topnew york statemissing womanwoman hits a manabandoned minepassive aggressive womanmurder spreepassive aggressive behaviorsecretly observingmultiple homicideruinhand injurydiscovering a dead bodypranksterhysterical womanmultiple murderbloody facepremature ejaculationextreme violencescreaming womanfinding a dead bodygrindhouse filmburningmass murderernude bathingpsychotronic filmburn victimdovewoman slaps a manimmolationseductive behaviorarm cut offjumping into watersexual frustrationcaretakerhospital roombreaking a windowfinger cut offhorninessmotorboatmasturbation referencemooningwormcigarettetelling someone to shut upclinicbroken windowserial murderslashingrafthuman monsterwoodrepeated sceneurban legendcanoedockmysterious manshortsoutcastbad guybeing followedpractical jokeplaying cardssunbathingflamethrowerbody countattractionsexual humordisfigurementslaughtersexual harassmentlostoilscissorsstabbed in the throatsevered fingerredneckmasked manfollowing someoneblack humorcommunityskullgaggedswimsuitpsychocampmass murderstabbed in the stomachmale bondingmagazinefriendship between menbarnmutilationelectronic music scoreburned alivedesirecard gameteenage sexdisasterholidaymaniacsevered armcabinsuspicionwitnessstalkingdisappearanceprankmissing personscreamcharacter's point of view camera shotsuitcasestrippingstalkerskinny dippingsmokingroommatebirdapologyaccidentstabbed to deaththroat slittingimpalementstabbingmassacreaxeflashlightsubjective camerasurvivalf wordswimmingcriminalvoyeurlow budget filmdead bodymaskbikiniundressingcondomslow motion scenerescuemirrorblood splattercryingfireshowerpantieschaseknifenipplesfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditysex scenemale nuditybare breastsgunbloodflashbackfightnudityviolencekisssex (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | slasher flickamerican horrorteen horrorteen moviesuspensecult filmindependent filmpsycho thrillermurder mystery |
| Themes: | evilsadisminsanitypsychopathvoyeurismmurderrevengedeathfearcorruptionbrutalityhumiliationcrueltytraumamysterious death |
| Mood: | slashergorenightdarknessblood and gore |
| Locations: | lakewoodsboatcarmotorcyclewaterrural settingpolice cartruck |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenage boyfriendteenagerpolicepolice officerpolicemanartistmothersheriff …truck driverserial murderer (See All) |
| Period: | summer1970s1950s |
| Story: | summer camppsycho killerlost in the woodscamp counselorhomicidal maniaccampfire storyaxe in the headpsychopathic killeraxe murdersadistic psychopathnipples visible through clothingnaked bathingmurder spreemultiple homicidemultiple murder …extreme violencegrindhouse filmserial murderslashinghuman monstercanoemysterious manshortsbody countslaughterloststabbed in the throatswimsuitpsychocampstabbed in the stomachelectronic music scoredesireteenage sexmaniaccabinstalkingprankstrippingskinny dippingaccidentstabbed to deaththroat slittingstabbingmassacreaxesubjective cameravoyeurlow budget filmdead bodybikinislow motion sceneblood splatterpantiesnipplesfemale rear nuditymale rear nudityfemale nuditymale nuditybare breastssexkissviolencenumber in titlebare chested malethree word titlesurprise endingbeatingcorpsedigit in titlefistfightblondethongbeerrunningmarijuanahallucinationguitardecapitationbedroombracandleold manwomandinersnakecultdream sequencedangerprologuescreamingfirst of seriesmoaningdeath of childinjectiondeath of sonmurdererfirst partkissing while having sexkillingfreeze framegirl in pantiesrevelationdressjeepgothicheavy rainmachetehathammervillainessgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseyobesitymercilessnesspower outagemutebutcherpsychotronicthunderstormbathingdisembowelmentsurpriseatticperversiondead manlens flareroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticphysical abuset shirtjoysexual awakeningbeheadingcar troubledead animaladolescencerepressionsexual perversionrestroomfemale psychopathjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanfamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessgame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimwet clothesgrudgeoff screen murdervillain not really dead clichebutcherymurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweatermistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbingraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlgruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentswoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | independent horroramerican horrorb horrorsuspensecult filmpsycho thriller |
| Themes: | evilinsanitypsychopathmurderdeathfearbrutalityexploitation |
| Mood: | slashergoredarkness |
| Locations: | running through the woodsbackwoodscampfirelakewheelchairwoodspolice carchase in the woods |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerboyfriend girlfriend relationshipteenagerserial murderermysterious killer |
| Period: | summer1980syear 1984 |
| Story: | summer camppsycho killercamp counselorhomicidal maniaccampfire storypsychopathic killermasked killernude swimmingevil mansadistic psychopathnipples visible through clothingmurder spreemultiple homicidemultiple murdergrindhouse film …psychotronic filmserial murderslashinghuman monstermysterious manbad guybody countslaughterredneckmasked manpsychocampmass murdermutilationmaniacstalkingcharacter's point of view camera shotstalkerskinny dippingthroat slittingimpalementmassacresubjective cameraswimmingdead bodymaskbikinislow motion sceneblood splatterpantiesnipplesfemale frontal nudityfemale nudityflashbackviolencefightbloodsexkissnumber in titlesequelsurprise endingtelephone callcorpsedigit in titleblondecatsecond partnumbered sequeldecapitationbrastrangulationjokesevered headcontroversyprologueopening action sceneconvertiblemurdererobscene finger gesturelove interestkissing while having sexkillingsplatterchesschainsawfireplacespeargothicmachetelifting someone into the airragevillainessphone boothgrindhousevictimrampagebra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headbetrefrigeratorlens flarecharacters killed one by onekilling spreepsychoticcar troublemadmanreturning character killed offfreakskirtsexual violencewetting pantshillbillyday in titletow truckparaplegicorchestral music scoremasked villainknife murderpitchforkbloody violencesole survivorlunaticmurder of a nude womandying during sexvillain not really dead clichebutcherycrime spreecreepkilled during sexmystery killershackpsycho terrorweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickgruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | independent horroramerican horrorcult filmpsycho thrillerbody horrorsadistic horror |
| Themes: | evilsadisminsanitypsychopathdeathmurdertorturebrutalitysupernatural power |
| Mood: | slashergorebreaking the fourth wallblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenage boyteenage girlboybrother sister relationshipserial murderermysterious killer |
| Period: | 1980s |
| Story: | summer camppsycho killerhomicidal maniacsexual attractionpsychopathic killermasked killerevil mansadistic psychopathmurder spreeextreme violencegrindhouse filmserial murderslashinghuman monstermysterious man …bad guybody countdisfigurementslaughterredneckmasked manpsychocampmutilationmaniaccabinstalkingcharacter's point of view camera shotskinny dippingstabbed to deathimpalementmassacresubjective cameralow budget filmmaskblood splatterpantiesfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare breastsbloodsexviolencenumber in titlesequelmasturbationsurprise endingcorpseunderweardecapitationstrangulationsevered headchild in perillooking at the camerastabbed in the backpremarital sexmurdererloss of motherobscene finger gesturekillinglifting someone into the airragemorguefourth partgrindhousetowelback from the deadrampagenew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentbody landing on a carcharacters killed one by onekilling spreecar troublemadmanstabbed in the handkillshot in the eyehillbillymeat cleavernaked dead womangraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticmurder of a nude womanvillain not really dead clichedisturbed individualbutcherycrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | american horrorcult filmindependent filmpsycho thriller |
| Themes: | evilsadisminsanitypsychopathdeathmurderrevengefearbrutalityexploitationpolice investigation |
| Mood: | slashergorerainnightmarenightdarkness |
| Locations: | backwoodswoodscemeterysmall townamerica |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenagerpolicemother son relationshipbrother brother relationshipsheriffserial murderermysterious killercountry boy |
| Period: | 1980s |
| Story: | summer camppsycho killerstabbed with scissorshomicidal maniacaxe in the headpsychopathic killermasked killeraxe murderevil mansadistic psychopathgarden shearsmurder spreemultiple homicideextreme violencegrindhouse film …psychotronic filmserial murderslashinghuman monstermysterious manbad guybody countslaughterredneckmasked manpsychostabbed in the stomachbarnmutilationmaniacstalkingcharacter's point of view camera shotstalkerthroat slittingimpalementmassacreaxesubjective cameralow budget filmdead bodyblood splatterpantieschasefemale frontal nudityfemale nuditybare breastsviolencebloodsexkissnumber in titlesequeldancingsurprise endingdigit in titlenumbered sequeldecapitationsword fightchild in perilgravedeath of brotherdeath of sonmurdererobscene finger gesturekissing while having sexchainsawmachetelifting someone into the airgrindhousevictimmental institutionrampagenew jerseyitalian americanbutcherpsychotroniceye gougingstabbed in the eyecharacters killed one by onefifth partsequel to cult favoritepsychoticcar troublemadmanlaundrydefecationcomic relieftombstonehillbillyeyeballmeat cleavercrushed headgraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticmurder of a nude womandisturbed individualbutcherydeath of grandfathercrime spreereturning character with different actorfatchopping woodpsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | slasher flickamerican horrorteen horrorcult filmsupernaturalparanormalparanormal phenomenabody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | evilsadismpsychopathvoyeurismdeathmurderrevengefriendshipsurrealismkidnappingghostfearescapemonsterbrutality …supernatural powerparanoiapanicmysterious deathshower murder (See All) |
| Mood: | slashergorerainhigh schoolnightmaredarknesspoetic justice |
| Locations: | stormbaseballbarschoolswimming poolsmall townbusdesertgay barschool busbus driverabandoned factoryschool bus driver |
| Characters: | slasher killerserial killerterrorvillainkillerteenage boyteenage girlboyboyfriend girlfriend relationshipfriendteenagerfamily relationshipshusband wife relationshiphomosexual …father son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteachergirlstudentpolicemanlittle girlself mutilationdriverserial murderergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | psycho killersocial outcasthomicidal maniaccigarette smokingplaying baseballpsychopathic killerevil mansadistic psychopathcrying for helpshower roomtaking a showerperson on firenipples visible through clothingfoot chaseserial child murder …male female fightspurting bloodmistaken belief that someone is deadsleeping fully clothedsleeping in underwearserial child murdererburned handsleeping shirtlessarm injurywatching someone sleepscreaming manmurder spreepassive aggressive behaviorsecretly observinghand injurygrindhouse filmpsychotronic filmjumping into waterbreaking a windowbroken windowserial murderslashingurban legendbad guybody countdisfigurementpsychomass murderstabbed in the stomachmutilationelectronic music scoreburned alivemaniacscreamcharacter's point of view camera shotbirdapologystabbed to deathimpalementstabbingmassacresubjective cameraf wordcriminalvoyeurdead bodybikiniundressingslow motion sceneblood splattercryingfireshowerchaseknifemale rear nuditymale nuditynudityfightbloodviolencecharacter name in titlenumber in titlesequelbondagedogbare chested malepartysurprise endingtelephone calldreamdigit in titleunderwearface slapshotgunwatching tvbare buttsunglassessecond partplace name in titleneighbornumbered sequeldemonhallucinationclassroomname in titlebasketballfootballstabbed in the chestsnakedream sequencechild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roompossessionkicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstkilling an animalwoundbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmousebarefoot malevisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingmale objectificationbarking dogmadmanhigh school teacherstuffed animalohiocafeteriaassumed identitysecond in seriesevil spiritfish tankbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationshape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonewet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorbutcherysleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying malewagontalking to oneselfboom boxbad dreamtoastercut armrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible manblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacetaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationlong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a ladderbad guy winsbiology teacherbiting someonegrillgroundeddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentstaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintmale bondagerunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipcar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacwrapped in a blanketbiology classfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandagepossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
| Subgenre: | slasher flickamerican horrorsuspensecult filmpsycho thrillerholiday horror |
| Themes: | insanitypsychopathvoyeurismmurderdeathjealousyfeartorturememoryseductionbrutalityobsessionparanoiablindnesstrauma …madnessmurder investigationmurder of a police officerpsychological trauma (See All) |
| Mood: | slashergorenightdarkness |
| Locations: | wheelchairhospitalcarsmall townpolice carhospital fire |
| Characters: | slasher killerserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationshipteenagerpolicepolice officernursedetectivepolicemansheriffserial murderer |
| Period: | 1970syear 1978 |
| Story: | psycho killerhomicidal maniacsexual attractioncigarette smokingpsychopathic killermasked killersadistic psychopathgood versus evilman on fireperson on firemurder spreemultiple homicidemultiple murderextreme violencegrindhouse film …burningnude bathingcigaretteclinicserial murderslashinghuman monstermysterious manbad guybody countdisfigurementslaughterstabbed in the throatmasked manpsychostabbed in the stomachmutilationelectronic music scoremaniacwitnessstalkingscreamcharacter's point of view camera shotstrippingstalkeraccidentstabbed to deaththroat slittingstabbingflashlightsubjective cameravoyeurmaskblood splattercryingfirechaseknifenipplesfemale rear nuditymale rear nudityfemale nuditymale nuditybare breastsnudityviolencekisssexbloodnumber in titlesequeltwo word titleexplosiontelephone callcar accidentshot in the chestblondewatching tvkissingbrawlsecretshootingsecond partneighborrevolverhalloweenold manstrangulationambulancebrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderbeaten to deathstabbed in the backprologuescreaminguniformpoisonproduct placementcollege studentinjectionglassestrapmurderersplattertv newssyringedestructionhypodermic needlelifting someone into the aircowboy hatwalkie talkiehammerhidingbuttockscaucasianpoolgrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidepresumed deadcamera shot of feetrampagemanhuntmercilessnessmutebroken glassbutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingstabbed in the eyedark pastcharacters killed one by onedead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokeflat tirefemale stockinged feetdead girlconfusioncar troublemadmanstoreneedlemedical masksurgical maskdark secretbandagelighteralonesuit17 year oldearringnurse uniformdental maskblood stainburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelhand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessflamegraphic violencelighting a cigarettenurse outfitmurder attemptmasked villainroman numbered sequelknife murderbloody violencebutcher knifepool of bloodfemale victimscaresilhouettevillain not really dead clichebutcheryzippo lighterdying wordssinisterescaped mental patientdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firepsycho terrormidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those …friends. (Read More)
| Subgenre: | slasher flickamerican horrorcult film |
| Themes: | psychopathdeathmurderrevengeabductionexploitation |
| Mood: | slashergoredarkness |
| Locations: | lakewoods |
| Characters: | slasher killerserial killerterrorvillainkillerteenage boyteenage girlboyfriend girlfriend relationshipteenagerserial murdererlow self esteemmysterious killer |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacpsychopathic killermasked killerevil mansadistic psychopathmurder spreeextreme violencegrindhouse filmmass murdererpsychotronic filmserial murderslashinghuman monsterbad guy …slaughterstabbed in the throatmasked manpsychomass murderbarnmaniacsevered armcabincharacter's point of view camera shotimpalementaxesubjective cameramaskbikinishowerbloodnuditysexnumber in titlesequeldigit in titlenumbered sequelthird partmurdererdismembermentsplattermachetelifting someone into the airrageroman numeral in titlesevered handgrindhousestupidityrampagenew jersey3 dimensionalconvenience storepsychotronicstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreetorso cut in halfcar troublemadmandefecationsexual violenceshot in the eyehillbillyeyeballhammockfamous scoremasked villainknittingpitchforksole survivordeformitybiker gangdisturbed individualcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | independent horrorb horrorb moviesuspenseindependent filmsadistic horrorpsychological horrorfrench horrorhorror b movie |
| Themes: | evilsadisminsanitypsychopathdeathmurderfriendshipsurrealismkidnappingrapefeartorturedeath of fatherbrutalitydeath of mother …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | slashergorenightmarecar chasenightdarknessblood and gore |
| Locations: | backwoodswoodsforesthospitalbathtubrural settingroad tripfrancetruckgas stationsinging in a carback country |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenage girlboyfriendfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationship …mother daughter relationshipbrother sister relationshipfemale protagoniststudentbest friendfrenchbest friendsserial murderermysterious killerdeath of boy (See All) |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killeraxe murderevil mansadistic psychopathshower curtaintaking a showermurder spreeextreme violencegrindhouse filmserial murderslashinghuman monster …bad guybeing followedbody countslaughterredneckfollowing someonepsychomass murderstabbed in the stomachmutilationmaniacstalkingthroat slittingimpalementstabbingmassacreaxeflashlightsurvivalsubjective cameracriminalvoyeurlow budget filmdead bodyslow motion scenemirrorblood splattershowerchaseknifefemale frontal nudityfemale nuditybare breastsflashbackbloodviolencegunf ratedmasturbationdogphotographlesbian kisssurprise endingtelephone calldreamcorpsecar accidenturinationshot in the headshotgunshootingriflesunglassesbedcar crashbathroomneighbortelephoneshot in the backdecapitationbound and gaggedstabbed in the chesthousesevered headscantily clad femalevanon the rundolldeath of childdeath of brotherpursuitdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murderchainsawfireplacekilling an animallistening to musicsurvivorsevered handgrindhousestrangerrape victimrapistfemale killerrampagetensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childswingclassmatesexual assaultcharacters killed one by onekilling spreeparrotdead dogpervertblood on camera lenssuffocationbarbed wirevideo surveillanceearphonesmadmanclosetnecrophiliaminimal castkillkilling a dogfarmhousefemale psychopathlistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanmurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimvineyardchainsdriving at nightdisturbed individualbutcherybludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | slasher flickcanadian horroramerican horrorsuspensecult filmindependent filmsupernaturalpsycho thrillerparanormal phenomena |
| Themes: | evilinsanitypsychopathdeathmurderrevengesuicidekidnappingghostfeartorturedrunkennessdeath of fatherbrutalitysupernatural power …death of motherabductiontraumafear of water (See All) |
| Mood: | slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore |
| Locations: | lakeforestcemeterysmall townpolice stationschool nurse |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenage boyteenage girlboyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipzombielittle girlsheriff …serial murderer (See All) |
| Period: | 2000s |
| Story: | summer camppsycho killercamp counselorhomicidal maniacpsychopathic killermasked killerevil mansadistic psychopathperson on firefoot chaseserial child murderserial child murderermurder spreemass murdererpsychotronic film …serial murderslashingmysterious mandockbad guybody countslaughtersevered fingermasked manpsychomass murdermutilationburned alivemaniacsevered armcabinstalkingcharacter's point of view camera shotskinny dippingimpalementstabbingmaskslow motion sceneblood splatterfireshowerviolenceflashbackbloodcharacter name in titlesequelphotographexplosionpartysurprise endingpistolvoice over narrationdreamcorpsebrawlfalling from heightcar crashdemondecapitationsevered headdream sequencechild in perilunderwater scenevandrowninglibrarycharacter repeating someone else's dialoguevirginprologueelectrocutioncover updeath of childdeath of brotherhigh school studentneck breakingpremarital sexmurdererdismembermentkillingundeadsplatterchild murderheroinemachetelifting someone into the aircomaragesevered handvictimgoatcrushed to deathrampagenew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingdemonic possessioncharacters killed one by onekilling spreegeekburned to deathnewspaper clippingtorso cut in halfblood on camera lensbeheadingmadmanfinal showdownnecrophiliakillohiolockerevil spiritsexual violencestonerdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimbreaking through a doorvillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsatanicgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimelm streetslashed to deathspringwood ohioabusive childhoodwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | slasher flickamerican horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationbody horrorurban fantasy |
| Themes: | evilsadisminsanitypsychopathdeathmurderfriendshiprapeghostpregnancyfearmonsterinvestigationbrutalitysupernatural power …depressiontrauma (See All) |
| Mood: | slashergorenightmare |
| Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
| Characters: | slasher killerserial killerterrorvillainkillerboydoctorboyfriend girlfriend relationshipfriendteenagerfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican american …female protagonistgirlnursebabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathgood versus evilcrying for helpcrying femalecrying womantaking a showerfoot chaseserial child murdersleeping fully clothedserial child murderersleeping shirtless …violent manpost coital scenemurder spreesecretly observinghand injuryhysterical womanscreaming womangrindhouse filmpsychotronic filmjumping into waterhospital roombreaking a windowmasturbation referencebroken windowserial murderslashingmysterious manbad guybody countdisfigurementslaughterfollowing someonemass murdermutilationmaniacsevered armstalkingscreamapologyaccidentimpalementstabbingflashlightslow motion sceneblood splattercryingshowerchaseknifefemale rear nudityfemale nuditybare breastsviolencesexnudityflashbackbloodgunf ratedsequelbare chested malephotographpartysurprise endingpistoltelephone calltopless female nuditydreamfoodcar accidentwatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationdisguiseambulancedeath of frienddinerweaponnunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollskeletonautomobilepremarital sexmurdererhaunted housedismembermentkillingredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousebeer drinkinggay characterfaintingcomic booklifting someone into the airmutantloss of friendspidervictimskateboardbirthpicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childdark pastbarefoot femalegay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingmale objectificationvillain played by lead actorgiving birthmental patientmadmantaking a photographreturning character killed offkillohioassumed identitytowerevil spiritdomineering motherlistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorcarnagejockdeath of boyfriendeating disordertraffic accidentfacial scarmysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencewet clothescut handfetusghoulbroken bottledeath of loverplant in titlebody parthigh school graduationdrinking from a bottleglovearm ripped offbad dreammental asylumfemale in a showerposing for a photographbossy womanpretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partsshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killerbrutalcamera shot from inside human bodyfusiongroup hugkissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous roledrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghosthole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning lateteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | slasher flickamerican horrorteen horrorcult filmsupernaturalpsycho thrillerparanormal phenomena |
| Themes: | evilinsanitypsychopathdeathmurderprisonmonstersupernatural powermurder of a police officer |
| Mood: | slashergorecar chasedarknessbreaking the fourth wall |
| Locations: | lakewoodsboatforestcemeterysmall townamerica |
| Characters: | slasher killerserial killerterrorvillainkillerteenagerpolicezombiesheriffserial murderer |
| Period: | 1980s |
| Story: | summer camppsycho killerhomicidal maniacpsychopathic killermasked killerevil mansadistic psychopathmurder spreeserial murderslashingbad guybody countslaughtermasked manpsycho …mass murdermutilationmaniacsevered armstalkingstabbed to deathstabbingmassacreflashlightmaskblood splatterviolencesexflashbackcharacter name in titlenumber in titlesequelsurprise endingnumbered sequeldemondecapitationambulancesevered headchildlooking at the cameradrowningelectrocutionneck breakingmurdererunderwaterdismembermentkillingundeadblood spattersplattergothicmachetelifting someone into the airvictimback from the deadrampagenew jerseybutchershovelstabbed in the headsevered legsequel to cult favoritekilling spreebloodbathbeheadingmadmankillactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimoff screen murdervillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | independent horroramerican horrorcult filmindependent filmpsycho thriller |
| Themes: | evilinsanitypsychopathmurderdeathdrugsrapetortureincestbrutalityexploitationmurder of family |
| Mood: | slashergore |
| Locations: | chicago illinois |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerprostitutebrother sister relationshipserial murderermurder of a prostitute |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreeextreme violencegrindhouse filmserial murderslashinghuman monstermysterious manbad guybody countslaughter …psychostabbed in the stomachmutilationmaniacstalkingstalkerroommatestabbed to deathstabbingcriminallow budget filmblood splatterfemale nuditybare breastsbloodnuditygunviolencecharacter name in titlesurprise endingshot to deathshot in the chestmarijuanadecapitationbisexualstrangulationvideo cameradrug dealerstabbed in the chestchild abusesevered headcontroversypantyhoseattempted rapeneck breakingdismembermentkillingsplatterfemale stockinged legsragerapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childstabbed in the eyeabusive fatherkilling spreepervertvillain played by lead actormadmankillsexual violencenaked dead womanvideo footagematricideknife murdercut into piecesoff screen murderchild rapemurder of a nude womanbroken neckdisturbed individualbutcheryexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | slasher flickamerican horrorteen horrorcult filmindependent filmpsycho thrillerparanormal phenomena |
| Themes: | evilpsychopathrevengedeathmurdermonstersupernatural powerdrug addictionmurder of a police officer |
| Mood: | slashergorerainhigh school |
| Locations: | seawoodsboatnew york citycityamericasewer |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenage boyteenage girlzombiepolice officerteacher student relationshipserial murderer |
| Period: | 1980s |
| Story: | summer camppsycho killerhomicidal maniacpsychopathic killermasked killerevil mansadistic psychopathmurder spreemass murdererserial murderbad guybody countslaughtermasked manpsycho …mutilationmaniaccharacter's point of view camera shotstabbed to deaththroat slittingimpalementstabbingaxeflashlightmirrorblood splatterpantiesfemale nuditybloodviolencecharacter name in titlenumber in titlesequelbare chested maleexplosionnumbered sequeldemonhallucinationguitarmanhattan new york citydecapitationgangnew yorkstrangulationvideo camerasubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutionattempted rapeunderwaterundeadhypodermic needlelifting someone into the airback from the deadmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentstabbed in the eyecharacters killed one by onesequel to cult favoritebeheadingmadmanaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticmetrooff screen murdermurder of a nude womanghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | slasher flickamerican horrorteen horrorcult filmindependent film |
| Themes: | evilpsychopathrevengedeathmurderfeardeceptionsurveillancemurder of a police officer |
| Mood: | slashergoresatire |
| Locations: | wheelchairwoodsforestkitchenrooftopfire truck |
| Characters: | slasher killerserial killervillainkillerteenage boyteenage girlnursesecurity guardpsychiatristcoroner |
| Period: | 2000s |
| Story: | homicidal maniacpsychopathic killermasked killeraxe murderevil mansadistic psychopathgood versus evilman on firefoot chasebreaking a windowserial murderhuman monsterbad guybody countstabbed in the throat …masked manskullmaniacsevered armdisappearancecharacter's point of view camera shotstabbed to deaththroat slittingimpalementaxeflashlightsubjective cameraf wordmaskundressingmirrorblood splatterfirechaseknifefemale nudityflashbackviolencebloodfightsequeltwo word titlesurprise endingcell phonecorpsefistfightwatching tvcomputercamerabrawlfalling from heightshowdowndecapitationhalloweenstrangulationambulancemontagestabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutionproduct placementkicked in the facecollege studentlightningskeletonneck breakingmurdererthreatened with a knifeobscene finger gesturekillingchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorguefatebroken legmental institutionrampagestabbed in the headblack brae mailrainstormraised middle fingergasolinecasual sexcharacters killed one by onesequel to cult favoritekilling spreenewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetold dark houseabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | slasher horrorindependent horroramerican horrorsuspenseindependent filmsadistic horrorhorror b movie |
| Themes: | evilsadisminsanitypsychopathmurderdeathtortureescapebrutalityhome invasionexploitationcrueltymurder of a police officer |
| Mood: | slashergorenightblood and gore |
| Locations: | strip clubtrying to escape |
| Characters: | mysterious villainserial killerterrorvillainkillerteenage girlteenagerhusband wife relationshipfather daughter relationshipmother daughter relationshiphostagethiefself mutilationtalking to oneself in a mirrorthe family …mysterious killerkiller dogdirector of photography (See All) |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killermasked killerevil mansadistic psychopathgood versus evilhouse on firefoot chaseburned handinsane manmurder spreemultiple homicidegrindhouse film …psychotronic filmfinger cut offcigaretteserial murderslashinghuman monstermysterious manbad guybody countslaughterscissorssevered fingermasked manpsychomutilationmaniacscreamstabbed to deathimpalementstabbingflashlightsurvivalcriminaldead bodyslow motion scenemirrorblood splatterknifenipplesfemale frontal nudityfemale nuditybare breastsviolencefightbloodflashbackcharacter name in titletwo word titlelesbian kisssurprise endingpistolbeatingcorpseshotgunpunched in the faceshowdownheld at gunpointcar crashhandcuffsgay slurstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackhomicideeaten aliverampagewoman in jeopardyburglartrappedmobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscene after end creditsdisembowelmentperversiontitle at the endknife throwinggasolinestabbed in the eyeboxcharacters killed one by onebloodbathpsychoticdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirewifestabbed in the handset upconstruction workerpistol whiplightervery little dialogueacidclimbing through a windowself defensehead bashed inpredatorbowling alleyman kills a womanheld captivechandelierretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelcut handdragging a bodyviolent deathbutcheryex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil dogslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend … has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
| Subgenre: | slasher flickpsycho thriller |
| Themes: | evilpsychopathdeathmurderrevengetorturedrunkennessbrutalitydeath of mothermurder of a police officer |
| Mood: | slashergoredarknesshorror movie remake |
| Locations: | backwoodscampfirelakewoodsboatforestmotorcyclebathtubbicyclewaterpolice cartunnelschool bussex in a tent |
| Characters: | mysterious villainterrorvillainkillerteenage girlboyfriend girlfriend relationshipafrican americantattoobrother sister relationshipsheriffasian americanserial murdererblonde girlgirl nudity |
| Period: | summer1980s |
| Story: | summer camppsycho killercamp counselorporn magazinehomicidal maniaccampfire storypsychopathic killermasked killeraxe murderevil mansadistic psychopathshower curtainserial murderslashinghuman monster …canoebad guybody countdisfigurementstabbed in the throatmasked manpsychocampmutilationelectronic music scoreburned alivemaniaccabinsuspicionstalkingdisappearancemissing personstalkerskinny dippingstabbed to deaththroat slittingimpalementstabbingmassacreaxeflashlightswimmingdead bodymaskblood splatterfirechasenipplesfemale frontal nudityfemale rear nudityfemale nuditysex scenebare breastsviolencebloodnuditynumber in titlemasturbationdogbare chested malesurprise endingpistoltelephone calltopless female nuditywoman on topcorpsedigit in titleurinationblonderemakeshot in the headbare buttmarijuanahallucinationalcoholdecapitationbracandlestrangulationtoplessvideo cameradeath of friendstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningstabbed in the backprologuescreamingmini skirtmoaningtentopening action scenepremarital sexlove interestkissing while having sexpot smokingfireplacebow and arrowmachetescene during opening creditscaptivewalkie talkiebuttockscovered in bloodrampagerear entry sexgrocery storenew jerseybackpackpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonebody landing on a carstabbed in the eyesevered legcharacters killed one by onearrowburned to deathpsychoticmannequinplantvillain played by lead actorbeheadingstabbed in the handbongstaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chesthearing noisesmissing sisterfireplace pokersummer housepower cutunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
| Subgenre: | slasher horrorslasher flickteen horrorteen movieindependent filmsurvival horrorhorror spoofslasher spoofhorror comedyhorror parody |
| Themes: | bullyingvoyeurismmurderrevengedeathfriendshipsurrealismkidnappingfearescapeseductionbrutalitydeath of mothertime travelpanic …self sacrificenear death experience (See All) |
| Mood: | slashersatirespoofhigh schoolparodyambiguous ending |
| Locations: | woodsforesthospitalsinging in a car |
| Characters: | slasher killerserial killerkillerteenage boyteenage girldoctorteenagerhomosexualmother daughter relationshiptattoofemale protagonistgirlnursehostagemother …ex boyfriend ex girlfriend relationshipparent child relationshipself referentialparty girl (See All) |
| Period: | 1980syear 1986year 1987 |
| Story: | summer campcamp counselorporn magazineprank gone wrongplayboy magazinecigarette smokingmurder by stabbingmasked killergood versus evilperson on firefoot chasegrindhouse filmpsychotronic filmburn victimcigarette …urban legendbody countdisfigurementmasked mancampbarnelectronic music scoreprankscreamaccidentstabbed to deathimpalementsurvivalf wordvoyeurundressingslow motion scenerescuefirepantieschaseknifeviolenceflashbacktwo word titlebare chested maledancingexplosionthree word titlesurprise endingcell phoneshot to deathcar accidentshot in the chestblondevomitingshowdowncar crashdecapitationcleavagegay slurorphansword fightambushmontagedinerstabbed in the chestwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaserace against timelightningscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowmacheteslow motionwatching a moviemovie theaterlosshome movievirginitypresumed deadtarget practicemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogknife throwinggasolinedark pastcharacters killed one by onegeekteleportationface maskfinal showdownbloopers during creditsmovie actressfilm in filmshot with an arrowhospital bedone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonecar rolloverstupid victimclimbing out a windowwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen busouttakes during end creditsyear 1957horror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | slasher flickindependent horroramerican horrorteen horrorteen moviecult filmindependent film |
| Themes: | evilpsychopathrevengemurdersurrealismfuneralsupernatural power |
| Mood: | slashergorehigh schoolnightmareavant garde |
| Locations: | cemeterybathtubpolice station |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipalcoholicpolice chaseself mutilation …serial murdererpolice lieutenant (See All) |
| Period: | 1980s |
| Story: | homicidal maniaccigarette smokingpsychopathic killerevil mansadistic psychopathgood versus evilperson on firefoot chaseserial child murderserial child murderergrindhouse filmfinger cut offserial murderbad guybody count …disfigurementsevered fingerpsychoelectronic music scoreburned alivemaniacstalkingcharacter's point of view camera shotsubjective cameraslow motion scenemirrorblood splatterviolencebloodbare chested malesurprise endingdreamcorpseface slaparrestfalling from heightbeddemonjailclassroomtelephonestrangulationdeath of friendstabbed in the chesthousecoffeefirst of serieshangingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairsgothiclifting someone into the airhatcrucifixgrindhousevictimstrong female leadseriesswitchbladebutcherheadphonesbooby trapcharacters killed one by onecellaralarm clockmadmanvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcheryplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | slasher flickamerican horrortragedypsycho thriller |
| Themes: | evilsadisminsanitypsychopathmurderdeathsuicidekidnappingrapetorturebrutalitydysfunctional familyhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
| Mood: | slashergoredarknessblood and gore |
| Locations: | small townstrip club |
| Characters: | slasher killerserial killerterrorvillainkillerboydoctorboyfriend girlfriend relationshipteenagerafrican americanhostagepsychiatristsheriffserial murderer |
| Period: | 1970s |
| Story: | psycho killerporn magazinepsychopathic killermasked killerevil mansadistic psychopaththroat slitmurder spreemultiple homicidemultiple murderextreme violencemass murdererserial murderslashinghuman monster …bad guybody countmasked manpsychomass murderelectronic music scoreteenage sexmaniacstalkingcharacter's point of view camera shotstabbed to deaththroat slittingimpalementstabbingmassacresubjective cameraf worddead bodymaskblood splatterchaseknifefemale frontal nudityfemale rear nudityfemale nuditymale nuditybloodsexviolencefemale full frontal nudityphotographtitle spoken by characterpistolwoman on topbeatingcorpseremakeshot in the headfalling from heighttelevisionstrippershot in the backstrangulationstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformbaseball bathangingshot in the shoulderpremarital sexmurdererloss of motherprofanitykillingblood spattersplatterkilling an animallifting someone into the airrageloss of friendpsychologistvictimhome moviebroken legrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearinghit with a baseball batpervertmexican americanmadmandead animaltrick or treatingabandoned housesexual violencetombstoneschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitaldisfigured facegraphic violencemasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimdying during sexanimal killingvillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkpsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | slasher flickamerican horrorteen horrorcult filmindependent filmpsycho thriller |
| Themes: | evilinsanitypsychopathdeathmurderdrugsparanoiaabductionalcoholism |
| Mood: | slasherhigh schoolnightmare |
| Locations: | schoolsmall townelevatorkitchentruck |
| Characters: | slasher killermysterious villainserial killerterrorvillainteenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipspolicemother son relationshipbrother sister relationshipgirlnurse …policemansecurity guardalcoholicsecretary (See All) |
| Period: | 1990syear 1998 |
| Story: | psycho killerhomicidal maniacpsychopathic killermasked killeraxe murderevil mansadistic psychopathgood versus evilmurder spreeserial murderslashingmysterious manbad guybody countmasked man …psychomaniacstalkingcharacter's point of view camera shotstalkerstabbed to deaththroat slittingstabbingaxeflashlightsubjective cameradead bodymaskchaseknifebloodviolencenumber in titlesequelpistolcar accidentfalling from heightbirthdayneighborhallucinationtelephonedecapitationhalloweenwinecandlecaliforniaambulancedeath of friendtoiletstabbed in the chestweaponsevered headattempted murderstabbed in the backprologuekeyuniformmistaken identityactor shares first name with characterreunionflowersplatterbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingvictimfaked deathrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingcharacters killed one by onedivorceesecret identitypumpkinnewspaper clippinghockeyreflectionstolen caranniversarybeheadingcar troublemadmanfire extinguisherreturning character killed offhiding in a closetgatebody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimvillain not really dead clichesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | slasher flickamerican horrorteen horrorteen moviecult filmindependent filmpsycho thrillerholiday horror |
| Themes: | evilpsychopathmurderdeathfearcorruptionparanoiamurder of family |
| Mood: | slasherhigh schoolnight |
| Locations: | carsmall towncar theftkitchen knife |
| Characters: | slasher killerserial killerterrorvillainkillerteenage boyteenage girlboyteenagerhusband wife relationshipfemale protagonistgirllittle girllittle boypsychiatrist …doctor patient relationshipserial murderer (See All) |
| Period: | 1970s1960syear 1963year 1978 |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killermasked killerevil mansadistic psychopathgood versus evilmurder spreegrindhouse filmcigaretteserial murderhuman monsterbad guybody count …masked manpsychostabbed in the stomachmutilationelectronic music scoremaniacstalkingcharacter's point of view camera shotstabbed to deaththroat slittingstabbingsubjective cameralow budget filmmaskblood splatterknifefemale nuditynudityviolencegunone word titledogtitle spoken by charactersurprise endingshot to deathshot in the chestwatching tvfalling from heightrunningmarijuananeighbortelevisiontelephonehalloweenstrangulationchildgunshotattempted murderprologuesuburbfirst of seriespay phonehalloween costumelong takemurdererfirst parthandgunkillingpot smokingteen angstbulletbabysitterlifting someone into the airblockbustergrindhousedead womanwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openkilling spreepumpkinnude woman murderedphonedead doggothmental patientmadmanyellingclosethiding in a closetkillsuit and tiefence17 year oldautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimoff screen murderwetnessvillain not really dead clicheescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | slasher flicksuspensecult filmindependent filmaustralian horrorsadistic horror |
| Themes: | evilsadisminsanitypsychopathmurderdeathkidnappingrapedrinkingfeartorturedrunkennessescapebrutalityabduction …exploitationcruelty (See All) |
| Mood: | slashergorecar chasenightdarknessblood and gore |
| Locations: | campfirehelicopterbarbeachrestaurantswimming poolcarairplanedesertaustraliaroad triptruckcavegas stationroad movie …australian outbackcar on fireshed (See All) |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerdoctorhusband wife relationshipsingerhostageaustralianself mutilationserial murderermysterious killer |
| Period: | year 1999 |
| Story: | psycho killerhomicidal maniaccampfire storycigarette smokingpsychopathic killerevil mansadistic psychopathabandoned minemurder spreeextreme violencegrindhouse filmmass murdererfinger cut offserial murderslashing …human monstermysterious manbad guybody countslaughtersevered fingerredneckpsychomutilationmaniacstabbed to deathimpalementstabbingmassacreflashlightf wordswimmingvoyeurlow budget filmdead bodyslow motion scenemirrorblood splatterchaseknifekissgunviolenceblooddogtwo word titlephotographtitle spoken by characterexplosionsingingpartybased on true storysongcorpseshot to deathcar accidentshot in the chesturinationshot in the headshotgundrinkvomitingrifleheld at gunpointsunglassescafebathroomguitarshot in the backgay slurbound and gaggedvideo camerafalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufokillinggaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencestrangervictimhome movierapisthomiciderampagesufferingmercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionrainstormcapturecliffminetied feetopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathdrugged drinkreflectionpervertbarking dogcar troublemadmancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisesurfboardlying on bedauto mechanicstation wagoncar set on firemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimkangaroocar rolloverdriving at nightvillain not really dead clichedisturbed individualbutcheryexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkmobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womanrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | evilinsanitypsychopathmurderdeathrevengesuiciderapetorturecannibalismrape and revenge |
| Mood: | slashergore |
| Locations: | desertwaternew mexico |
| Characters: | slasher killerserial killerterrorvillain |
| Period: | year 2007 |
| Story: | psycho killerhomicidal maniacaxe in the headpsychopathic killeraxe murderevil mansadistic psychopathgood versus evilextreme violencegrindhouse filmpsychotronic filmserial murderhuman monsterbad guybody count …severed fingerpsychocampmaniacsevered armstabbed to deathimpalementstabbingsurvivalf wordrescueblood splatterfirefemale nuditybare breastsnudityfightsequelexplosionsurprise endingpistollickingcorpseshot to deathshot in the chestremakeshot in the headfalling from heightriflenumbered sequelgay slurarmystabbed in the chesttrainingbeaten to deathstabbed in the backkicked in the faceshot in the shouldertragic eventexploding bodydismembermentsplatterropeclaim in titlemutantrageassaultaccidental deathbroken legguardrampagehit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminekilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesgiving birthmadmanstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathgraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysledgehammerstupid victimhillbody partno endingstabbed in the mouthfalling off a cliffsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | independent horroramerican horrordark comedyblack comedycult filmindependent filmsupernaturalparanormalpsycho thriller |
| Themes: | evilsadisminsanitypsychopathmurderdeathsurrealismdrugsghosttorturesupernatural powerdeath of motheramnesia |
| Mood: | slashergorerainhigh schoolnightmaredarkness |
| Locations: | small townairplaneroad trip |
| Characters: | slasher killerserial killerterrorvillainkillerteenagerfamily relationshipsfather son relationshipfather daughter relationshipteacherself mutilationyounger version of characterdeafnessserial murderergerman american …evil father (See All) |
| Period: | 1990s1970s1960s1940s1950s |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathgood versus evilserial child murderserial child murderermurder spreefinger cut offserial murderhuman monsterbad guybody countdisfigurement …slaughtersevered fingerpsychomutilationburned alivemaniacimpalementsubjective cameracriminalslow motion scenerescueblood splatterfireknifeflashbackbloodviolencef ratedcharacter name in titlesequelbare chested maletitle spoken by characterpunctuation in titletitle directed by femaledreamfalling from heightapostrophe in titledemonstrangulationstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murderfalling down stairskilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothvictimorphanagerapistback from the deadrampagecameocrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childknife throwingraised middle fingerdark pastabusive fatherkilling spreepsychoticnewspaper clippingposterhit with a baseball batmarijuana jointvillain played by lead actormadmanstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamechild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseelm streetspringwood ohioabusive childhoodspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
| Subgenre: | teen horrorb moviedark comedysuspenseblack comedyindependent filmmartial artsabsurdismfish out of water |
| Themes: | psychopathmurderdeathfearescapemonstermilitarybrutalitysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia |
| Mood: | slashergoreambiguous ending |
| Locations: | lakewoodsforestouter spacelaboratoryspace stationresearch stationship explosion |
| Characters: | terrorvillaindoctorboyfriend girlfriend relationshipteenagerteachersoldiertough guyteacher student relationshipprofessorengineerbabe scientist |
| Period: | 2000s |
| Story: | summer camppsychopathic killermasked killerevil manextreme violencemass murdererarm cut offslashinghuman monsterdisfigurementslaughtermasked manmass murderstabbed in the stomachmutilation …electronic music scoresevered armstalkingstalkerstabbed to deaththroat slittingimpalementmassacreflashlightsurvivalmaskrescueblood splatterfirechaseknifenipplesfemale frontal nudityfemale nuditysex scenekissflashbackbloodviolencefightcharacter name in titlenumber in titlesequelbare chested maleexplosionsurprise endingpistolbeatingcorpseshot to deathfistfightmachine gunshot in the chestface slapshot in the headshotgunpunched in the facecomputerfalling from heightshowdownrifleheld at gunpointhand to hand combatnumbered sequelrobotkung fuscientistshot in the backdecapitationambushstrangulationmixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotbeaten to deathdangerstabbed in the backprologuekarateelectrocutionrace against timekicked in the facetough girlinjectionexploding bodyneck breakingthreatened with a knifemercenarylove interestkissing while having sexdismembermentundeadsurgerysabotagehypodermic needlemachetecowboy hatroman numeral in titlespacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityback from the deadandroidpresumed deadcyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramknife throwingfemale doctorsevered legcharacters killed one by onetank topgatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldiermadmanface maskfemale fightercameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shouldermicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinefemale victimmurder of a nude womanarmy basestupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
| Subgenre: | american horrordark comedyblack comedycult filmindependent filmpsycho thrillersurvival horror |
| Themes: | evilsadisminsanitypsychopathmurderdeathkidnappingdeceptionincestmental illnesshome invasiongreedcannibalismwealthstarvation …claustrophobia (See All) |
| Mood: | slashergoresatiredarknesssocial satire |
| Locations: | los angeles californiaslum |
| Characters: | terrorvillainboypolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog |
| Period: | 1990s |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killerevil mansadistic psychopathmurder spreegrindhouse filmwoman slaps a manserial murderslashinghuman monsterbad guybody countstabbed in the throat …severed fingermasked manskullpsychostabbed in the stomachmutilationmaniacimpalementflashlightblood splatterknifeviolenceblooddogtitle spoken by characterpistolcorpseshot to deathshot in the chestface slapshotgunbirthdaymansionhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondolldeath of childskeletonbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragespidersevered handgrindhousesadomasochismrampagehit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boycellarlasersightlandlordgothpervertmadmanhiding in a closetold dark houseschemeevictionlighterfemale psychopathclimbing through a windowanimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dressdisturbed individualstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
| Subgenre: | american horrorb moviecult filmindependent filmvideosadistic horrorhorror b movie |
| Themes: | evilsadismpsychopathvoyeurismrevengemurderdeathkidnappingrapefeartortureseductionangerbrutalityhumiliation …exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
| Mood: | slashergore |
| Locations: | lakeforestnew york citychurchcarsmall townbathtubbicyclewatergas stationcountry |
| Characters: | serial killervillainkillerfemale protagonistgirlwriterlustserial murdererself justicesex with a stranger |
| Period: | 1970s |
| Story: | psycho killercigarette smokingpsychopathic killeraxe murderevil mansadistic psychopathnipples visible through clothingvideo nastymurder spreemultiple homicideextreme violencegrindhouse filmmotorboatserial murderhuman monster …canoebody countredneckmutilationcabinsmokingaxevoyeurlow budget filmbikinimirrorcryingpantiesknifenipplesfemale frontal nudityfemale rear nudityfemale nuditymale nuditybare breastsviolencegunbloodmale frontal nuditybare chested malefemale full frontal nuditymale full frontal nudityleg spreadingfondlingbeatingmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkfemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manygraveauthorscreamingunderground filmhangingfemale removes her clothesglassesthreatmurdererhandgunvigilantekillingrecord playereyeglassesclaim in titleinjurysexual abuseragedesperationgrindhousevictimrape victimrapistfemale killerwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationbruisecharacters killed one by onekilling spreemisogynywoman in bathtubpervertkillviolence against womenvigilantismmisogynistfemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockgraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathone woman armyviolent deathdelivery boynoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
| Subgenre: | slasher flickteen horrorteen moviesuspenseblack comedycult filmindependent filmfish out of watersurvival horrorpsychological thriller |
| Themes: | insanitypsychopathmurderdeathrevengefriendshipkidnappingfeartortureescapebrutalityparanoiahome invasionpaniccannibalism …couragehuntingmurder of a police officerwildernessnear death experience (See All) |
| Mood: | slashergore |
| Locations: | woodsforestbathtubpolice cartruckcavegas station |
| Characters: | slasher killerteenage boyteenage girlboyfriend girlfriend relationshipteenagerpolice officerhostageinterracial relationshipself mutilation |
| Period: | 2000s |
| Story: | cigarette smokingaxe murderperson on firefoot chasehuman monsterbody countdisfigurementrednecksevered armstalkingprankstalkerstabbed to deathaxeflashlight …survivalslow motion scenerescueblood splattercryingfirechaseknifeviolencesexbloodexplosionsurprise endingpistolcell phonebeatingcorpseshot to deathcar accidentshot in the headshotgunfalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationbound and gaggedambushmountaindeath of friendtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreedangerstabbed in the backprologuescreamingfirst of seriesdollcollege studentscene during end creditsfirst partthreatened with a knifewaterfallnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daygasolinesevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark housemental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
After Iggy's long-time girlfriend is murdered and the whole town agrees he is the killer, he awakens one morning with horns and the townspeople soon confess their sins. Once knowing the sins of the people, he is facing the true killer of his beloved girlfriend.
| Subgenre: | supernaturalmurder mysteryurban fantasy |
| Themes: | evilmurderdeathrevengelovefriendshipinfidelityrapereligionjealousydrunkennessinvestigationangersupernatural powerdeath of mother …cancerillnessalcoholismcrueltytraumadevilpolice investigationmurder of a police officernear death experiencedeath of daughterrape and murder (See All) |
| Locations: | sex outdoorswoodsforesthospitalbarchurchcemeterysmall townpolice carsex outsidesex in a carsex in chaircar on firesex in woods |
| Characters: | killerteenage boyteenage girldoctorboyfriend girlfriend relationshipfriendteenagerfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationship …girlpolice officernursepolicemanmusicianpriestlawyerlove trianglechristianbest friendreference to godlittle girlgay kisswaitressinterracial relationshipchristianityalcoholicchildhood friendyounger version of charactercheating girlfriendreligious fanaticdeath of girlfriendbetrayal by friend (See All) |
| Story: | social outcastporn magazinecigarette smokingcrying for helpsetting a firehouse on firecrying womanperson on firemale female fighttalking about masturbationpointing a gun at someonediscovering a dead bodyhand injuryhysterical womanfinding a dead body …burn victimimmolationseductive behaviorhospital roommasturbation referencewormrepeated sceneoutcastbeing followedsevered fingerfollowing someonemagazinefriendship between menburned alivewitnessimpalementstabbingdead bodyundressingslow motion scenecryingfirefemale frontal nudityfemale rear nudityfemale nuditysex scenemale nuditybare breastsflashbackfightviolencebloodbased on novelone word titlemale frontal nuditybare chested maleinterracial sexphotographtitle spoken by charactermale full frontal nudityexplosiontopless female nudityvoice over narrationshot to deathshot in the chesturinationblondeface slapshot in the headshotgunpunched in the facewatching tvbrawlsecretletterliehallucinationhandcuffsreference to jesus christprayerreportergay slurnewspaperjournalistcandlecocainedinerstabbed in the chestsnakenonlinear timelineno opening creditsscantily clad femaleunderwater sceneshot in the legnecklacetransformationbartendergunshotconfessionattempted murderpublic nuditydrug addictcursevirginbeaten to deathprotestdollstatueringscarhairy chestcrosscharacter says i love youloss of motherredheadcheating wifearsonterminal illnesstopless womancloseted homosexualrockanswering machineaddictionheavy raingay characterdruglistening to musicgroup of friendstold in flashbackcaught having sexdemonstrationvisitteddy bearcrying manpresumed deaddrug overdosepump action shotgunbreakupblood on faceconfrontationunfaithful wiferejectionbroken glassjunkietaking a picturepolice officer shotfirst kissdeath of protagonistaccidental killingfriendship between boyswedding ringsuspectgasolinemale male kissbarefoot femaleinjusticechainriding a bicycleplaying pianoframed for murderseattle washingtonengagement ringsinmale objectificationblood on camera lensbarking dogtaking a photographcartoon on tvmolotov cocktailstuffed animalplaying poolhead blown offdoubtdrunken manpiano playingloss of daughtertemptationmale in underwearoutsiderdouble barreled shotgun13 year oldexhibitionistgramophonereceptionistbare chested boystreet fightbitten in the neckman punching a womantaking off shirthandcuffedtopless girlconscienceurinatingtrumpetmurder suspectsleeping in a carevil womancar set on firewatermelonmurder attemptmurder by gunshottreehousedance scenehiding placeriding a bikepitchforkmemorialrescue from drowningtaking off clothesundressing someonetraumatic experienceangstturkeydeath by gunshotsnake bitepunch in facedonutsex from behindcloseted gaymale male hugblasphemycrime of passionseductive womanwingsdrug triptitle spoken by narratorvinylman slaps womandaredrunken womanspoiled bratcrying malemoving outselfish womanhornlearning the truthburnreference to the rolling stonesman hits womancharacter says i'm sorryvicarloss of girlfriendtalismanhysterical outburstdeath by shootingantiherotv crewbitten on the armbiblical referenceblood on handscherrybreaking upspoiled childhomophobic slurmelonunfaithful girlfriendreference to david bowietrumpet playerpassed out drunkmorse codeoutburstsex at workfalse accusation of murderchildhood flashbackscreaming girlmurder disguised as suicideprivate investigationhit on the head with a rockmurder by shootingbitten in the facesleeping on the floorbrother brother conflictestranged motherupside down camera shotheavy smokerreference to nirvanahornstree houseasthma inhalerbanging head against wallterminally illgay copplush toyreference to jim morrisonangel wingssearch for truthgrieving fatherplaying trumpetspoiled girlbitten by a snakeadvocatepunch in stomachreference to the doorswingbrother brother fightgoodbye letterstabbed with a pitchforkdeath during sexfight between friendschristian fanaticgolf instructorattention seekerdelirium tremensoutdoors sexselfish motheramc gremlinchainletcherry bomb (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | black comedycult filmindependent filmpsycho thrillersadistic horror |
| Themes: | evilsadisminsanitypsychopathdeathrevengemurderfriendshipsuicidekidnappingrapebetrayalfeartortureescape …deceptionseductionangerdeath of fatherbrutalitydeath of motherparanoiahumiliationexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
| Mood: | gorenightmareambiguous ending |
| Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
| Characters: | serial killerterrorvillainprostituteboyfriend girlfriend relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshiptattoobrother brother relationshipbrother sister relationship …police officernursehostagetough guymaidsheriffpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
| Period: | 1970syear 1978 |
| Story: | homicidal maniaccigarette smokingpsychopathic killeraxe murderevil manhouse on firefoot chasemurder spreemultiple homicidegrindhouse filmmass murdererserial murderhuman monsterbad guybody count …disfigurementslaughterstabbed in the throatredneckmasked manmass murderstabbed in the stomachmaniacstabbed to deaththroat slittingimpalementaxesurvivalf wordcriminallow budget filmdead bodyslow motion scenerescueblood splatterfireshowerpantieschaseknifefemale rear nuditymale rear nuditysex scenebloodviolenceflashbacksequeldogbare chested malefemale full frontal nudityphotographtitle spoken by characterexplosionpistolshootoutwoman on topbeatingdreamcorpseshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunpunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partinterrogationmarijuanajailhandcuffsrevolvershot in the backgay slurbound and gaggedambushstrangulationdeath of frienddrug dealercocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencehead buttlooking at oneself in a mirrorscene during opening creditsragecowboy hatkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipgas maskwatching televisionrampagecrime scenestealing a carhatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copknife throwinggasolinebarbecueranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingmadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynistsexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortingbutcheryevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtcmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
| Subgenre: | b moviesuspenseblack comedycult filmindependent filmabsurdismsurvival horrorpsychological thrillerbody horror |
| Themes: | insanitymurderrevengedeathfriendshipdrinkingfeardrunkennessescapebrutalityparanoiaguiltillnessunrequited lovehome invasion …exploitationpanicpolice brutalityhuntingcamping (See All) |
| Mood: | goreraincar chaseambiguous ending |
| Locations: | backwoodscampfirelakewoodsforesthospitalbathtubbicyclewaterfarmtruckcavegas stationshed |
| Characters: | doctorboyfriend girlfriend relationshipfather son relationshippoliceafrican americanpolice officersheriffself mutilationhomeless mankiller dog |
| Period: | 2000s |
| Story: | campfire storycigarette smokingsexual desireperson on firefoot chaseweirdraftcanoedisfigurementslaughterstabbed in the throatredneckburned alivesevered armcabin …skinny dippingstabbed to deathimpalementmassacreaxesurvivalf wordswimminglow budget filmdead bodybikinislow motion sceneblood splatterfireshowerpantieschaseknifefemale frontal nudityfemale rear nudityfemale nuditysex sceneflashbackbloodviolencemasturbationdogbare chested malefingeringphotographpartysurprise endingpistolcell phonewoman on topbeatingcorpseshot to deathhorsecar accidentshot in the chesturinationblondeshot in the headshotgunpunched in the facewritten by directorbrawlbare buttvomitingrifleheld at gunpointbeermarijuanahallucinationrevolverguitarshot in the backdecapitationcleavagegay slurambushambulancedeath of friendstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivereverse footagetensionstealing a carunderage drinkingstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistdeerranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemicmental retardationabandoned housesquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingmarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | suspensesupernaturalparanormalpsycho thriller |
| Themes: | evilinsanitypsychopathmurderdeathsuicidekidnappingmarriagerapeghostprisonfeartortureescapememory …supernatural powerparanoiadrug usemental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
| Mood: | slashergorerainneo noirnightmaredarkness |
| Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
| Characters: | slasher killerserial killerterrorvillainkillerdoctorfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshiptattoofemale protagonistnurse …policemanlawyerreference to godsecurity guardpsychiatristsheriffself mutilationdoctor patient relationshipstepfather stepdaughter relationshipserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
| Story: | psycho killerhomicidal maniacpsychopathic killeraxe murderevil mansadistic psychopathman on fireperson on firefoot chaseleavingextreme violenceserial murderslashingbad guypsycho …barnmaniacstalkingaccidentthroat slittingaxeflashlightsubjective camerasurvivalswimmingmirrorblood splattercryingfireshowerchaseknifefemale frontal nudityfemale nuditykissflashbacksexviolencebloodfightgunf ratedinterviewbare chested malephotographexplosionsurprise endingpistoltelephone callcell phonedreamcorpsecar accidentshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreportervideo camerawomanbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingfantasy sequencepay phonefugitiveumbrellapossessionlightningattempted rapeinjectionpursuitdeath of husbandmurderertrustkillingtherapypizzasyringehypodermic needlegothicheavy rainsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctornervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderdead girlmemory lossintimidationgothvideo tapemental patientmadmanelectricitykillmental breakdownblackoutsatanismblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockcamcordergraphic violenceinmatebloody violencetrapdoorfemale victimpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
| Subgenre: | american horrorsuspensecult filmindependent filmpsycho thrillerpsychological horror |
| Themes: | insanitypsychopathvoyeurismdeathmurdermarriagemoneyfearfuneraldeceptiondivorcetheftguiltdatingmental illness …unrequited lovemadness (See All) |
| Mood: | slasherraindarknessbreaking the fourth wall |
| Locations: | stormchurchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water |
| Characters: | slasher killerserial killerterrorvillainkillerfriendfamily relationshipsmother son relationshippolicemansister sister relationshipthiefpsychiatristsecretarysheriffserial murderer |
| Period: | 1960syear 1960 |
| Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathgood versus evilshower curtainmissing womanmurder spreegrindhouse filmserial murderslashinghuman monstermysterious manbad guybody count …skullpsychomutilationmaniacwitnessmissing personscreamcharacter's point of view camera shotstalkerbirdstabbed to deathstabbingsubjective cameravoyeurundressingshowerbloodviolenceflashbackbased on novelone word titleinterviewbare chested malephotographsurprise endingtelephone callvoice over narrationcorpseunderweararrestsecretbathroomjailhallucinationnewspaperbracaliforniadisguisewomanwidowtoiletstabbed in the chestbathold womanwidowerfirst of seriesmistaken identitylong takefemale removes her clothescountrysidebasementtrapmurdererfirst partthreatened with a knifecross dressingkillingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airblockbusterimpersonationphone boothgrindhousevictimdriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatbutcherblack braswamparizonarainstormextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathpsychoticfemale stockinged feetimpotencevillain played by lead actormadmandirector cameoold dark housefemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodydomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderbloody violencefemale victimreclusemurder of a nude womansilhouettefade to blackpeep holedisturbed individualbutcherycrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in brapsycho terrorloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad motherremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpsenight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | slasher flickindependent horroramerican horrorteen horrorsuspenseblack comedycult filmindependent filmtragedypsycho thrillersurvival horror |
| Themes: | evilsadisminsanitypsychopathdeathmurderfriendshipkidnappingfeartortureescapebrutalityparanoiadysfunctional familyexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
| Mood: | slasheravant gardedarknessambiguous ending |
| Locations: | stormwheelchaircarcemeterykitchenfarmroad triptruckgas stationtexascountryback country |
| Characters: | slasher killerserial killerterrorvillainkillerteenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipsbrother brother relationshipbrother sister relationshiphostageself mutilationtruck driver …serial murdererself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | homicidal maniacpsychopathic killermasked killerevil manfoot chasemurder spreescreaming womangrindhouse filmpsychotronic filmserial murderslashinghuman monsterurban legendbad guybody count …redneckmasked manskullpsychobarnmutilationmaniacstalkingimpalementmassacreflashlightsurvivallow budget filmmaskblood splatterchaseknifebloodviolencephotographsurprise endingvoice over narrationbeatingcorpseurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunningcollegedecapitationbound and gaggedambushdeath of friendstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckchainsawropegothiclifting someone into the airgroup of friendsloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodgrindhousevictimproduced by directorhitchhikerhitchhikingfull moonrampagewoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathsouthern accentclose up of eyescar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark housescene before opening creditsmeatestatetexanabandoned housefarmhouseanimal crueltycar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimsledgehammercut handclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherysocial decaybludgeoningextreme close upwoman in dangerleg injurysinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | suspensecult filmparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
| Themes: | sadisminsanitypsychopathdeathmurdersurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigation …angercorruptiondeath of fatherbrutalityparanoiablackmailillnesshome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
| Mood: | slashergorenightdarkness |
| Locations: | wheelchairhospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenaustraliapolice stationpolice car …cityitalytruck (See All) |
| Characters: | slasher killermysterious villainserial killerterrorvillainkillerboydoctorboyfriend girlfriend relationshiphomosexualfather son relationshippolicemother son relationshipfather daughter relationship …singergirlpolicemanmusicianactresspsychiatristmaidprofessorjewgermangay friendserial murdererself pity (See All) |
| Period: | 1970s |
| Story: | homicidal maniaccigarette smokingpsychopathic killersadistic psychopathhouse on firevideo nastymurder spreeextreme violencegrindhouse filmpsychotronic filmserial murderslashinghuman monstermysterious manbody count …disfigurementslaughterstabbed in the stomachdesiremaniacsuspicionwitnessstalkingbirdstabbed to deathimpalementstabbingaxeflashlightsurvivalsubjective cameradead bodymirrorblood splatterfirechaseknifekissbloodgunflashbackviolencetwo word titlephotographsingingsurprise endingtelephone callsongshootoutbeatingcorpseface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningcafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereporterdecapitationgay slurnewspaperbedroomjournalistbandold manstrangulationdinerhousejokebrunettedrivingsevered headdrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianistthreatdarkbasementtrapcult directorpsychiceuropekillingarsonrecord playertv newsfireplacebreaking and enteringstreetdressgothictape recorderrome italymagiciantoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingdark pastfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsapparitiondark secretkillgloveslong hairmen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanfamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimhouse fireclose up of eyefingerprintsilhouettebutcheryhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicwitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
| Subgenre: | american horrorsuspenseblack comedycult filmindependent filmmartial artssupernaturalparanormal |
| Themes: | evilpsychopathrevengemurderfuneralsupernatural power |
| Mood: | slashergorerainhigh schoolnightmare |
| Locations: | hospitalbeachcemeterysmall townelevatorschool nurseblood in water |
| Characters: | slasher killerserial killerterrorvillainkillerfriendteenagerfather son relationshipfather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress …serial murderer (See All) |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killerevil mansadistic psychopathperson on fireserial child murderserial child murderermurder spreeburn victimserial murderslashingbad guydisfigurement …stabbed in the stomachmutilationelectronic music scoremaniacsevered armstabbed to deathblood splatterfirefemale frontal nuditybloodnumber in titlesequeldogbare chested malephotographsurprise endingdreamcorpsedigit in titleurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerpay phonekicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersleepingkillingundeadpizzasurgeryteen angstslow motionwoman with glasseslifting someone into the airkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamsoulabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawtime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoelm streetspringwood ohiofilm starts with a quotepin up girlfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
| Subgenre: | american horrorteen horrorsuspenseblack comedysuperherotragedypsycho thrillersurvival horrorpsychological thriller |
| Themes: | insanitypsychopathvoyeurismdeathmurderfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeception …death of fatherbrutalityparanoiamental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
| Mood: | slashergoreneo noir |
| Locations: | woodsforesttraintaxikitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
| Characters: | slasher killerserial killerterrorvillainkillerteenage girldoctorteenagerfather daughter relationshipafrican americanpolice officerhostagesecurity guardpsychiatristuncle niece relationship …serial murdererpolice dog (See All) |
| Period: | 2010s |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathserial murderhuman monsterbad guybody countpsychomaniacsuspicionstalkingmissing personcharacter's point of view camera shot …stalkerflashlightsurvivalsubjective cameravoyeurrescuepantieschaseknifeflashbackbloodviolenceone word titlesequeldogbare chested maledancingtitle spoken by characterpartysurprise endingcell phonecorpseshot to deathshot in the chestshotgunwatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborriverorphanbedroomambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderdangertentknocked outbaseball batflowersscarinjectiontragic eventhigh school studentbasementlaptoploss of fathermurdererkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastcharacters killed one by onekilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditsspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
| Subgenre: | slasher flickteen horrorteen moviesuspenseblack comedycult filmcoming of ageconspiracypost modernpsychological thrillerhorror spoof |
| Themes: | psychopathmurderrevengedeathfriendshipinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcebrutalitydeath of mother …paranoiahome invasionnear death experiencedeath of daughter (See All) |
| Mood: | slashergoresatirehigh schooldarkness |
| Locations: | woodsforestsmall townkitchenpolice stationschool bus |
| Characters: | slasher killerserial killervillainkillerteenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipbrother sister relationship …female protagonistsheriffsingle fatherself referential (See All) |
| Period: | 1990s |
| Story: | cigarette smokingmasked killernipples visible through clothingfoot chasemasked mansuspicionstalkingprankscreamcharacter's point of view camera shotstalkerstabbed to deaththroat slittingflashlightsurvival …subjective cameraf wordmaskslow motion scenerescueblood splatterfirechaseknifeviolencebloodf ratedone word titlebare chested maletitle spoken by characterpartysurprise endingpistolcell phonecorpseshot to deathcar accidentshot in the chestblondeface slapshot in the headpunched in the facewatching tvcomputercatarrestfalling from heightshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonebound and gaggedcaliforniadisguiseambulancedeath of friendstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadvirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriesproduct placementhangingshot in the shoulderamerican flaghigh school studentcheerleaderpremarital sexfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidepresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by oneframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation …at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)
| Subgenre: | slasher flickamerican horrorindependent film |
| Themes: | evilmurderdeathfriendshipfearescapeself sacrifice |
| Mood: | slasherdarkness |
| Locations: | foresthospitalcarbathtubbuspolice stationpolice carrunning in the forest |
| Characters: | slasher killerserial killervillaindoctorfriendpolicegirlpolice officernursepsychiatristuncle niece relationship |
| Period: | 1980s20th century |
| Story: | stabbed with scissorsmasked killergood versus evilhiding behind a treemass murdererserial murderhuman monsterbad guybody countscissorsmasked manbarnholidaystalkingscream …character's point of view camera shotstabbingsubjective cameramaskmirrorcryingchaseknifekissviolencebloodguncharacter name in titlenumber in titlesequeldogphotographexplosionpartysurprise endingcatfalling from heightrunninghalloweencandleambulancedeath of friendweaponexploding carchildanimalcoffinchild in perilpolice officer killedattempted murdertreedangercostumescreamingbracelethangingautomobilethreatneck breakingtrapratmurderersplatterhateropehuggingheroinelooking at oneself in a mirrorslow motionlifting someone into the airloss of friendhidingpresumed deaddeath threatpsychotronicstairsdead manfieldlaughingfifth partsequel to cult favoritekilling spreepumpkinlightsirendead dogreflectionpetpresentyellingtablereturning character killed offlaundrydead animalold dark housediscoveryclimbingkittenglasslocked doorhanged mancapemasked villainpitchforkscytheliquidsittingemergencydustlight bulbpolice officer knocked unconsciousmichael myerscarrying someonelifting a female into the aircrawlingboogeymanpleadingcrying childjumpsuitunmaskingopening a windowstringcult film referencestrawpink dressserial teen killertrailer narrated by don lafontaineattempted child murderpolice officer strangulatedkilled with a forkteardropwhite maskblack masklaundry chuteevil unclenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
| Subgenre: | slasher flickteen horrorteen moviesuspenseblack comedycult filmconspiracypost modernhorror spoof |
| Themes: | sadisminsanitypsychopathvoyeurismmurderdeathrevengelovebetrayalfeardrunkennessescapeinvestigationdeceptionparanoia …theatremurder of a police officernear death experience (See All) |
| Mood: | slashergoresatire |
| Locations: | hospitalbicyclepolice stationpolice carfire truck |
| Characters: | serial killerkillerboyfriend girlfriend relationshipteenagerpolicefemale protagonistpolice officerdetectivehostagepolice detectiveex boyfriend ex girlfriend relationshipself referential |
| Period: | 1990s |
| Story: | cigarette smokingmasked killergood versus evilfoot chasewoman slaps a manbody countstabbed in the throatmasked manstabbed in the stomachsuspicionstalkingprankscreamstalkerstabbed to death …throat slittingimpalementstabbingaxeflashlightsurvivalf wordvoyeurmaskslow motion scenerescueblood splatterchaseknifekissviolencebloodf ratednumber in titlesequelinterviewbare chested malesingingpartysurprise endingpistolcell phonebeatingcorpsedigit in titleshot to deathcar accidentshot in the chesturinationface slapshot in the headpunched in the facewatching tvcomputerbrawlshowdownheld at gunpointsunglassessecond partcar crashcollegehallucinationtelevisiontelephonereportergay slurbedroomjournalistambushvideo cameraambulancedeath of friendstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorcharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningscarbodyguardfilm within a filmisolationstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendscrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarypresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitemercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplaycharacters killed one by oneethnic slursequel to cult favoritekilling spreemedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
| Subgenre: | canadian horroramerican horrorsuspensecult filmindependent filmsupernaturaltragedyparanormalpsycho thrillerparanormal phenomena |
| Themes: | psychopathmurderdeathlovesurrealismsuiciderapechristmasfearinvestigationdeceptionsupernatural powerdeath of motherparanoiablackmail …death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All) |
| Mood: | slasherneo noir |
| Locations: | wheelchairhospitalschoolchurchsnowpolice cartrucktunnelschool teacherfire truck |
| Characters: | serial killervillaindoctorboyfriend girlfriend relationshiphusband wife relationshipfather son relationshipmother son relationshipteacherpolice officernursephotographerbabylittle boypsychiatrist …snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All) |
| Period: | 1980sworld war two1970swinterseeing the future |
| Story: | stabbed with scissorshomicidal maniacpsychopathic killergood versus evilhouse on fireserial child murderserial child murderergrindhouse filmpsychotronic filmserial murderslashingbad guybody countslaughterlost …scissorsmutilationelectronic music scoredesiremaniacaccidentflashlightf wordslow motion scenerescueblood splatterfirechasefemale nudityflashbackbloodkissbased on novelphotographtitle spoken by characterexplosionsurprise endingpistolshootoutdreamcorpseshot to deathcar accidentshot in the chestwatching tvbattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffsrevolvertelephonereporterambulancemansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmancold waricedestinyassassination attemptreference to adolf hitlergothicheavy rainsociopathcomaexploding buildingloss of wifepress conferencesevered handgrindhouseambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicsenatordeath of protagonistdark herodead childrainstormsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentteachingswastikacrutchesroller coastermegalomaniacold flameelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainecar rolloverheadacheassassination plotnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightstuffed toy rabbitgirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
| Subgenre: | black comedy |
| Themes: | deathmurderfriendshipbetrayaldrunkennessguilt |
| Mood: | slashergorehorror movie remake |
| Locations: | kitchenfire truck |
| Characters: | serial killerkillerboyfriend girlfriend relationshipfather son relationshipbrother sister relationshipinterracial relationshipalcoholicmysterious killerdeath of a friend |
| Story: | prank gone wrongaxe in the headhouse on fireperson on firediscovering a dead bodystabbed in the throatburned alivestalkingprankscreamaccidentthroat slittingimpalementaxeflashlight …voyeurslow motion scenemirrorblood splatterfireshowerpantieschaseknifefemale frontal nudityfemale rear nuditymale rear nudityfemale nudityviolencebloodbare chested malepartysurprise endingcell phonecorpseshot in the chestblonderemakeshotgunpunched in the facebare buttsecretvomitingheld at gunpointlingeriecollegehallucinationhandcuffsalcoholcleavagestrangulationambulancedeath of friendstabbed in the chestwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialoguemini skirtchampagnecover upcollege studentbraceletlong takebasementcharacter says i love youlooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardyironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunmurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsstabbed in the mouthhooded figurecprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.
| Subgenre: | suspensecult film |
| Themes: | insanitypsychopathmurderdeathkidnappingrapeadulterytortureseductionbrutalityobsessiondrug usegrief |
| Mood: | rainnightmarenight |
| Locations: | oceanseahospitaltrainaustraliapolice carshipyachtstorm at seaship on fire |
| Characters: | serial killerterrordoctorhusband wife relationshippolicepolicemandancerphotographerhostageaustralianaustralian abroaddeath of killer |
| Story: | psycho killercigarette smokingevil manday for nightarm injurymass murdererraftblack humormaniacsuspicionapologyaccidentflashlightsubjective cameraswimming …dead bodyrescuecryingfireshowerchaseknifefemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nudityflashbackkisssexfightviolencebloodbased on noveldogtwo word titlebare chested maledancingphotographsongbeatingcorpsefoodcar accidentshotgunbare buttheld at gunpointtearssunglassessubwayradiounderwater scenedrowningduelbinocularsmicrophonekeydeath of childdeath of sonisolationmurdererdie hard scenariosociopathsurvivorcaptivewristwatchstrangerhome movierailway stationpassportwoman in jeopardydivingphoto shoottrappedpillsloss of sonhit in the crotchdeath threattitle appears in writingrowboatmedicationexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedpsychoticminimal castalonesailboatsailingdegradationmarried coupleflareunconsciousnessdruggedswimming underwaterlying on bedman in swimsuitstabbed in the shouldershot through the mouthtitle same as bookpsychological torturesole survivorbreaking through a doorflare gundriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceandeeply disturbed personhands tiedwriting in bloodlooking at picturebathing suitmovie projectorsleeping pillsharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlesalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
| Themes: | evilinsanitypsychopathdeathsuicideghostdrunkennessbrutalityexploitationhomelessnessmurder of a police officerdeath of daughter |
| Mood: | slashergorerainnightmaredarkness |
| Locations: | helicopterhospitalstrip club |
| Characters: | serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner |
| Story: | homicidal maniacpsychopathic killeraxe murderevil mansadistic psychopaththroat slitextreme violencemass murdererserial murderslashinghuman monsterbad guybody countmaniacstalking …stalkerstabbed to deaththroat slittingimpalementstabbingflashlightf wordmaskslow motion sceneblood splatterchasefemale frontal nudityfemale rear nudityfemale nuditybloodviolenceflashbacknumber in titlesequelinterviewsingingpartypistolbeatingdreamcorpsecar accidentshot in the chesturinationshotguncamerabookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperdecapitationhalloweenbandstrangulationdeath of friendstabbed in the chestexploding carhit by a carlatex glovesflash forwardmicrophonestabbed in the backportraitclownattackhalloween costumescarglassesneck breakingmurdererprofanitypizzasurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armcharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexbeheadinggroupg stringreturning character killed offmedical masksurgical masksexual violencedental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry housegraphic violenceoverturning carstabbed in the facebloody violencefemale victimpentagramschizophrenicbreaking through a doormurder of a nude womanbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite masknitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv …ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
| Subgenre: | slasher flickamerican horrordark comedyblack comedycult filmindependent filmstop motion animationdark fantasygross out comedysupernatural horror |
| Themes: | evilsadismdeathmurderrapeghostdancesupernatural powersupernatural rapebook of evil |
| Mood: | slashergoreone night |
| Locations: | woodsforestcarsinging in a car |
| Characters: | teenage boyteenage girlboyfriend girlfriend relationshipfriendbrother sister relationshipstudentself mutilationself cannibalism |
| Period: | 1980s |
| Story: | video nastyover the topextreme violencegrindhouse filmpsychotronic filmtelling someone to shut upplaying cardsblack humormutilationcabincharacter's point of view camera shotstalkerstabbed to deathstabbingaxe …subjective cameralow budget filmblood splatterfirefemale nuditykissviolencebloodfightthree word titlesurprise endingremakeshot in the headshotgunwritten by directorshootingbookcollegedemonriverdecapitationbridgesnakesevered headanti heronecklacepaingravetreestabbed in the backkeyfirst of seriespossessionisolationbasementhauntingfirst partdirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendscaucasianblockbustersevered handgrindhouseburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spiritvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandflametragic lovebloodshedstressfemale victimtongue in cheektapesevered footcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motioncar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit …h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
| Subgenre: | tragedypsycho thriller |
| Themes: | evilsadismpsychopathrevengedeathmurdersuicidekidnappingrapetorturedeath of fatherbrutalitydeath of motherdeath of wifecannibalism …self sacrificemadnessmurder of familyghost town (See All) |
| Mood: | slashergorehorror movie remake |
| Locations: | desertcavegas stationsuv |
| Characters: | serial killerterrorvillainkillerteenage boyteenage girlfamily relationshipsbrother sister relationshipbaby |
| Period: | year 2006 |
| Story: | homicidal maniacaxe in the headpsychopathic killeraxe murderevil manperson on firefoot chaseextreme violenceserial murderhuman monsterbad guybody countstabbed in the throatsevered fingermutilation …burned alivemaniacsevered armimpalementaxeblood splatterbloodviolencedogsurprise endingpistolcar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolverstabbed in the chestexploding carsevered headcontroversyshot in the foreheadstabbed in the backvacationbaseball batamerican flagglassesmurdererfirst partdismembermentkillingsplatterclaim in titlekilling an animalmutantragewalkie talkievictimrapisthomiciderampagecannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailerminemutationsevered legkilling spreedeath of loved onemannequinhysteriamadmancrucifixionex copkilldead animalkilling a doghead blown offgerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyminersiblinggraphic violencestabbed in the facecut into piecesbloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | american horrorcult filmindependent filmsupernaturalpsycho thrillerstop motion animation |
| Themes: | evilsadisminsanitypsychopathmurderdeathghostfuneralmonstersupernatural power |
| Mood: | slashergorenightmare |
| Locations: | hospitalbarchurchcemeteryschool boy |
| Characters: | slasher killerserial killerterrorvillainkillerdoctorteenagerfather daughter relationshipmother daughter relationshipnursetough guylittle girlsingle motherself mutilationalcoholic father …serial murdererevil nurse (See All) |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killerevil mansadistic psychopathfoot chaseserial child murderserial child murderermurder spreeserial murderslashingbad guybody countdisfigurement …electronic music scoremaniacstabbed to deathimpalementstabbingslow motion scenerescueblood splatterfirefemale nudityviolencenumber in titlesequelbondagebare chested malesurprise endingdreamcorpsedigit in titlethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationnewspaperdeath of friendsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollskeletonisolationbasementmurderercharacter says i love youkillingundeadsplatterfalling down stairsteen angstlifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogstabbed in the eyecharacters killed one by onekilling spreepajamassmokemadmanalleyreturning character killed offohioevil spiritabandoned housestabbed in the armgroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattressgymnasticsvillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeatherselm streetspringwood ohiofalling leavespapier macheteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | american horrorblack comedysupernaturalpsycho thriller |
| Themes: | evilpsychopathdeathsupernatural power |
| Mood: | slashergoreraincar chase |
| Locations: | chicago illinoisschool buswater gun |
| Characters: | slasher killerserial killerterrorvillainkillerboyhusband wife relationshippoliceteacherserial murderernew student |
| Period: | 1990s |
| Story: | psycho killerhomicidal maniaccigarette smokingpsychopathic killerevil mansadistic psychopathfoot chasebad guybody countblack humorpsychoburned alivemaniacstabbed to deaththroat slitting …slow motion scenebloodsequelsingingpunctuation in titlecorpsedigit in titlecar accidentfalling from heightheld at gunpointsecond partapostrophe in titlebound and gaggedstrangulationambulancestabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondolllightningdeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturefalling down stairsgothiclifting someone into the airtied to a bedtoynosebleedsevered handbutchershovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murdersuffocationmadmanhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravelocked in a roomvillain not really dead clichebutcheryliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c …olleagues (Read More)
| Subgenre: | slasher flicksuspenseblack comedycult filmsurvival horror |
| Themes: | evilinsanitypsychopathvoyeurismmurderdeathrevengesurrealismrapedrinkingfearescapeangersupernatural powerparanoia …surveillancepanictechnologymadness (See All) |
| Mood: | slasher |
| Locations: | restaurantswimming poolelevatorlaboratory |
| Characters: | slasher killerboyfriend girlfriend relationshipfemale protagonistreference to godsecurity guardbabe scientist |
| Period: | 1990s2000s |
| Story: | person on firefoot chasebroken windowflamethrowerbody countmass murderstabbed in the stomachburned alivestalkingstalkerimpalementsurvivalvoyeurdead bodymask …mirrorblood splatterfireshowerpantieschasenipplesfemale frontal nuditymale rear nudityfemale nuditykissgunviolencefightblooddogbare chested maleexplosiontelephone calldreamcorpseunderwearshot in the chesturinationface slappunched in the facecomputerdrinkthongvomitingshowdownsunglassesbombcafebathroomsciencescientiststrangulationman with glassesanti herounderwater scenedrowningtransformationdangerstabbed in the backsuburbelectrocutioninjectionpursuitneck breakingratfirst partcult directormonkeywashington d.c.experimenteavesdroppingkilling an animalwarehousecagesociopathlifting someone into the airmad scientistpoolcovered in bloodcgipeeping tomrampagetrappedsurveillance cameraresearchthirty somethingcharacters killed one by onelasersightkilling spreeburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillaanimal abuseelectric shockgiving a toastseizuretop secretburnt bodysole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonvillain not really dead clichescience runs amokscientific researchloss of controlresearchertragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insecticiclesprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com