Please wait - finding best movies...
While in Wales visiting her husband James, Adelle tries to fix her relationship with her teenager daughter Sarah. They see a weird memorial without the plate and with the name "Annwyn" marked, and the local Dafydd explains that this would be the place where people go after dying in accordance with t …he Welsh mythology. Later, Sarah vanishes on the beach and the daughter of the local fanatic shepherd, Ebrill, who died fifty years ago, appears in her place. Adele makes a research trying to find how to rescue her daughter from Annway. (Read More)
| Subgenre: | supernatural |
| Themes: | celtic mythologysupernatural powerdeath of daughterafterlifemythologydyingpanicabusegriefguiltobsessionangerinvestigationtorturefear …ghostreligionsuicidedeathmurder (See All) |
| Mood: | nightmarerain |
| Locations: | tunneloceanrural settingwaterbathtubboatcarbeachhospital |
| Characters: | little girllittle boyamerican abroadteenage girlartistpolice officergirlboytattoodoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipteenager |
| Story: | smoking a cigarettepushed off a cliffsleeping pilljumping off a clifftaking pillsrefracting telescopesleeping pillsflock of sheepdead sheepdrug overdosehuman sacrificesearch partyroad mapfalling into waterchild abuse …zodiac boatmissing girlblind girlsleeping in a cardriving a carcrying womanmass suicideblood on one's facemother searches for missing daughtersurgical instrumentold english sheepdognewspaper archivejawbonemotoristbreaking through a wallabattoirknockingwet hairseacoastalternate endinghole in the wallhair brushmoorsisolated placekeychainwhispercryflamesestranged couplemicrofilmcelticcigarette smokingwelshswitchcoastlinefuneral pyreblond hairlocked inblue jeansprocessionsweatermissing daughterearringsdripping bloodlockwet clothesshepherdsymbolmonumentritespeedboatflamecodelocked doorloss of childwaleshearing voicespremonitioncigarettescalpelunderworldcoasthugwhisperingx rayloss of daughterearringtwist endinglibrarianoverdosesculptorliving deadapparitionearphonespillswearingphoneboxpet dogcliffblood on facesuperstitionlostheadphonesresearchpillstelescopevisiondivingback from the deadpreacherjumping from heightsheepimpersonationcaucasianfaintinginjuryfireplacespiriteyeglassessacrificeprofanityratdiarymissing persondollsuitcasekeylegendlibrarydrowningunderwater scenesearchritualdrawingmapimpalementold manflashlightfoot chasef wordswimmingtelephonedead bodytearsvomitingfalling from heightsecretrescueface slapdreambased on bookcryingfiresurprise endingphotographtwo word titlebased on novelflashbackbloodviolencedog (See All) |
Dr. Joe Darrow is a recently widowed doctor. He is grieving due to the death of his pregnant wife in a Red Cross mission in Venezuela. Although being atheist, he began to believe that his dead wife wants to communicate with him, through her young patients in the Pediatrics of a Chicago hospital.
| Subgenre: | supernaturalblack comedysuspensetragedymelodramaparanormal phenomena |
| Themes: | supernatural powerafterlifedyingpanicgriefguiltangerfearghostdeathlovefriendshippregnancydrinkingfuneral …paranoiafaithdeath of wifenear death experience (See All) |
| Mood: | raintearjerker |
| Locations: | tunnelhospitalbarchurchairplanebusairportelevatorvillagewheelchairpolice stationpolice carchicago illinoisjungleschool bus …catholic schoolbus accident (See All) |
| Characters: | little girllittle boygirlboydoctorfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipfriendchildrenbrother sister relationshipsoldier …nursepolicemanbabypriestlawyerbest friendsecurity guardcatholicemployer employee relationshipdeath of boy (See All) |
| Period: | 2000s |
| Story: | jumping off a cliffdrug overdosecigarette smokingsymbolhearing voicesapparitionback from the deaddrowningunderwater scenedrawingmapfoot chasedreamsurprise endingphotograph …flashbacksexone word titlebare chested maleguntitle spoken by characterchasetelephone callcell phonecorpsemachine guncar accidentmirrorslow motion scenecameradrinkarrestriflebeerneighborhallucinationhandcuffsrevolverrivercandleambulancearmysuicide attemptnunbirdgraveyardnews reportlatex glovesgravepilotcharacter repeating someone else's dialoguewidowerpay phoneproduct placementrace against timedeath of childlightningcrosswaterfallfreeze frameanswering machinerevelationflyingheavy rainscene during opening creditscomapatientcrucifixloss of wifedesperationparking garagethunderattempted suicidepower outageresurrectionevacuationinsectheavenassault rifleheartrainstormtribefemale doctorparrottranslatordoubtphysicianinsomniafemale lawyerparamedicstethoscopetoastcolombiaemergency roomrainbowjumping into watersleeplessnessrescue from drowningtietrespassingpackagebilingualismrainforestvenezuelabirthmarkred crossmistmessengercandelabraends with freeze framedefibrillatorschoolyardbirdcageriver rapidsmemorial servicedragonflyorgan donorwaking up from a comareference to christopher columbuscat scanorgan transplantwhite water raftinglandslidepoegelatinmudslidebrain deadintensive care unitmountain roadtribesmanaid workerair stripanesthesiologistnative nuditylaw professorrockslidejungle tribeflatlininghospital cafeteriabald spotgrief counseling (See All) |
The cynical and skeptical writer Mike Enslin writes books evaluating supernatural phenomena in hotels, graveyards and other haunted places, usually debunking the mystery. While writing his latest book, he travels from Los Angeles to New York to spend one night in the Dolphin Hotel's posessed room 14 …08, which is permanently unavailable for guests. The reluctant manager Mr. Gerald Olin objects to his request and offers an upgrade, expensive booze and finally relates the death of more than fifty guests over decades in the cursed room. However Mike threatens Mr. Olin, promising to sue the hotel, and is finally allowed to check into the room. Later in the night, he finds that guests of room 1408, once they have checked in, might never leave the room alive. (Read More)
| Subgenre: | supernaturalparanormal phenomenasupernatural horrorparanormal activity |
| Themes: | supernatural powerdeath of daughterpanicguiltangerinvestigationfearghostsuicidedeathmurdersurrealismdrinkingfuneralmemory …paranoiainsanityillnessevilself sacrificeclaustrophobia (See All) |
| Mood: | nightmarerain |
| Locations: | waterbeachhospitalnew york cityrestauranthotelsnowcemeterylos angeles californiataxiwheelchairpolice carhotel fire |
| Characters: | police officergirlmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipafrican americanwriterlawyerwaitressbiblemaid |
| Story: | estranged couplemicrofilmcigarette smokinghearing voicesapparitionkeylibrarydrowningunderwater scenemaptelephonetearsfalling from heightsecretdream …cryingfiresurprise endingphotographbloodflashbacknumber in titletitle spoken by characterknifechaseshowertelephone callsongmirrorwatching tvcomputerdrinkpaintingbookcafebathroomhallucinationmanhattan new york citythroat slittingdinerradiocoffinflash forwardgraveauthorhotel roomperson on firebased on short storypossessionkicked in the facehauntingsuspicionhaunted housearsonblack americaniceoccultdestructionburned alivetape recordersurfingbarefoottrappedinsecttitle appears in writingbookstoreeye gougingmarital separationrefrigeratorsurgeonbonfirealarm clockatheistlaptop computerfiremandoppelgangerinvestigatorcandyclosetmolotov cocktailbandagemazerepeated scenepostcardpublishermetaphorremorsewebcambugsurferblood stainmind gamemailsurfboardwarningnursing homenoosehanged manburnt bodyshockhome videopost officedemolitionrescue from drowninghit with a hammertuberculosislocked in a roombludgeoningpoltergeistdeja vufloodingjumping out a windowconcussionbook signingskepticismhand injuryghost hunterhotel managerhospital gowndeath of a childturned to stoneledgekeyholeceiling fanbased on the works of stephen kingcold the temperaturesingle locationcount downdeliriumnumber as titleinfra redair ventcognachotel desk clerkfly the insectsiren the alarmcrushed handboiling waterfire sprinklerbook editorsanityreference to franz kafkacall for helpletter openerwalking on broken glassreference to truman capoteunplugged electronic worksventilation shaftdoor handlebook tourdebunkinghaunted hotelclock radiosense of timefalling through the ceilingfire rescuehanging from a ledgepost office boxarmoirescene at a windowthermostattransom (See All) |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel … Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
| Subgenre: | suspensegothic horror |
| Themes: | supernatural powerdeath of daughterafterlifegrieffearghostsuicidedeathmurderfriendshiprevengebetrayaldrinkingadoptiondeath of wife …vengeanceforgivenessmadnessdeath in childbirth (See All) |
| Mood: | nightmarerainhorror movie remake |
| Locations: | rural settingbathtubcarbeachtrainforestlondon englandvillagewoodsengland |
| Characters: | little girllittle boygirlboymother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfriendsister sister relationshipreference to godsingle fathersuicide by hangingbaby boy …ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All) |
| Period: | 1910s |
| Story: | locked doorloss of childhearing voicesapparitionsuperstitionlostfireplacedollkeydrowningsearchdrawingtelephonedead bodytears …secretrescuecryingfirephotographbased on noveldogflashbackbloodviolencecorpsefoodmirrorslow motion scenedrinkletterpaintingrunningcolor in titlenewspapercandleaxemansioneatingwidowhouseaccidentdrivingchildbirdcoffinjourneygraveyardflash forwardgravecurseprologuescreamingwidowerperson on firedeath of childskeletonhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of mothersleepinghaunted housesingle parentlooking at oneself in a mirrorcrucifixtoyloss of wifeeccentriclossrailway stationclockthunderloss of sonwizardthunderstormdead childatticfogmurder of a childvoice over letterlanternbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogold dark housemental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorpocket watchbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All) |
A young hospice worker helping care for an invalid who lives in a remote mansion in the Louisiana bayous finds herself caught in the middle of morbid happenings centered around a group of Hoodoo practitioners.
| Subgenre: | suspense |
| Themes: | panicfearghostdeathkidnappingmarriagemagic |
| Mood: | nightmarerain |
| Locations: | bathtubhospitalcemeterynightclubelevatorkitchenwheelchairrooftopgas station |
| Characters: | little girllittle boypolice officernursemusicianbabylawyermaidfrenchwitch doctor |
| Period: | 1920s |
| Story: | locksymbolritesuperstitionheadphoneskeyritualmapold manflashlightfalling from heightsecretdreamsurprise endingphotograph …flashbackbloodfightdancingpartyknifepantiescell phonecar accidentmirrorblondeshotguncamerariverbound and gaggedcandlestrangulationroommategunshotattempted murderumbrellalightningringhangingdomestic violencecountrysideisolationloss of fatherstagetied uprecord playeroccultropefalling down stairshypodermic needlegothicpatientservanttorchhaircutthunderjob interviewnew orleans louisianarowboatswampatticrainstormvoodooblack magicmusic banddrugged drinkspellwifegardeningparalysisgatelouisianaelderlycanoelizardlaundromatno title at beginningponytailparamedichusbandstrokefall from heightbusiness cardpotionnursing homenoosehouse partydumpsterpigtailslynchinghatchetphonographsecret roomamerican southvolkswagen beetledustbedriddenphonograph recordshackstreetcarbayouspiked drinkinvalidpeacocksouthern gothicchalkbraidscandlelight dinnerhospicesoul transferenceincantationbedsheetvictim invited to dinnerconjurerwant addouble barrel shotgunparalyzedskeleton keyhoodoogumbo (See All) |
John and Laura Baxter are in Venice when they meet a pair of elderly sisters, one of whom claims to be psychic. She insists that she sees the spirit of the Baxters' daughter, who recently drowned. Laura is intrigued, but John resists the idea. He, however, seems to have his own psychic flashes, seei …ng their daughter walk the streets in her red cloak, as well as Laura and the sisters on a funeral gondola. (Read More)
| Subgenre: | supernaturalindependent filmcult filmsuspensebritish horrorcult classic |
| Themes: | supernatural powerdeath of daughterafterlifegriefguiltdeathmurdersurrealismmarriagedrinkingdrunkennessfuneralmental illnessblindnesswriting …death in childbirth (See All) |
| Mood: | raingore |
| Locations: | rural settingwaterboathospitalrestaurantchurchhotelbicycleairportpolice stationcityitaly |
| Characters: | police officergirlboymother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipchildrenserial killerpolicemanpriestsister sister relationship …villainmaid (See All) |
| Period: | 1970s |
| Story: | cigarette smokingloss of childpremonitionloss of daughterapparitionlostfaintingspiritratdollsuitcasedrowningold mandead bodyvomiting …surprise endingphotographbloodflashbackfemale nuditymale nuditybare breastsfemale frontal nuditymale frontal nuditysex scenekissnipplesknifechasethree word titleshowertelephone calltopless female nuditypunctuation in titlecorpseunderwearfoodhorsemirrorslow motion scenecatarrestbare buttletterapostrophe in titlecafehallucinationprayermale pubic hairsubjective cameracandleambulancewomanbridgeeatingwidowfemale pubic hairnunbathpantyhoseold womanflash forwardbased on short storycharacter's point of view camera shotstatuereadingdeath of childcity name in titlepursuitsadnesspsychicitalianoccultarchitectureloss of loved onebuttocksaccidental deathlossladderfatewhiskeydwarfhaunted by the pastnippledeath of protagonistdead childpolice inspectorbrushing teethriding a bicyclemale objectificationimperative in titleseancebroken mirrormarried couplestretchervenice italyblind womanmediummotorboatbishopcowgirl sex positionseizurepondbleeding to deathpsychic powerorchestral music scorebriton abroadbloody violencedeath by drowningpsychotronic filmchance meetingdressinggrindhouse filmmurder victimtrancecanalmosaicmental instabilitybritish accentgrievingunhappy endingraincoatgondolastained glass windowfemale star appears nudegiallo esquenude pantyhosescaffoldsibling relationshipmale in a showerdeliberate crueltygrieving mothermusic score features pianoprecognitiondead daughterthe color redtalking with the dead5 year oldartificial respirationspilled drinkstray catgrieving fatherchild drowningringing a bellsleazy giallodyetalking dollwomen's restroomreference to john miltonslashed to deathaccidental drowningmale star appears nudebegins with deathmultiple sex positionsprimal screamsaint nicholasboeing 727woman faintingexsanguinationgrieving parentdrowned bodysecond sightwoman getting dressedapplying mascaraitalian flagrefusing to believechurch restoration (See All) |
Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing … voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)
| Subgenre: | suspense |
| Themes: | supernatural powerpanicangerfearghostdeathmurderfriendshiprevengemarriageinfidelityadulteryvoyeurismextramarital affairunfaithfulness |
| Mood: | rain |
| Locations: | rural settingwaterbathtubboatrestaurantswimming poolsnowcemeterylakelaboratoryyacht |
| Characters: | teenage girlfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipfriendteacherstudentmusicianteacher student relationshippsychiatristprofessorghost in a mirror |
| Period: | 2000s |
| Story: | drug overdosemissing girlhearing voicespet dogresearchfireplaceratmissing personkeydrowningunderwater scenetearssecretcryingsurprise ending …photographdogbloodinterviewpartythree word titleshowertelephone callcell phonecar accidentmirrorwatching tvcomputercatbathroomcollegeneighborwinecandlewomanbathroommategraveyardgravebinocularselectrocutionpossessioncollege studentdeath of husbandhauntingsuspicionmurderergardenhaunted housetherapyrunawaypickup truckoccultteagothicmousehammertherapistblockbusterboston massachusettsanxietyspyingpieropening a doorphoto albumlaptop computervillain played by lead actordockseancefireballphysicianfencesailboatparamedicshoedruggedcelloouija boardgeneticshitchcockiansleeplessnesspet catpoltergeistcellistfootprint911power failurevermonthair dryervisionswriting on a wallsteamcocktail partyouijasource musiclock of hairvaliumglass shardmurder by drowningalimonyprinceton universityempty neststepping on glasssound systemhair dryer falling into a bathtubreference to jonas salkreference to madame curie (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
| Subgenre: | supernaturalindependent filmcult filmpsychologicalpsychological horrorsupernatural thriller |
| Themes: | supernatural powerdeath of daughterinvestigationreligiondeathmurderdrugsmagicincestmemorycorruptionblackmailgamblingcannibalismamnesia …devilmurder investigationfather daughter incest (See All) |
| Mood: | goreneo noir |
| Locations: | bathtubbeachhospitalnew york citybarrestauranttrainchurchhotelsnowbuselevatorfarmtrain station |
| Characters: | teenage girldoctorfather daughter relationshipsingersoldierserial killernursedetectivemusicianbabypriestlawyerinterracial relationshiplustpolice detective …biblemaidfrenchself discoverypolice arrestfather daughter sex (See All) |
| Period: | 1950s |
| Story: | cigarette smokinglocksymbolritehearing voicessuperstitionpreacherspiritratmissing personkeydrowningsearchritualold man …flashlightfoot chasetearsvomitingdreamcryingsurprise endingphotographtwo word titlebased on noveldogbloodflashbackcharacter name in titlefemale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudityinterracial sexdancingnipplessingingpantiespistolcorpseshot to deathblood splatterfistfightmirrorcatwritten by directorrunninginterrogationpianodemonhallucinationrevolverrivermanhattan new york citybracandlemansionbridgestabbed to deathdinertoiletstabbed in the chestsevered headnundream sequencegraveyardbartenderracial slurgunshotgravedrug addictmicrophoneuniformstatuescreamringscene during end creditspianistpursuitcountrysideglassesstagechickenjazzprivate detectiveapplauseoccultidentitykilling an animalhead buttbreaking and enteringcophypodermic needleeggtape recorderperformancecomamutilationpatientguitaristbuttocksmovie theatersevered handtimecovered in bloodnew year's eveaudiencebrooklyn new york cityparadeanimal attackmental institutionwatching televisionfannew orleans louisianajunkiescene after end creditsdisembowelmentheartblood on shirtchoirsoulrainstormcanecastrationlooking at self in mirrorpastorfortune tellervoodooblack magicmusic bandprivate investigatorposteratheistwoman in bathtubdrumsgarterbeing followedceremonyinvestigatorfountainbaptismlouisianaspiral staircasehorse racingperformerarcadeanimal crueltysatanismbroken mirrormaking outclinicinterracial kissgramophoneshot in the eyelistening to radiowhistlingrazormarching bandafrican american womanstablecleaning ladyolder man younger woman sextimes square manhattan new york citycrabbettingcrowbarmorphineheart ripped outhorse and wagoniconpentagramaltarprivate eyecut handmurder of a nude womankicking in a doorpart of the body in titletrenchcoatharlem manhattan new york citydeal with the devilworld war two veteranstraight razortap dancingevil childgenital mutilationfuneral processionluciferphonograph recordshackstreetcarbody part in titlesatanic ritualincestuous sexdevil worshipcajunconey island brooklyn new york citydog bitenylonswashroomsouthern gothicafroelectric fananimal sacrificeblood on the floorcockfightyear 1955ice pickpriestesssoul transferencemarqueeherbincantationtarot cardsbloodstainoccult ritualmedicine cabinetfreight elevatorlost soulconey islandpit bullharlemfaustianjubilationscaldingpalm readerpick up truckfoot bridgeslumscongafather murders daughteroccult detective17 year old girlbongosposing as a doctorid tagsearch for selfbreaking a lockhoodoopoughkeepsie new yorkfaustian bargaingumboself search17 year old daughterfather kills daughter (See All) |
Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own …life. (Read More)
| Subgenre: | paranormal phenomenasupernatural horror |
| Themes: | supernatural powerdyinginvestigationfearghostsuicidedeathmurderrevengesurrealismfuneralvoyeurismphotographyadoptionmysterious death |
| Mood: | nightmarerainhorror movie remake |
| Locations: | waterbathtubelevatorwheelchaircity |
| Characters: | teenage girlgirlboydoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipteenage boyfemale protagonistteacherserial killerstudent …writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All) |
| Story: | jumping off a clifffalling into watercigarette smokingclifflegendunderwater scenedrawingtelephonefalling from heightface slapdreamsurprise endingphotographbased on novelflashback …bloodf ratedtitle spoken by characterpantiesshowertelephone callcell phonehorsemirrorblonderemakewatching tvcomputercamerahallucinationvoyeurislandclassroomreportergood versus evilcleavagenewspaperjournalistaxewomanno opening creditsbirdscantily clad femaleforeign language adaptationtreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmfirst partcabinpsychicgirl in pantiesanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeladderapartment buildingmental institutionsevered fingerpastmental hospitaldead childbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secreturban legendwellno title at beginningtape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowningelevator shafthookevil childinvestigative reporterpick axeel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitjournalism studentdeformed armhorse breederfalling down a well (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r …eason too. (Read More)
| Subgenre: | cult filmtragedy |
| Themes: | supernatural powergriefangerghostsuicidemurderdeathfuneralmagicdeath of motherdeath of wife |
| Mood: | nightmaregorenightdarkness |
| Locations: | rural settingbathtubcarhospitalschoolchurchcemeteryairplaneairportwoodstrucknew england |
| Characters: | little girllittle boydoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipbrother sister relationshipzombiepriestsuicide by hangingfather in law son in law relationshipdeath of boy |
| Period: | 1980s |
| Story: | loss of childscalpelpet dogback from the deadinjuryold manflashlighttelephonetearssecretrescuedreamfiresurprise endingphotograph …based on noveldogbloodflashbackviolenceexplosiontitle directed by femalecorpsepunched in the facewatching tvcatbedbathroomneighbordeath of friendwomanweaponchildcoffinpantyhosepainconfessiongraveperson on firehangingdeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonmoonfemale stockinged legsburned alivegothiclifting someone into the airhatloss of friendtoyhidingloss of wifedead womanhitchhikingcamera shot of feetpromiseloss of sonresurrectionshovelpsychotronicdead childdeath of sisterdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeuphit by a truckhead injurykitenooseloss of sisterkiller childmurder of wifeorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmainesuicide noteswinginghouse firepet catdeath of loverglowing eyesevil childairlinerscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead songrave robbingkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi …nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
| Subgenre: | independent filmsuspense |
| Themes: | supernatural powerafterlifeguiltobsessionfearghostsuicidedeathmurderlovekidnappingpregnancydrinkingdrunkennessfuneral …memoryparanoiadrug usedysfunctional family (See All) |
| Mood: | nightmarerainmurder suicide |
| Locations: | bathtubcemeterychicago illinois |
| Characters: | teenage girlgirlboymother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipchildrenteenage boypolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationship …super heroseeing a ghost (See All) |
| Story: | missing girlhearing voicespremonitionearphonesblood on facesuperstitionmissing personsearchflashlightdead bodyvomitingsecretcryingbased on novelblood …sexbare chested malegunfemale rear nudityfightpartyknifeerectionsongwoman on topcorpseshot to deathblood splattershot in the chestwatching tvdrinkshootingheld at gunpointbeermarijuananeighborhallucinationguitarshot in the backsubjective camerabandambulancesuicide attempthousenonlinear timelinecoffingraveyardtalking to the cameragraveproduct placementcover upattempted rapedisappearancesleepinghaunted housepsychicgamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewunderage drinkingshoveldelusionhypnosisfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationold dark houseremorsemental retardationdigginghypnotismbreaking a windowhearseloss of sisterpsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | supernaturalindependent filmcult filmsuperheroparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy |
| Themes: | supernatural powerinvestigationfearghostdeathmurderfriendshiprapepregnancymonsterpsychopathbrutalitydepressioninsanitysadism …eviltrauma (See All) |
| Mood: | nightmaregoreslasher |
| Locations: | watercarhospitalchurchswimming poolmotorcyclecar on firedeath in a car accident |
| Characters: | little girllittle boyartistgirlboydoctormother daughter relationshipfather daughter relationshipteenagerfather son relationshipmother son relationshipafrican americanfriendboyfriend girlfriend relationshipfemale protagonist …serial killernursebabyreference to godsingle motherwaitresskilleralcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | crying womanhole in the walldripping bloodwet clotheslocked doorblood on faceback from the deadfaintingspiritdolllibraryunderwater scenedrawingimpalementflashlight …foot chasefalling from heightdreamcryingsurprise endingphotographviolenceflashbackbloodsexfemale nudityf ratednuditybare breastssequelbare chested malegunfemale rear nuditypartyknifechasepistolshowertelephone calltopless female nudityblood splatterfoodcar accidentslow motion scenewatching tvbare buttshootingplace name in titlebedcar crashdemonhallucinationgood versus evildisguiseambulancestabbingdeath of frienddinerweaponaccidentapologynunchilddream sequencepart of serieshit by a cartransformationpaingunshotdangerscreaminglocker roomfantasy sequencechampagnepossessionevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay charactercomic booklifting someone into the airmutantmutilationloss of friendspidervictimskateboardbirthfollowing someonepicniccelebrationmental institutionrampagedamsel in distresstensionplaygroundanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmcut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnenightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.
| Subgenre: | suspense |
| Themes: | death of daughterafterlifeobsessioninvestigationdeathmurdersurrealismrapedrinkingfuneralvoyeurismmemoryredemptionpoetryhome invasion …hopemurder investigationmissing child (See All) |
| Mood: | rain |
| Locations: | bathtubhospitalschoolsnowcemeterybicycletaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water |
| Characters: | little girllittle boyteenage girlgirldoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipbrother sister relationshipteenage boyserial killer …detectivepolicemandancerphotographersister sister relationshipgrandmother granddaughter relationship (See All) |
| Period: | 1970syear 1973 |
| Story: | falling into watercigarette smokinglostback from the deadeyeglassessuitcaseunderwater scenesearchflashlightdead bodytearsfalling from heightdreamcryingfire …photographbased on novelflashbackblooddogf ratedkissdancingtitle spoken by characterknifechasethree word titletelephone callvoice over narrationbeatingcorpseblood splatterfoodwatching tvcameradrinkpaintingbookrunningbirthdayneighborvoyeursubjective camerasoccercandleaxemontageeatingno opening creditspainterflash forwardtreestalkersuburbfantasy sequenceevil manreadingbaseball batlightningflowerspursuitsuspicionhatestrong female characterrecord playerpoembreaking and enteringhatjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastshoesshopping mallfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwrecklost lovevacuum cleanerbroken windowdigging14 year oldcornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousetoy storechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All) |
A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.
| Subgenre: | cult filmcreature featuresurvival horrorbritish horror |
| Themes: | panicgriefguiltfearghostmurderdeathfriendshiprevengeinfidelitybetrayaldrinkingescapemonsterbrutality …cannibalismblindnessmurder of familyclaustrophobia (See All) |
| Mood: | nightmaregore |
| Locations: | carhospitalforestwoodscavecave in |
| Characters: | little girlhusband wife relationshipfriendfemale protagonistbest friend |
| Story: | falling into waterdriving a carloss of daughterfireplacedollunderwater sceneimpalementflashlightvomitingfalling from heightcryingsurprise endingphotographtwo word titleblood …violencef ratedknifebeatingcorpseblood splattercar accidentblondebookliehallucinationsurvivalmountainvideo cameradeath of friendwomanthroat slittingstabbed in the chestcreaturenecklacesmokingbeaten to deathdarkisolationneck breakingfirst partunderwatercabinwaterfallcult directortrustbirthday cakeropehuggingwhat happened to epiloguebeer drinkingsurvivorlifting someone into the airgroup of friendsvictimskullcheating husbandtorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandkilling spreeblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All) |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto …p her from constantly getting visions of Jessica's fate. (Read More)
| Subgenre: | independent film |
| Themes: | supernatural powerinvestigationghostsuicidemurderdeathinfidelityjealousyadulterydeceptionincestextramarital affairdeath of fatherunfaithfulnessmental illness …father daughter incest (See All) |
| Mood: | nightmarerain |
| Locations: | rural settingwaterbathtubschoolcemeterysmall townwoodswheelchaircourtroomstormbackwoods |
| Characters: | boytattoofather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshiplawyersingle motherlustwitchsheriffsuicide by hanging |
| Story: | child abusemissing girlpremonitionback from the deadmissing personunderwater scenesearchritualdead bodysecretdreamfirephotographtwo word titledog …violencebloodflashbackfemale nudityf ratedfemale frontal nuditymasturbationmale rear nuditybare chested malegunfightdancingexplosionpartyleg spreadingpantiestelephone callbeatingcorpsewatching tvthongbare buttliesex standing uphallucinationhandcuffscleavagecandlestrangulationwomanwidowwhite pantiestrialscantily clad femalegraveyardgraveperson on fireliarbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upgrandmotherwhippingcult directorpsychictherapygarageheart attackgirl in pantiespickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sextherapistdysfunctional marriagechokingmechanicsexual desirecamera shot of feetredneckwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneygeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
| Themes: | dyingpanicangerinvestigationghostdeathmurdersurrealisminfidelityrapechristmasjealousydrinkingdrunkennessfuneral …corruptionpsychopathdeath of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatretraumaclaustrophobiachristmas past (See All) |
| Mood: | gorenightslasherdarkness |
| Locations: | waterbathtubcarhospitalbarrestaurantschoolcemeterybicycleelevatorkitchenwheelchairaustraliapolice stationpolice car …cityitalytruck (See All) |
| Characters: | girlboydoctorfather daughter relationshiphomosexualfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipsingerserial killerpolicemanmusicianactress …killervillainpsychiatristmaidprofessorjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All) |
| Period: | 1970s |
| Story: | driving a carcigarette smokingdripping bloodlocked doortwist endingapparitionfireplacedollkeylibrarydrowningsearchdrawingimpalementold man …flashlighttelephonedead bodyvomitingsecretface slapfiresurprise endingphotographtwo word titleflashbackbloodviolencegunkisssingingknifechasetelephone callsongshootoutbeatingcorpseblood splattermirrorwatching tvcameradrinkshootingpaintingbookrunningcafebathroomneighborpianohallucinationcolor in titlerevolvertelevisionreportersubjective cameradecapitationsurvivalgay slurnewspaperbedroomjournalistbandstrangulationaxestabbingstabbed to deathdinerhousejokebrunettedrivingsevered headbirdhit by a cargraveyardold womannecklacepainattempted murdervirgindangerstabbed in the backprologuescreamingpuppetproteststatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playermaniactv newsdesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousehomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious mandark secretkillgloveslong hairhuman monstermen's bathroomfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmenteyeballmeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
Joong-ho is a dirty detective turned pimp in financial trouble as several of his girls have recently disappeared without clearing their debts. While trying to track them down, he finds a clue that the vanished girls were all called up by a same client whom one of his girls is meeting with right now.
| Subgenre: | suspense |
| Themes: | panicgriefguiltangerinvestigationtorturefeardeathmurderrevengekidnappingescapebrutalitycrueltypolice investigation …police corruption (See All) |
| Mood: | raingore |
| Locations: | hospitalchurchhotelelevatorpolice stationpolice carmotel |
| Characters: | little girlpolice officerprostituteserial killernursedetectivephotographermotherpolice detectivedaughtermayorpimp |
| Story: | cigarette smokinglockpet dogkeysearchdrawingflashlightfoot chasetearsface slapcryingphotographblooddogviolence …flashbacknudityone word titlemale rear nuditybare chested malenipplespantiesbased on true storycell phonebeatingcorpseunderwearblood splattercar accidentslow motion scenepunched in the facewatching tvcamerawritten by directorarrestrunninginterrogationhandcuffsreporterbrabound and gaggedmountainvideo cameraprisonersubwaysevered headanti heronews reportpaingravecharacter repeating someone else's dialoguebeaten to deathuniformumbrellarace against timedebtknocked outkicked in the facescreamdisappearancepursuittied updismembermentropekilling an animalcopscene during opening creditshammerkicked in the stomachbuttockslosssevered handcovered in bloodvictimburialsocial commentaryconvenience storeshovelaquariumstabbed in the legbruisesirenhogtiedbeing followedimpotencestruggleex copgatesubtitlesgolf clubpolice chiefkoreandiggingcall girlhead bashed inwoman in bra and pantiesbusiness cardkickdnahandcuffedpressprosecutorsouth koreadocumentex conshockhit with a shovelcustomertragic endinghit with a hammerhookexcrementbedriddenhit with a chairmetropolispick axefemaleincompetencehit with a golf clubseoultoolstask forcechisel (See All) |
Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen …ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)
| Subgenre: | independent filmsuspensetragedypsychological thrillerfamily tragedy |
| Themes: | panicgriefguiltangerinvestigationfearlovefriendshipmarriageinfidelitybetrayaladulterypregnancyescapedeception …memoryextramarital affairdivorcebrutalityparanoiaunfaithfulnessillnessmental illnesstraumaamnesiaforgiveness (See All) |
| Mood: | nightmareneo noir |
| Locations: | carhospitalschoolhotelairplanelondon englandairportelevatorkitchenpolice carenglandfire truck |
| Characters: | little boyboydoctorhusband wife relationshipfather son relationshipmother son relationshipfriendteenage boyfemale protagonistteacherbabybest friendpsychiatristex husband ex wife relationshippregnant woman …self discoverydoctor patient relationship (See All) |
| Period: | 1990s2000s2010syear 1999year 2013year 2007 |
| Story: | crying womancigarette smokingwet clotheslocked doorhearing voiceswhisperingtwist endingblood on facediarykeysearchdrawingfoot chasef wordtelephone …secretface slapdreamcryingsurprise endingphotographbased on novelviolencebloodflashbacksexfemale nuditynuditysex scenekissfemale rear nudityfightpartychaseshowertelephone callcell phonebeatingblood splatterfoodmirrorslow motion scenepunched in the facecamerawritten by directorarrestbare buttletterlierunningbedsex standing upbathroomhallucinationbritishsubjective camerabedroomstrangulationambulancemontageeatingaccidentfalse accusationapologyno opening creditsdream sequencedouble crosson the runflash forwardparkattempted murderargumenthotel roomdangerscreamingattackliarcharacter's point of view camera shotknocked outdomestic violencescarinjectiondeath of sonreunionsleepingtrusttherapygaragefreeze framesyringerevelationwarehousehypodermic needleheavy rainlooking at oneself in a mirrorlistening to musicsociopaththerapistnosebleedbarefoot malepsychologistparking garagefalse identitypresumed deadreverse footagetensionbloody nosemobile phoneintrigueloss of sonimpostorbroken glasshousewifeescape attempthit on the headevidencesurprisewedding ringvoice over letternotepierbruisebenchnewspaper clippingholding handsmannequinphoto albumfast motion sceneclose up of eyesfiremanmemory lossanniversarymental patient12 year oldclosetnotebookmedical maskviolence against womenrepeated sceneschemeassumed identitydoubtfake identityfriendship between womenhospital roomhospital bednewspaper articlehead injuryscene of the crimedomestic abuseseizurecamcorderrepeated linefacial scarmanipulative behaviorfirst person titlehiding placehitchcockiandistrustfully clothed sexwaking upflashback within a flashbackbrain damageclose up of eyefade to blackman hits a womanwedding anniversaryman slaps a womanwrapped in a towelred herringman slaps womanloss of memorycityscapevideo diaryconcussionfire alarmlearning the truthdigital camerapretending to be someone elseman hits womanpsychological manipulationrepeated eventman fights a womanrepressed memorywine bottlehysterical outburstleft for deadbloody mouthhidden truthman punches a womanvideo recordingobservatoryreconstructionsedativefemale star appears nudepenis slurkiss on the foreheadhummingmanipulative mandead sonoutburstpeepholeprivate investigationbirth certificatedisbeliefrepeated dialoguemysterious event40 year old8 year oldmentally unstablename tagfacial bruisechloroformedmale female fightwindshield wiperamnesiacmristanding in the rainviolent manmentally unstable womanbrushing one's teethclose up of handmentally unstable protagonistwoman wrapped in a towelhusband hits wifehusband slaps wifelocking a doorwrapped in a bedsheetbreaking a glassshort term memory losswedding photographlost memorymeningitiswaking up nakedgaslightingmistaken belief that someone is deadshoeboxill wifeshort term memorycamera shot of eyessick wifeanterograde amnesiareunited with familysearching for the truthskiing accidentage regressionhit with a lampchemistry teachermedical reportsick womanlooking through a peepholetalking to a camerasinging along to music (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
| Subgenre: | martial artsblack comedysuspensepunk |
| Themes: | panicinvestigationtorturefearmurderdeathrevengekidnappingbetrayallesbianismdrunkennessescapedeceptionseductionbrutality …paranoiasadismhome invasion (See All) |
| Mood: | goreneo noircar chase |
| Locations: | tunnelwaterbathtubbarrestauranttrainhotelsnowmotorcycleairplaneparis francenightclublondon englandtaxiairport …elevatorapartmentpolice carrooftoptrain stationcar firecar in watercar into waterescape from a car in water (See All) |
| Characters: | american abroadpolice officertattoomother daughter relationshipfather daughter relationshiphusband wife relationshippolicefemale protagonistsoldierhostagehitmansniperrussiangermanpolice shootout …sniper riflepolice chasecoroneramerican in the uk (See All) |
| Period: | 1980syear 1989 |
| Story: | smoking a cigarettemicrofilmcigarette smokingblond haircigaretteswearingblood on facejumping from heightcaucasianprofanitydrowningunderwater sceneimpalementfoot chasef word …telephonedead bodyfalling from heightrescuefiresurprise endingphotographtwo word titlebased on novelviolenceflashbackbloodfemale nudityf ratedmale nuditybare breastsbare chested malegunsex scenefemale rear nudityfightexplosionpartyknifelesbian kisschasepistoltopless female nudityvoice over narrationshootouthigh heelsbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestblondeshot in the headslow motion scenepunched in the facecameragunfightbrawlbased on comicshowdownheld at gunpointbeerhand to hand combatsunglassesbedcar crashinterrogationbritishcolor in titlerevolverfightingkung fushot in the backspybisexualsurvivalbraassassinbased on comic bookambushstrangulationmassacredisguisewomanmontagethroat slittingbridgestabbed to deathmixed martial artsstabbed in the chestnonlinear timelineexploding carman with glassesradiodisarming someonehit by a cardouble crossbathpolice officer killedvanfemme fatalenews reportshot in the legshot in the foreheadbartenderlatex gloveson the rungunshotflash forwardattempted murderone against manystalkerhotel roombinocularscharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuekarateprotestattackpay phoneumbrellamissionundercoverproduct placementrace against timecover upknocked outkicked in the facetough girlopening action scenelong takemanipulationscarwigstalkingneck breakingpremarital sexsuspicionthreatened with a knifehandgunsecret agentsilencerlove interestespionageciasubtitled scenekillingarsonstylized violencehenchmanberlin germanyriotcold waritalianiceropetraitorfalling down stairsbulletrevelationhead buttassassination attemptelectronic music scorewoundheavy rainscene during opening creditstold in flashbackbeardmorguekicked in the stomachmovie theatereccentricwristwatchphone boothcovered in bloodbuttskateboardstrong female leadfollowing someoneaction heroinefemale killerfemale warriorpassportthugstealing a carfight to the deathintrigueresistancestabbed in the throathit in the crotchmercilessnessshot in the faceevacuationescape attemptstabbed in the headblack bracigarette lightertime lapse photographystabbed in the legpunched in the chestassault rifleaerial shotblack eyeknife fightblood on shirtundercover agentbody landing on a carknife throwinggasolinepolice raiddressing roombruisewilhelm screamstick fightroundhouse kickfast motion scenevodkafemale assassinenglishman abroadbisexual womanblood on camera lenscia agentporn magazinehistorical fictionalleyfinal showdownset uppistol whipscene before opening creditssuit and tieblonde womanarms dealerwatchstabbed in the armfemale spybearded manshot in the eyefilm starts with textbased on graphic novelstrong languageman kills a womangun violencekgbmacguffinraveski maskwoman kills a manaudio cassettejudocar set on fireshot in the throatmetal detectortwo way mirrorgraphic violencelighting a cigaretteoverturning carberlin wallrogue agentstabbed in the facespy herowoman fights a manmagnifying glassbloody violencedeath by drowningfrenchmanpool of bloodstrangled to deathsecret policeone woman armyimprovised weaponcar rolloverfreedom fighterresistance fighterabandoned warehouserookieanti heroineassassination plotbreaking a bottle over someone's headdouble agentknocked out with a gun buttwalkmanwiretappingbilingualismhidden gunslow motion action scenecassette tapeenglishwoman abroadwoman punches a mangarrotecrushed by a carman fights a womanbrass knucklesdefectorman punches a womanbatonblood on handsborder guardfrenchwomanbritish secret serviceaudio recordingstabbed in the foreheadbritish intelligencewearing a sound wireneonlistcode nameneon lightfake passportstasiforgerc wordstolen police carsex on bedknife in chestrussian spymi6stabman with a ponytailghetto blastercar falls into waterdrownedtough womancivil unrestdrownlighting a cigarette for a womaneast berlinkgb agentice bathphotographic memorytrapped underwaterphoto labwearing a wirewatchmakerhand in pantieswest berlincounter espionageeurospylesbian sex scenetelevision news reportcar falling into waterreference to david hasselhoffgarrotteoni presssubmerged in car (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
| Subgenre: | supernaturalindependent filmsuspensepost apocalypsesurvival horrorzombie apocalypsedisaster film |
| Themes: | supernatural powerpanicfearsuicidemurderdeathrevengedrunkennessescapedeceptionbrutalityparanoiainsanitysurveillancehome invasion …apocalypsecannibalismnear death experience (See All) |
| Mood: | nightmaregorebehind the scenesambiguous ending |
| Locations: | tunnelbartrainforestcemeteryairplaneairportwoodskitchenapartmentcampfireschool teachercar bombnew englandcar fire …train driver (See All) |
| Characters: | teenage girlartistpolice officerteenagerfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother sister relationshipteacherzombiestudentsecurity guardteacher student relationship |
| Period: | 2010s |
| Story: | cigarette smokingliving deadphonefireplacekeysearchdrawingimpalementflashlightfoot chasefalling from heightrescuedreambased on bookfire …surprise endingbased on novelviolencedogbloodone word titlefightdancingtitle spoken by characterexplosionpartyknifechasepistolcell phonebeatingcorpseshot to deathblood splattershot in the chestshot in the headshotgunslow motion scenecatswordbrawlshowdownrifleheld at gunpointbombshot in the backsurvivalambushaxemontagestabbed to deathdinertoiletstabbed in the chestsubwayexploding cardisarming someonechild in perilhit by a cardouble crosstransformationshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingperson on fireattackfantasy sequencepay phoneon the roadbaseball batexploding bodyundeaddisasterbow and arrowburned aliverevelationmachetelistening to musicscene during opening creditssurvivormutantviruscooksecurity cameracaught having sexeccentriccovered in bloodmind controlend of the worldburialeaten alivebarefootmobile phonedual wielditalian americanboston massachusettscannibalchaosshovelstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murdermutationburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayhooded figurec4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned cartire ironairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All) |
An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.
| Subgenre: | cult filmsuspense |
| Themes: | griefobsessiontorturedeathmurderkidnappingrapeadulteryseductionpsychopathbrutalitydrug useinsanity |
| Mood: | nightmarerainnight |
| Locations: | oceanhospitaltrainaustraliapolice carseashipyachtstorm at seaship on fire |
| Characters: | doctorhusband wife relationshippoliceserial killerpolicemandancerphotographerhostageaustralianterroraustralian abroaddeath of killer |
| Story: | sleeping pillscigarette smokingpillsdivingkeydrowningunderwater sceneflashlightswimmingdead bodytearsrescuecryingfirephotograph …two word titlebased on novelbloodviolenceflashbackdogsexfemale nuditymale nudityfemale frontal nuditymale rear nuditybare chested malekissfemale rear nudityfightdancingknifechaseshowersongbeatingcorpsefoodcar accidentshotgunbare buttheld at gunpointsunglassessubjective camerasubwayapologyradioduelbinocularsmicrophoneevil mandeath of childdeath of sonisolationsuspicionmurdererdie hard scenariomaniacsociopathsurvivorcaptivewristwatchstrangerhome movierailway stationblack humorpassportwoman in jeopardyphoto shoottrappedloss of sonhit in the crotchdeath threattitle appears in writingrowboatmedicationexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedpsychoticpsycho killerminimal castalonesailboatsailingraftdegradationmarried coupleflareunconsciousnessdruggedswimming underwaterlying on bedman in swimsuitstabbed in the shouldershot through the mouthtitle same as bookpsychological torturesole survivorbreaking through a doorflare gunmass murdererdriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceandeeply disturbed personhands tiedwriting in bloodlooking at picturebathing suitmovie projectorharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlearm injurysalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasday for nightplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo …od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
| Subgenre: | ghost storyparanormal activity |
| Themes: | supernatural powerinvestigationghostreligionsuicidedeathmurderfriendshippregnancyweddingpsychopathevilhome invasioncrueltytrauma …self sacrificedevilpolice investigationnear death experience (See All) |
| Mood: | nightdarknessmoving |
| Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
| Characters: | little girldoctorhusband wife relationshippoliceafrican americanfriendfemale protagonistnursedetectivepolicemanbabypriestchristianreference to godkiller …christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
| Period: | 1970syear 1969year 1970 |
| Story: | crying womanflameslocked insymbolflamelocked doorhearing voicesapparitionspiritsacrificedollritualdrawingflashlightfoot chase …cryingfirephotographviolenceflashbackbloodf ratedcharacter name in titleone word titlefighttitle spoken by characterknifechasebased on true storytelephone callshot to deathblood splattershot in the chestslow motion scenepunched in the facewatching tvcamerashootingbookneighbordemonhallucinationreference to jesus christgood versus evilname in titlestabbingthroat slittingsuicide attemptnonlinear timelinecultnunno opening creditschild in perilnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessionbaseball batscreamscargiftbasementhaunted housegraffitiblood spattercouplerecord playeroccultdresslistening to musicspin offstabbed in the stomachtoyvisithometaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titlehiding in a closetsuit and tiepopcornblood stainhospital roomfilm starts with textlistening to radiofall from heightafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaletraffic accidentmysterious womanbechdel test passedtraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayontalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
The film revolves around Park Hee-bong, a man in his late 60s. He runs a small snack bar on the banks of the Han River and lives with his two sons, one daughter, and one granddaughter. The Parks seem to lead a quite ordinary and peaceful life, but maybe they are a bit poorer than the average Seoulit …e. Hee-bong's elder son Gang-du is an immature and incompetent man in his 40s, whose wife left home long ago. Nam-il is the youngest son, an unemployed grumbler, and daughter Nam-joo is an archery medalist and member of the national team. One day, an unidentified monster suddenly appears from the depths of the Han River and spreads panic and death, and Gang-du's daughter Hyun-seo is carried off by the monster and disappears. All of the family members are in a great agony because they lost someone very dear to them. But when they find out she is still alive, they resolve to save her. (Read More)
| Subgenre: | independent filmcult filmblack comedysuspensetragedycreature featureasian horror |
| Themes: | panicgriefangerfearsuicidedeathmurderrevengekidnappingbetrayaldrunkennessescapefuneralmonsterdeception …militarydeath of fatherdysfunctional familyabductionunemploymenthomelessnessenvironmentself sacrificenear death experience (See All) |
| Mood: | raingoresatire |
| Locations: | tunnelwaterboathospitalsnowtaxielevatorpolice cartrucksewer |
| Characters: | little girllittle boyamerican abroadteenage girlpolice officerdoctorfather daughter relationshipteenagerfamily relationshipsfather son relationshippolicechildrenbrother brother relationshipbrother sister relationshipsoldier …nursephotographerhostagedaughteramericansingle fatherfishermangrandfather granddaughter relationshiphomeless man (See All) |
| Period: | 2000syear 2000year 2006 |
| Story: | lostheadphonesjumping from heightsacrificesearchmapimpalementflashlightfoot chasetearsrescuecryingfiresurprise endingphotograph …two word titleviolencebloodone word titletitle spoken by characterexplosionchasepistolcell phoneblood splatterurinationshotgunslow motion scenewatching tvcamerashowdownrifleheld at gunpointbeerislandriverscientistsurvivalorphangangambushdisguiseambulancebridgearmyfishfishingchild in perildouble crosscreaturevannews reportlatex glovesflash forwarddangerprologueprotestpoisonrace against timecover updeath of childdeath of brotherinjectiontragic eventgovernmentsleepingsingle parenteavesdroppingsabotagesyringebow and arrowathleteburned alivehypodermic needleheavy rainmutantvirusdemonstrationmorguenosebleedgiantdesperationskullparking garageanimal attackcrushed to deatheaten alivegas maskrampagepump action shotgunremote controlbraverymourningpower outagehungerevacuationescape attemptdead childinfectionpollutiongasolinemutationburned to deathsirenmedia coverageparking lottext messagingfinal showdownmolotov cocktailkoreagiant monstersuit and tiedead childrenshot with an arrowarcherymedalchangeshot in the eyewetting pantsmegaphoneteenage daughtertentaclesouth koreashot through the mouthquarantinearcherhomeless personrecreational vehicletoxic wastecoughing bloodcheckpointpsychotronic filmimprovised weaponanimal killingmortuarygiant animalgrindhouse filmstarvinglootingdustflaming arrowrescue attemptkaijujumping off a bridgesquidhazmat suitflash driveboneshuman skulltarget shootingmealblood samplebiohazardvomiting bloodchild in dangersocial criticismreference to robin hoodlong tongueseoulbeer cancollege graduatetoxicurinating in fearman eating monsterchild eatenboy eatenpaddle boathypodermicbio hazardkiller fishman versus naturedemonstratorformaldehydelazyworld health organizationjumping from a bridgemounted animal headeaten by animalman versus monstersnack barbullseyecell phone tracedropkickirresponsible fatherriot squadchild killed by an animalbronze medalworld cinema (See All) |
Brian Lackey is determined to discover what happened during an amnesia blackout when he was eight years old, and then later woke with a bloody nose. He believes he was abducted by aliens, and N. McCormick, a fellow player on Brian's childhood baseball team, may be the key as to exactly what happened … that night. As Brian searches for the truth and tries to track him down, Neil McCormick takes up hustling and moves to New York, in attempts to forget childhood memories that haunt him. Together, the two of them uncover the terrible truth of the scars they share. (Read More)
| Subgenre: | independent filmcoming of age |
| Themes: | abusegriefguiltobsessioninvestigationfriendshipkidnappingdrugsrapechristmasmoneydrinkingdrunkennessvoyeurismmemory …corruptiontheftparanoiadrug usedysfunctional familyhumiliationunrequited lovecrueltychildhoodtraumaregretchildhood traumaalien abductionpsychological trauma (See All) |
| Mood: | nightmarerain |
| Locations: | bathtubnew york citybarsnowsmall townbusbicyclebaseballrooftopmotelgay barbus station |
| Characters: | little girllittle boyteenage girlgirlboytattoofamily relationshipshomosexualfather son relationshipmother son relationshipfriendbrother sister relationshipprostituteteenage boy …alienstudentgay sexphotographerbest friendgay kissbullysingle mothergay friendhomosexual rapehomosexual kissgay rape (See All) |
| Period: | 1980s1990syear 1991year 1983year 1981year 1987 |
| Story: | child abusecigarette smokingsweaterwhisperingearphoneslostfaintingeyeglasseskeylibrarysearchdrawingflashlighttearsface slap …dreambased on bookcryingphotographbased on noveldogflashbackbloodviolencenuditymale nuditymasturbationmale rear nuditygunkissejaculationsingingshowertelephone callvoice over narrationbeatingunderwearfoodurinationwatching tvdrinkcondomundressingletterbeerrunningbirthdaybedmarijuanaprostitutionsubjective camerahalloweengay slurbedroomnew yorkcocainehousesubwaynonlinear timelinechildbathejaculation into someone's mouthmicrophonestrippingangelreadingchristmas treecollege studentfarmerhalloween costumeprankscargiftsadnessunderwaterobscene finger gesturefireworksgraffitiufosingle parentpizzacoachpot smokingrevelationbreaking and enteringheavy rainlistening to musictape recordersexual abuseice creamtoywatching a movienosebleedvideotapeteddy bearcrushmovie theatremale prostitutehaunted by the pasttarget practicebloody nosesufferingchild's point of viewplaygroundunderage drinkingrejectiontaking a picturepost traumatic stress disorderhypnosischristmas eveabsent fatherpedophileperversionrainstormmustachesnowingdark pastbruisecellarhustlerchildhood memorypipe smokingphoto albumtracking devicepervertpresentnew jobshynesspedophiliaspit in the facepostcardmen's bathroomtrick or treatingsnorting cocainechild molestationjournalcrutchesblackoutmotel roombitternesssexual perversiongay crushtween girlclimbing through a windowboy with glassesdegradationanal rapemale rapehanging upside downlsdfallingcrippleplaying a video gamemuggingaudio cassetteseizurestation wagonmale prostitutiondecadencesorrowoverhead camera shotchild molesterkansascruising10 year oldpolaroid cameratraumatic experiencewitch costumebaseball teammolestationfast food restaurantloudspeakerinner title cardchristmas caroldepravityletter writingrocking chairleaving homesoul matechild swearingdisabledboy girl relationshipcerealborderline personality disorderbody part in titlemistreatmentman boy relationshipsubconsciouscupcakerepressed memorytv show in filmhandballdevil costumeloss of innocencesexually transmitted diseasegomorrahyscaffolddrug snortingmoral corruptionvenereal diseasebed wettingshampooumpiregay hustlereight year oldlittle leagueswing setmother's boyfriendgay man straight woman relationshipmobilemen's toiletuses the word faggotgay kidcommunity collegeporch swinguses the word faghomemade haunted house attractionairplane ticketbaseball coachglbt issuesbreakfast cerealcamaropartner in crimeatariephebophilecrawlspacebroken eyeglassesdead cowbaseball cardconfronting the pasteyesightsilent nightmaking facesunwanted sexual advancesblue lightmale male relationshipmale wearing makeupsexual aberrationdrive in theatremale hustlergarglingcrabsrecovered memorysexual ambiguitytagginglittle league baseballmouthwashburied memorieschristmas carollingfalling glassuniversity of california berkeleyemotional shockman boy lovehand in pantsmodesto californiasandwich shopsexual corruptionsordidnesssubway ridebottomless pitgay man straight man relationshipreference to jan vermeerkarposi sarcomaloss of dignitysnack foodupside down imagevermeer paintingbeanbagcrab licenegligent motherpot pipeamc gremlinbrighton beach new yorkloft bed (See All) |
Sharon Da Silva wakes up every night screaming about "silent hill". Pursued by a police officer suspicious of her motives and swerving to avoid another child her adoptive mother crashes the car knocking herself unconscious. When Rose Da Silva awakens to find her adopted child is missing, she searche …s the fog and ash blanketed town for her beloved daughter. (Read More)
| Themes: | supernatural powertortureghostreligionmurderdeathfriendshiprevengesurrealismbetrayalmonsterbrutalitysadismfaithhope …self sacrificemurder of a police officermissing childghost townreligious cult (See All) |
| Mood: | raingorenight |
| Locations: | carhospitalschoolhotelelevator |
| Characters: | little girlpolice officergirlmother daughter relationshippolicenursepolicemanwitchreligious fanatic |
| Story: | knockingmissing daughtercliffsacrificemissing personkeymapimpalementflashlightrescuephotographbloodflashbackviolencefemale nudity …guntitle spoken by characterknifepistolcell phoneblood splattercar accidentarrestshowdownbathroomdemonhandcuffsclassroomgood versus evilsurvivalwomanbridgestabbed in the chestnundouble crosscreaturebeaten to deathscreamingperson on firecourtscardarkpolicewomanwaterfallhandgundismembermentburned alivegothicmutilationladderorphanagecompassionjanitortrappedsufferingbased on video gametitle appears in writingcigarette lighterdark herofogsoulsirentorso cut in halfheroismblood on camera lensbarbed wirefemale bondingfemale fighterhuman monsterbus stopburnt faceunconsciousnesshandcuffedpipeconscienceashesburnt bodypersecutioncar radiochild molesteradopted daughtermotorcycle copmurder of a nude womanimmolationsleepwalkingsecret roomretreatknife in the chestmisthornhidden roomsliced in twomoral ambiguitycoal minebodily dismembermentwest virginiaabandoned minedaylimbohandcuffed womanskinned aliveburned at the stakesexy nursetown name in titlemultiple monstersmelting facemurder of a policewomanchain link fencesplit in twonightmare becomes realitysleeping on couchcatholic orphanagefundamentalist christianroom keywitch burninghandcuffed behind backschool roomsilent hillmaternal instincttorn fleshash falldead but doesn't know itmotherly instinctbarcelona chairdust mask (See All) |
Pre-teen Jeliza-Rose's parents are hopeless drug addicts. When pa, rocker Noah, finds ma's OD'd, he fears to be charged with homicide and takes Jeliza along to his ma's place, in a desolate country region. With Noah passed out, the girl mentally transfers to a fantasy world she and her doll heads en …ter magically. Jeliza's adventures also star the crazy locals, notably Dell, and Dell's grown but intellectually disabled brother Dickens. (Read More)
| Subgenre: | independent filmcult filmfairy taledark fantasybased on fairy talemodern fairy tale |
| Themes: | supernatural powerabusefeardeathsurrealismpregnancydrinkinglonelinessdeath of fatherdeath of motherdrug usedysfunctional familyinsanitymental illnessdeath of wife |
| Mood: | nightmareavant garde |
| Locations: | rural settingbartrainbuskitchenfarmsubmarineschool bus |
| Characters: | girlboyfather daughter relationshipmother daughter relationshipfamily relationshipsboyfriend girlfriend relationshipsingerbrother sister relationshipmusicianreference to godgrandmother granddaughter relationshipfrench kiss |
| Story: | drug overdosecigarette smokingwhisperingfaintingdollsuitcaseunderwater sceneritualflashlightswimmingdead bodyvomitingfalling from heightsecretdream …firephotographbased on novelflashbackbloodsexkissexplosionsingingknifesongbeatingcorpsefoodmirrorurinationdrinkpaintingbookriflesunglassesrunningbedpianohallucinationprayerguitarorphanbandstabbingeatingrock bandchild in perilvoice overtreedrug addictscreamingpuppetfantasy sequencestorytellingreadingrabbitdomestic violencescarwigcrossrock 'n' rollisolationloss of fatherloss of mothersleepingcult directorheroinheart attackflirtingpickup truckhypodermic needletalking animalguitaristdenmarkdrug abuseeccentricflatulencesharkskullfalse identitypeeping tomimaginationrock concertinnocenceshoeswhipjunkiemakeupdynamiteatticlipstickshadowalternate realitywedding dressfamily dinnerlanternfieldpumpkinshaved headbrainsouthern accentminingface maskdinner partymummynecrophiliapedophiliastuffed animalold dark houseeyedead fathermental retardationabandoned housebeebugfarmhousetween girlsquirrelimaginary friendlistening to a radioelectric guitaranttrain trackstrain ridepieseizurecleaningfart jokerock musicianheroin addictaltarman childepilepsyclose up of eyedelivery boyalice in wonderlandwingspillow fightchildhood sweetheartrocking chairwagondutch anglecar wreckdecomposing bodymirror ballpassenger traintreasure chestapplying makeuptaxidermylemonademousetrapprairiefireflygrave diggerpinatapeanut buttershooting uplobotomyspider webcandy bardissectiontrain wreckpretendinggeesechild neglectphalluswatchingapple piereference to alice in wonderlanddesecrationembalmingdeath by overdosetrain derailmentwonderlandtransistor radioexploding trainfeather boajutlandtalking dollreference to barbie the dollscrubbingalonenessplaying dress upshotgun shellurinating on the groundburritodead treementally handicapped personrabbit holebroken dollpillow feathersspasticdoll's headribcagehead scarlightning bugcrushed skullfalling off a bedswim fins (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int …ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
| Subgenre: | supernaturaltragedymedicalparanormalteen movieteen horrorpsychological thrillerpsychological horror |
| Themes: | supernatural powerafterlifepanicguiltobsessionfeardeathfriendshiprevengesurrealismdrunkennessescapeparanoiaredemptionbullying …childhoodnear death experienceregret (See All) |
| Mood: | nightmarehorror movie remake |
| Locations: | waterbathtubhospitalbarswimming poolsnowmotorcyclebusnightclubelevatorapartmentrooftopyacht |
| Characters: | doctormother daughter relationshipafrican americannursesecurity guardprofessorcrying baby |
| Period: | 2000s2010s |
| Story: | hearing voicesback from the deadcaucasianlibraryunderwater sceneflashlightswimmingfalling from heightrescuedreamsurprise endingflashbackone word titlebare chested malekiss …interracial sexknifeshowercell phonecorpsecar accidentremakeslow motion scenesunglassescar crashpianohallucinationreference to jesus christsubjective cameradeath of friendmontagebridgeapologyvoice overflash forwarddangerprologuefantasy sequencecharacter's point of view camera shotrace against timecover updeath of childinjectiontragic eventbasementlaptoppremarital sextwenty somethingsyringeelectronic music scorehypodermic needleloss of friendmorgueaccidental deathwristwatchparking garagehaunted by the pastpower outageresurrectionfalling to deathdeath of sisteraerial shotalternate realitydark pastlightmoral dilemmabullet timetext messagingmale objectificationstabbed in the handscene before opening creditsold flamebroken mirrordomineering mothermedical studentraveloss of sisterexperiment gone wronghigh techtragic pastcamera phonetaking off clothesmedical doctorpsychotronic filmbulldozercar rolloverhedonismscience runs amokwhite coatjellyfishflickering lightmedical experimentbritish actor playing american characterrubik's cubepagerwalking stickhouseboatscientific experimentguilty consciencedefibrillationdefibrillatorout of body experienceyear 2017inside the mindseeing dead peoplevirtualitybrain scancompetitivenessparanormal phenomenonreference to jesusside effectcyberbullyingremake of cult favoritemedical sciencemedical scannercar falling off a bridge (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
| Subgenre: | conspiracyabsurdism |
| Themes: | supernatural powerpanicangerfearkidnappingmoneyescapemagicdeath of fatherdeath of motherabductioncrueltymissing child |
| Locations: | oceanbeachrestaurantschoolhotelsnowsmall townbicycletaxielevatorkitchenpolice carengland |
| Characters: | little girllittle boypolice officergirlboydoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshippolicemanbaby …maidwitchgrandmother grandson relationship (See All) |
| Story: | missing girlfaintingeyeglassesmissing personsearchdrawingfoot chasetearsrescuebased on bookcryingsurprise endingbased on novelsingingunderwear …catmaskpaintingrunningbirthdaysubjective cameragood versus evilorphanbedroomcandlemountaindisguisesnakechildradiochild in perilcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationscreamspeechdisappearancepursuitwiggiftexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeapplauseeavesdroppingtalking animalcakecagecomic booklifting someone into the airhatcookmousehidingwitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleaverhandtreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessscottishluggagemoney falling through the airbedriddenhuman becoming an animalyoung boyrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childtree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All) |
A regular family - Maria ('Naomi Watts' (qv)), Henry ('Ewan McGregor' (qv)) and their three kids - travel to Thailand to spend Christmas. They get an upgrade to a villa on the coastline. After settling in and exchanging gifts, they go to the pool, like so many other tourists. A perfect paradise vaca …tion until a distant noise becomes a roar. There is no time to escape from the tsunami; Maria and her eldest are swept one way, Henry and the youngest another. Who will survive, and what will become of them? (Read More)
| Subgenre: | independent filmsuspensetragedydisaster filmdisaster movie |
| Themes: | griefangerfeardeathchristmasmemoryparanoiahopecouragenear death experience |
| Mood: | nightmarerainambiguous endingtearjerker |
| Locations: | oceanwaterbeachhospitalrestaurantswimming poolhotelhelicopterairplaneairportseatruckjungleblood in water |
| Characters: | little boyamerican abroadboytattoodoctorhusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipbrother brother relationshipteenage boyfemale protagonistnursereference to godterror …germanamericantruck driver (See All) |
| Period: | 2000swinteryear 2004 |
| Story: | falling into watercoastlineearphonestelescopeinjurysuitcaseunderwater scenesearchmapswimmingtelephonedead bodytearsrescuecrying …surprise endingphotographtwo word titlebloodflashbackfemale nuditynuditymale nuditybare breastsfemale frontal nuditymale rear nuditybare chested malekissbased on true storytelephone calltopless female nuditycell phonecorpseblood splatterfoodurinationblondeslow motion scenewatching tvundressingbikinirunningsubjective cameracleavagesurvivalwinemountaineatingfishapologyno opening creditsbirdscantily clad femalechild in perilold womanpaintreescreamingcharacter's point of view camera shotvacationrace against timetentscreamscarinjectionfemale removes her clotheshairy chesttragic eventreunionflowersleepingstrong female characterholidaypickup trucksurgerydisasteritalianhuggingdestructionwoundhypodermic needletouristsurvivorswimsuitteddy bearhome moviestrong female leadearthquakepresumed deadwatching televisionpromisebarefootreverse footagetensionfloodwindsufferingstarbraveryinsectballchristmas eveinfectionaerial shotwedding ringfemale doctorcanenotelanternholding handsmoral dilemmaseparationsunbathingclose up of eyesasiaenglishman abroadhistorical fictionchristmas presentdead animalrepeated scenehead woundnudeshipwreck14 year oldcoca colano title at beginningresortnude girlfilm starts with textstretcherfallingbare feetswimming underwaterkindnessbleedingpalm treereading a bookgurneyclimbing a treenatural disasterhome videoscarfoverhead camera shotfather son reunionspitting bloodfrenchmantsunamimattressping pongfade to blackwaveleg injuryleg woundoverhead shotorangebeetlecatastrophefloodingmissing fatherreference to santa clausenglishwoman abroadhusband wife reuniondevastationfamily vacationoxygen maskmother son reunionsoutheast asiadead fishmotivationaltidal wavemissing sonstar gazingceiling fancold the temperatureseparation from familythaithree brothersfear of flyingvomiting blood9 year oldlooking through a windowblenderseat belt7 year oldbeach resortsitting in a treeswedename tagmissing husbandmissing wifemissing brothermissing motherwading in waterindian oceanface woundrubbledragging someonenear drowningrapidssnorkelingassumed deadbeach ballbrother brother reunionturbulencesoda popfive year oldmissing boyone breast exposedantibioticsearch for familyopening creditstorn clothesclothes cut offphuket thailandtangerineboxing daylifting a boy into the airsplashing water on someoneshoulder wound2004 indian ocean earthquake and tsunami73 year oldmissing familypaper lanternred ballswept awayfather son reunitedfloating lanternhole in ceilinglantern festivalthree sons (See All) |
After discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre ocurrences happen and the group becomes trapped inside the ship, which they soon learn is inhabi …ted by a demonic creature. (Read More)
| Subgenre: | cult filmsuspensesurvival horror |
| Themes: | supernatural powerguiltangerghostmurderdeathbetrayaldrunkennessdeceptiongreed |
| Mood: | raingore |
| Locations: | oceanbarseaghost ship |
| Characters: | little girllustghost in mirror |
| Period: | 1960syear 1962zip line |
| Story: | cigarette smokinglocked indripping bloodapparitionratdrowningunderwater scenemapimpalementflashlightvomitingfalling from heightphotographflashbackviolence …bloodfemale frontal nudityfemale rear nuditytitle spoken by characterexplosionpistolcorpseshot to deathblood splattermachine gunshot in the chestshot in the headshotgunpunched in the faceheld at gunpointislandsubjective cameradecapitationmassacreambulancedeath of friendwomanthroat slittingsevered headradiochild in perilfemme fatalecigar smokingnecklaceshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firepoisonstorytellingknocked outdeath of childskeletondisappearanceexploding bodyhauntingsevered armdismembermentchild murderitaliangoldcaptainburned alivemass murderlooking at oneself in a mirrorshot in the stomachtreasurebuttocksfemale singersevered handwatching televisionstabbed in the throatstabbed in the legsoulsintorso cut in halffemale removes her dressshipwreckburnt faceshot in the eyetavernpoisoningrazor bladescuba divingpassengeraltered version of studio logocruise shipsole black character dies clichemaggotshape shifterimmortalexploding shipcut into piecessole survivorpool of bloodvillain not really dead clichelocketradarballroomstraight razorballroom dancingcruiseexploding boatfalling through the floorc4 explosivessliced in twostabbed in the foothundred dollar billfall to deathblowtorchmorphingfreak accidentocean linerstartledrock paper scissorssinking shiphead cut in halfshaving headspear gungold barindoor swimming poolrat poisonwoman wearing a red dresssalvagehanged childhung from a hookconstruction cranepile of moneytugboathit with a metal pipeavaricefalling to one's deathrustshell casingchild ghostlogbookdigital watchluxury linerpoisoned foodevil markfall through floorbering straitcan of beansfalling into poolhiding in a freezership collisionbenevolent spirittug boat (See All) |
1327. After a mysterious death in a Benedictine Abbey, the monks are convinced that the apocalypse is coming. With the Abbey to play host to a council on the Franciscan's Order's belief that the Church should rid itself of wealth, William of Baskerville, a respected Franciscan friar, is asked to ass …ist in determining the cause of the untimely death. Alas, more deaths occur as the investigation draws closer to uncovering the secret the Abbey wants hidden, and there is finally no stopping the Holy Inquisition from taking an active hand in the process. William and his young novice must race against time to prove the innocence of the unjustly accused and avoid the wrath of Holy Inquisitor Bernardo Gui. (Read More)
| Subgenre: | conspiracyperiod dramamurder mystery |
| Themes: | supernatural powerinvestigationtorturefearreligionsuicidemurderdeathlovefriendshippovertyfaithexecutionapocalypsewealth …devilmurder investigationthe devil (See All) |
| Mood: | poetic justice |
| Locations: | tunnelbathtubchurchsnowcemeteryitalyfrancecavecatholic church |
| Characters: | artistfriendserial killerdetectivepriestreference to godchristianitylusthomosexualitybiblewitchcatholicfrenchself flagellationreligious fervor …suicide by poisonsuicide by jumping out a window (See All) |
| Story: | pushed off a cliffcodelibrariansuperstitionlostresearchjumping from heighteyeglassesratlibrarydrowningimpalementold mandead bodyfalling from height …secretfirebased on novelbloodflashbackfemale nuditymale nuditymale frontal nuditymale rear nuditysex scenekissfemale rear nudityfightfemale full frontal nuditynipplessingingchasevoice over narrationwoman on topcorpsemirrorcatbare buttbookreference to jesus christprayertoiletfemale pubic hairaccidentfalse accusationtrialpainterforeign language adaptationtonguegraveyardfive word titleconfessiongravepoisoncrosswitnesspigchickeneuropemonkeyitalianmousewitchcraftblockbusterskulltorchmonkdebatecensorshipdwarfmiracleprophecyreference to satanlaughterthrown through a windowmedieval timesautopsyfogblind manhorse and carriageshowtranslatorspittingdonkeypeasantpopegreekmonasteryfoxpaintdoubttowertemptationhead bashed instablebishopcluepersecutiontitle same as bookmultiple murdermiddle agesblack catsaintmagnifying glassdeath by drowningman on firetrapdoorreference to the virgin maryaltarsecret passagemassrichantichristbludgeoningplant in titlepoorvulturesecret roomhunchbackmaterialismsex on the floorreference to the devilmedievalchantinglabyrinthchurch bellglovepick axemissionary positionreference to the book of revelationinquisitioninksatanic ritualconundrumeunuchorderbook burningsexual favorfalse confessionreference to aristotleburned at the stakechantbiblical quotebattering ramgay for paynameless charactercalligraphyflower in titledeath by impalementpoisonedbludgeoned to deathheresyabbeycensorreference to the popeobediencenovicenorthern italy14th centuryhereticambiguous titledrowning in a bathtubexcommunicationtorture deviceseminarytribunalquestion and answerreasonvirtue1300sarseniccatacombsdeath by poisonpyreflagellationsouthern franceabbotsatan worshipherbalistwalking backwardspoisoned to deathcipherfaith in godinscriptionfranciscanholinesssecret entrancecorporeal mortificationlemon juiceredistribution of wealthreference to saint francis of assisiavignon francebibliophiliaflagrante delictoforbidden bookhidden staircasereference to ecclesiastesshoeprintdispensarylatin phraseparchmentpig penreference to virgilbenedictinecopiertithevow of povertyword of godblack spotbutchering pigpage turnerrecantationreference to ovidreference to st. thomas aquinas (See All) |
What starts as a poignant medical documentary about Deborah Logan's descent into Alzheimer's disease and her daughter's struggles as caregiver degenerates into a maddening portrayal of dementia at its most frightening, as hair-raising events begin to plague the family and crew and an unspeakable mal …evolence threatens to tear the very fabric of sanity from them all. (Read More)
| Subgenre: | mockumentarymedicalfound footagefake documentary |
| Themes: | supernatural powerpanicangerinvestigationfearmurderdeathkidnappingdrinkingmemoryparanoiaillnessevilphotographymysterious death |
| Mood: | gorenightdarkness |
| Locations: | tunnelcarhospitalforestwoodskitchenpolice carcavebackwoods |
| Characters: | police officerdoctormother daughter relationshippolicefriendserial killerpolicemanpriestsherifffilmmakerself destructivenessself destructionthe familyout of controlself injury …lesbian daughter (See All) |
| Story: | driving a carritewhisperingx rayinjurysacrificemissing personritualflashlighttelephonevomitingsecretcryingfirephotograph …flashbackviolencebloodfemale nuditynuditygunfemale rear nudityknifetelephone callcell phonecorpseshot to deathfoodmirrorshotguncomputercameradrinkshootingpaintingbirthdaybedbathroomneighborpianorevolverreportersubjective camerabedroomcookingvideo cameraeatingwidowsuicide attempthouseinternetsnakeman with glassesbirthday partyold womanlooking at the cameratalking to the camerajeansconfessiontreeargumentpossessioninjectionbasementpolicewomangardenmaniactv newsmedicinedresshypodermic needlediseasedesperationladderhomehomiciderampagesufferingsurveillance cameraattempted suicideshovelmedicationstairsdead childsurpriseattichandheld camerahealingalzheimer's diseasecellphoneh.p. lovecraftfemale doctorminedark pastopening a doorfemale reporternervous breakdownliving roomroomdead girlpsychopathic killerconfusionmysterious mangardeningdark secretmoney problemspaintfilm crewstaircasetelevision newsdiggingtv reportercameramanhospital roomhospital bedsicknessjacketworminternet videomedical studenthallwayvirginiauniversity studentshirtfemale police officerdecadencemysterious womannervousnessholeanguishenigmamedical doctorwindowtalking while drivingtelevision reportercaverndisturbed individualquestionbiteloss of controlsmartphonecorridorloss of memorybitingfemale studentdigital camerasenilityhostilityserpentblouseevil powerdiagnosisobscuritythesiscancer patientnightiehummingtrousersporchbloody handevil forcetelephone operatorcomputer screenfurystaringtroubled pastdistorted voicepediatriciansackforces of evilmysterious noisemedical testpantsspadedark powerburnt corpsecamera operatordark forcehospital patientmedical examhuman remainsdegenerative diseasedisturbed personrecuperationspinal tapclosed doorfemale patientpagan ritualforce of evilswitchboardburning corpsemysterious behaviortrowelradiographybewildermentswitchboard operatoraspsinister forcechild with leukemiamurmuringsenile dementia (See All) |
Mort Rainey is a successful writer going through a rather unfriendly divorce from his wife of ten years, Amy. Alone and bitter in his cabin, he continues to work on his writing when a stranger named John Shooter shows up on his doorstep, claiming Rainey stole his story. Mort says he can prove the st …ory belongs to him and not Shooter, but while Mort digs around for the magazine which published the story in question years ago, things begin to happen around Shooter. Mort's dog dies, people begin to die, and his divorce proceedings with Amy continue to get uglier. It seems that Shooter has Mort over a barrel, but perhaps Mort has his own ideas on how to resolve all the problems that plague him lately. (Read More)
| Subgenre: | cult filmpsycho thriller |
| Themes: | panicangerinvestigationfeardeathmurderinfidelityjealousyadulterydrinkingdrunkennessmemoryextramarital affairdivorcetheft …paranoiainsanityunfaithfulnessmental illnessjusticeclaustrophobia (See All) |
| Mood: | nightmaregore |
| Locations: | restaurantsnowsmall townwoodspolice stationpolice carlakemotelgas stationsuvcar in water |
| Characters: | husband wife relationshippoliceboyfriend girlfriend relationshipdetectivepolicemanwriterthiefmaidsheriffex husband ex wife relationshiptalking to oneself in a mirrorself doubtself reflection |
| Period: | winter |
| Story: | sleeping in a carcigarette smokinghearing voicespet dogcliffheadphonesfaintingfireplaceeyeglassesratkeyflashlightdead bodytearsvomiting …falling from heightsecretdreamcryingfiresurprise endingbased on novelflashbackdogbloodbare chested malegunfighttitle spoken by characterpistoltelephone callvoice over narrationcorpseunderwearblood splattermirrorpunched in the facecomputerdrinkletterbookheld at gunpointcafehallucinationrevolverdecapitationaxestabbingdinerman with glassesflash forwardauthorstalkerproduct placementkicked in the facescreamactor shares first name with characterthreatisolationsuspicioncabincheating wifearsonprivate detectivedestructionkilling an animalrevelationmass murderhatmousemagazineassaultpsychologywristwatchtimestrangerburialschizophreniawhiskeyloss of sonstabbed in the throatunfaithful wifeconvenience storeshoveltitle appears in writingnovelistdelusionscissorsstabbed in the headstabbed in the legevidencenotebruisemarital problemseparationprivate investigatorsouthern accentlaptop computerdead dogfiremanintimidationvillain played by lead actorconfusioninvestigatornotebookmolotov cocktailhit in the facedead animalkilling a dogmental breakdownmetaphorinspirationsexual tensiondisposing of a dead bodywatchanimal crueltysquirrelbroken mirrorcottagesplit personalitytennesseecabin in the woodscreativitybathrobewriter's blockcleaning ladysole black character dies clichemacabremanuscripthit with a shovelcadillacrepeated linepost officedigging a gravereference to john waynehusband murders wifecornbreaking a mirrorfinger gunmississippihatchetsleeping on a couchthrown from a carplagiarismshort storytalking to oneselfmultiple personalitypaddlescrewdriverwriting on a walltimerfire enginebreakdownhit with a rockbracesnew york statebased on the works of stephen kinginsurance companydestruction of propertyseclusionlake houseinsurance investigatorhit on the head with a rockliterary agentmysterious eventupstate new yorkloss of petparcelreservoirfire pokerhickstory within a storyarthritisjack danielsmystery writercorn on the cobdelivery truckpounding on a doorrock thrown through a windowburying a dead dogisolatedreclusivenesscar goes over a cliffdestroying a roomburnt down houseslinkyupslunch counterpet doorneedlepointcattle dogincriminationpage torn from book (See All) |
After Iggy's long-time girlfriend is murdered and the whole town agrees he is the killer, he awakens one morning with horns and the townspeople soon confess their sins. Once knowing the sins of the people, he is facing the true killer of his beloved girlfriend.
| Subgenre: | supernaturalmurder mysteryurban fantasy |
| Themes: | supernatural powerdeath of daughterangerinvestigationreligionmurderdeathlovefriendshiprevengeinfidelityrapejealousydrunkennessdeath of mother …cancerillnessevilalcoholismcrueltytraumadevilpolice investigationmurder of a police officernear death experiencerape and murder (See All) |
| Locations: | hospitalbarchurchforestcemeterysmall townwoodspolice carsex outsidesex in a carsex in chaircar on firesex outdoorssex in woods |
| Characters: | little girlteenage girlpolice officergirldoctorfather daughter relationshipmother daughter relationshipteenagerfamily relationshipsfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationship …brother brother relationshipteenage boynursepolicemanmusicianpriestlawyerlove trianglechristianbest friendreference to godgay kisswaitressinterracial relationshipchristianityalcoholicchildhood friendyounger version of charactercheating girlfriendreligious fanaticdeath of girlfriendbetrayal by friend (See All) |
| Story: | drug overdosesleeping in a carcrying womancigarette smokingloss of daughterblood on facedollunderwater sceneimpalementdead bodysecretface slapcryingfirephotograph …based on novelflashbackviolencebloodfemale nuditymale nudityone word titlebare breastsfemale frontal nuditymale frontal nuditybare chested malesex scenefemale rear nudityfightinterracial sextitle spoken by charactermale full frontal nudityexplosiontopless female nudityvoice over narrationshot to deathshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewatching tvundressingbrawlletterliehallucinationhandcuffsreference to jesus christprayerreportergay slurnewspaperjournalistcandlestabbingcocainedinerstabbed in the chestsnakenonlinear timelineno opening creditsscantily clad femaleshot in the legnecklacetransformationbartendergunshotconfessionattempted murderpublic nuditydrug addictcursevirginbeaten to deathprotestperson on firestatueringscarhairy chestcrosswitnesscharacter says i love youloss of motherredheadcheating wifearsonterminal illnesstopless womancloseted homosexualrockanswering machineburned aliveaddictionheavy raingay characterdrugfriendship between menlistening to musicgroup of friendstold in flashbackcaught having sexdemonstrationmagazinevisitteddy bearfollowing someonecrying manpresumed deadpump action shotgunsevered fingerbreakupconfrontationunfaithful wiferejectionbroken glassjunkietaking a picturepolice officer shotfirst kissdeath of protagonistaccidental killingfriendship between boyswedding ringsuspectgasolinemale male kissbarefoot femaleinjusticechainriding a bicycleplaying pianoframed for murderseattle washingtonengagement ringsinbeing followedmale objectificationblood on camera lensbarking dogtaking a photographporn magazinecartoon on tvoutcastmolotov cocktailstuffed animalplaying poolrepeated scenehead blown offdoubtdrunken manpiano playingtemptationmale in underwearoutsiderdouble barreled shotgunhospital roommasturbation reference13 year oldexhibitionistgramophonereceptionistbare chested boywormstreet fightbitten in the neckman punching a womantaking off shirthandcuffedtopless girlconscienceurinatingtrumpetmurder suspectevil womancar set on firewatermelonmurder attemptmurder by gunshottreehousedance scenehiding placeriding a bikepitchforkseductive behaviormemorialrescue from drowningtaking off clothesundressing someonetraumatic experienceangstturkeydeath by gunshotburn victimsnake bitehouse on firepunch in faceimmolationdonutfinding a dead bodysex from behindcloseted gaymale male hugpointing a gun at someoneblasphemycrime of passionseductive womanwingsdrug triptitle spoken by narratorvinylman slaps womandaredrunken womanspoiled bratcrying malemoving outhysterical womandiscovering a dead bodyselfish womanhornlearning the truthburnreference to the rolling stoneshand injuryman hits womancharacter says i'm sorryvicarloss of girlfriendtalismanhysterical outburstdeath by shootingantiherotv crewbitten on the armbiblical referencesocial outcastblood on handscherrybreaking upspoiled childhomophobic slurmelonunfaithful girlfriendreference to david bowietrumpet playerpassed out drunkmorse codeoutburstsex at workfalse accusation of murderchildhood flashbackscreaming girlmurder disguised as suicideprivate investigationhit on the head with a rockmurder by shootingbitten in the facesleeping on the floorbrother brother conflictestranged motherupside down camera shotheavy smokerreference to nirvanahornstree houseasthma inhalerbanging head against wallsetting a fireterminally illgay coptalking about masturbationplush toymale female fightreference to jim morrisonangel wingssearch for truthgrieving fatherplaying trumpetspoiled girlbitten by a snakeadvocatepunch in stomachreference to the doorswingcrying for helpbrother brother fightgoodbye letterstabbed with a pitchforkdeath during sexfight between friendschristian fanaticgolf instructorattention seekerdelirium tremensoutdoors sexselfish motheramc gremlinchainletcherry bomb (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
| Subgenre: | supernaturalindependent filmcult filmsuspensetragedyparanormalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror |
| Themes: | supernatural powerpanicinvestigationfearsuicidemurderdeathlovesurrealismrapechristmasdeceptionpsychopathdeath of motherparanoia …blackmaildeath of wifeapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All) |
| Mood: | neo noirslasher |
| Locations: | tunnelcarhospitalschoolchurchsnowwheelchairpolice cartruckschool teacherfire truck |
| Characters: | little boypolice officerdoctorhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipteacherserial killernursephotographerbabyvillainpsychiatrist …snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All) |
| Period: | world war two1980s1970swinterseeing the future |
| Story: | premonitionlostvisionsacrificedrowningunderwater sceneflashlightf wordtelephonefalling from heightrescuedreamfiresurprise endingphotograph …based on novelbloodflashbackfemale nuditykisstitle spoken by characterexplosionchasepistolshootoutcorpseshot to deathblood splattercar accidentshot in the chestslow motion scenewatching tvbattlegunfightletterrifleheld at gunpointcar crashhandcuffsrevolverreportergood versus evilambulancemansionpoliticianstabbed in the chestman with glassesassassinationchild in perilpolice officer killednews reportmarriage proposalflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestcult directorpsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmanmaniaccold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomamutilationexploding buildingloss of wifepress conferencesevered handgrindhouseambitionpresumed deadrampagecrime scenemercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerbad guyteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant herohead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | supernaturalindependent filmcult filmcoming of agesuspenseconspiracyfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | supernatural powerpanicfearmurderdeathfriendshipsurrealismdrunkennessescapedancedeceptionvoyeurismbrutalityparanoiaillness …sadismevilunrequited lovecrueltyblindnessself sacrificemysterious death (See All) |
| Mood: | raingorenightavant gardeslasherdarknessstylization |
| Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
| Characters: | american abroadteenage girlpolice officergirlboydoctorteenagerfriendfemale protagonistteacherstudentsister sister relationshipkillerpsychiatristprofessor …witchgermanamericanself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
| Period: | 1970syear 1977 |
| Story: | cigarette smokinghearing voiceswhisperingblood on faceresearchfaintingmissing personlegendritualimpalementfoot chaseswimmingtelephonefalling from heightsecret …firesurprise endingdogviolencebloodflashbackone word titledancingexplosionknifechasetelephone callvoice over narrationcorpseblood splatterslow motion sceneshowdownbathroompianodemonhallucinationvoyeursubjective cameragood versus evilwineambushstrangulationstabbingdeath of friendthroat slittingstabbed to deathtoiletstabbed in the chestcoffinattempted murdercharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotcover upcollege studentlightningscreamhangingdisappearanceinjectionsuspicionmurdererfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody nosestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
A thought-provoking and haunting exploration of how reality and dream-states may combine to form complex interactions. The line between the imagination and reality blurs when an accomplished Psychiatrist takes on a patient that appears to be suicidal.
| Themes: | dyingguiltinvestigationghostsuicidedeathlovesurrealismdrinkingmemorydeath of fatherdeath of motherdepressionillnessmental illness …blindnesswritingforgivenessmadnessmurder of fathermurder of mother (See All) |
| Mood: | nightmarerain |
| Locations: | bathtubnew york citytraincemeterybicycletaxistrip clubtaxi driversuvcar fire |
| Characters: | artistboyhomosexualfather son relationshipmother son relationshipafrican americanboyfriend girlfriend relationshipstudentdanceractorbabyactresswaitresssecurity guard …psychiatristsecretarysheriffdoctor patient relationshipart studentself injuryart teacher (See All) |
| Story: | cigarette smokingdripping bloodlocked doorhearing voicespillskeylibraryunderwater scenedrawingtearsdreamcryingsurprise endingdogblood …flashbackone word titlegunkissdancingtitle spoken by charactershowertelephone callunderwearfoodcar accidentdrinkundressingpaintingrunningbirthdaycar crashbathroomneighborpianostrippersubjective cameraorphanambulancebridgeeatingsuicide attemptdinersubwaynonlinear timelinepainterbathmarriage proposalstorytellingreadingcollege studentlightningclassreference to william shakespearepsychicarsonblack americanchesshugginganswering machinesyringeballoonwoundhypodermic needlesurvivorpatientrehearsalart galleryfateanimal attackslavemental institutionpromisewhiskeywindnew jerseymedicationaquariumbookstorebalconyblind manbuddhismengagement ringman cryingreflectionnotebookrepeated scenespiral staircaselecturestairwaybrooklyn bridgewrist slittingmailboxmeat cleaverrazor bladebleedinggurneyreference to shakespeare's hamletcircular staircasepole dancershared bathdog attackloss of parentseyespsychosiswater fountainslide showreference to sigmund freuddance classmatchmakersuicide threatsnorricamwatching someonewriting on a walldeadlinepeep showcaught in the raingrand pianodeputy sheriffdog bitesketchinghand wounddiamond ringprescriptionacting classart studiofortune cookiewalruslecturerempty housefireplace pokerweathermanmeteorologyanimal bitehailstormchopsticks the eating utensilcigarette burndance rehearsalsparrowlecture halleyesightkey ringsketching a portraitxanaxwrist scartelling storystopping timeeating with chopstickstire blow out21st birthdaychinese carryout foodpiano movingscript readingtoreadormylar helium balloonforetellingknocking over a tablepsychiatric sessionreference to athena (See All) |
Miles of twisting catacombs lie beneath the streets of Paris, the eternal home to countless souls. When a team of explorers ventures into the uncharted maze of bones, they uncover the dark secret that lies within this city of the dead. A journey into madness and terror, As Above, So Below reaches de …ep into the human psyche to reveal the personal demons that come back to haunt us all. (Read More)
| Subgenre: | supernaturaltragedyfound footage |
| Themes: | panicgriefguiltinvestigationfearghostsuicidedeathmurderlovefriendshipescapeevilclaustrophobia |
| Mood: | darknessaffection |
| Locations: | tunnelchurchparis francenightclubcavemuseumcave in |
| Characters: | friendmysterious being |
| Story: | apparitionblood on faceresearchlegenddrowningmapflashlighttelephonefalling from heightsecretviolenceflashbackbloodtitle spoken by characterexplosion …telephone callcorpsecamerawritten by directorrunningpianodemonhallucinationsubjective cameravideo cameravanlooking at the cameratalking to the camerapoint of viewdangerscreamingperson on firescreamskeletondisappearancedarktrapropegoldundergroundburned alivetreasuredesperationcovered in bloodskullirananxietyhandheld camerahealinglens flarebroken armtourconfusionremorsepiano playingtombstoneold flamearcheologyfall from heightbitten in the neckhanged mantour guiderunarcheologistfrightgravestoneriskanguishriddleangstscarebonerelicchurch bellhooded figurescreaming in feardigital camerahidden doorshaky camalchemyburning carperilobscurityscreaming in horrorevil forcemanholewet jeanshealing powerinfernounderground tunnelmysterious noisecatacombevil beingportal to helldark forcespelunkingtemplar knightsoaked clothessupernatural forcearamaicfemale archeologistgate of hellrosetta stone (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | supernaturalcult filmparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | supernatural powerpanicfearghostdeathmurderfriendshiprevengesurrealismkidnappingescapemonstervoyeurismpsychopathbrutality …paranoiasadismevilmysterious deathshower murder (See All) |
| Mood: | nightmareraingorehigh schoolslasherdarknesspoetic justice |
| Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
| Characters: | little girlteenage girlgirlboyfather daughter relationshipmother daughter relationshiphusband wife relationshipteenagerfamily relationshipshomosexualfather son relationshipmother son relationshipfriendboyfriend girlfriend relationship …brother sister relationshipteenage boyteacherserial killerstudentpolicemankillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | cigarette smokinglocked inwet clotheslocked doorhearing voicesblood on faceback from the deadratdiarylegendimpalementfoot chasef worddead bodyface slap …dreamcryingfiresurprise endingviolenceblooddogcharacter name in titlenuditynumber in titlemale nuditysequelmale rear nuditybondagebare chested malefightpartyknifechaseshowertelephone calldigit in titleunderwearblood splattershotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titleneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalsubjective cameraname in titlemassacrestabbingbasketballfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditystabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamconvertiblegymhigh school studentexploding bodybasementmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mmale underwearfull moonrampagedamsel in distressseriesunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upsnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlebreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
John Murdoch awakens alone in a strange hotel to find that he has lost his memory and is wanted for a series of brutal and bizarre murders. While trying to piece together his past, he stumbles upon a fiendish underworld controlled by a group of beings known as The Strangers who possess the ability t …o put people to sleep and alter the city and its inhabitants. Now Murdoch must find a way to stop them before they take control of his mind and destroy him. (Read More)
| Subgenre: | cult filmblack comedysuspenseconspiracydystopiacyberpunkaustralian fantasyaustralian science fictionaustralian horrortech noir |
| Themes: | supernatural powerguiltinvestigationsuicidemurderdeathsurrealismkidnappingmarriageescapedeceptionmemoryextramarital affairparanoiainsanity …amnesiaself sacrificemurder investigationpolice investigationunlikely heroalien abduction (See All) |
| Mood: | neo noirnightdarknessaustralian supernatural |
| Locations: | waterbathtubbeachhospitalbarrestaurantswimming poolhotelbusnightclubtaxiwheelchairurban settingapartmentpolice station …outer spacespacetaxi driverlaboratoryspace stationfire escape (See All) |
| Characters: | little girldoctorhusband wife relationshippolicesingerprostituteserial killeraliendetectivehostagepolice detectivepsychiatristuncle nephew relationshippolice chaseevil alien …running from police (See All) |
| Period: | 1940sfuture |
| Story: | cigarette smokingunderworldlostjumping from heightratsuitcasekeydrawingmapimpalementold manfoot chasetelephonefalling from heightrescue …dreamsurprise endingphotographviolencebloodflashbackfemale nuditymale nudityfemale frontal nudityinterviewmale rear nuditykissfightexplosionknifechasevoice over narrationcorpseblood splattercar accidentshot in the chestpunched in the facewritten by directorarrestbare buttshowdownrifleheld at gunpointinterrogationcaferevolverscientistsubjective camerathroat slittingstabbed in the chestsubwayfalse accusationanti herodouble crosspolice officer killedcigar smokingon the runduelcharacter repeating someone else's dialogueelectrocutionfugitivecharacter's point of view camera shotlightninginjectionfemale removes her clothesexploding bodythreatened with a knifelove interestexperimenteavesdroppingidentityfalling down stairssabotagesyringedestructionrevelationflyingwarehousehypodermic needlegothicarchitectureexploding buildingfemale singervirtual realityproduced by directormind controlcrushed to deathclockcamera shot of feetcrime scenehaunted by the pastchaosplot twistrowboataquariumframe uptime lapse photographyexploding headsoulalternate realitywedding ringpierpassionate kissexistentialismpolice inspectornude woman murderedtelekinesisdaggernewspaper clippingsymbolismuncletelepathyclose up of eyesmemory losslighthouselevitationbrainwashingex coppostcardspiral staircasewalletidealismharmonicabillboardsleephanging upside downgoldfishpocket watchforeplayhand over mouthbusiness cardstabbed in the shoulderfight the systemmicroscopespasubterraneanwaking upmind readingfingerprintforce fieldglowing eyestrenchcoatalien racebarber shopstairwellthroat cutman in a wheelchairevil childhit by a traindeja vufalling through the floormidnightsnowglobezero gravityel trainhuman experimentationsubconscioussecret passagewaycandelabraalbinoapplying lipstickstopwatchindividualitysledge hammeranti conformitydreamerfalse memorystabbed in the foreheadexplosive decompressionindividualismalien possessionnewsstanderased memoryfighting in the airpsychokinesisexposed brainvirtualitysplit headburn scargerman expressionismlovecraftianalien parasitefishbowlslideshowbead curtainintroductionstopped timealien spaceshiphuman guinea pigmale in a bathtubdream realityfloating in spacepicture bookspiralimplanted memoryman in blackdriving licencetest tubekey ringsimulated realityurban gothicfish bowlfloating citybinocular microscopemindbenderbrain in a vatwaking up someonemind over matterdeep sleepnewspaper standrunning down stairshermetic worldknife murdererplaying accordianexpress trainknocking a hole in a wallpossessed corpse (See All) |
It hasn't even been a year since a plantation owner named Louis lost his wife in childbirth. Both his wife and the infant died, and now he has lost his will to live. A vampire named Lestat takes a liking to Louis and offers him the chance to become a creature of the night: a vampire. Louis accepts, …and Lestat drains Louis' mortal blood and then replaces it with his own, turning Louis into a vampire. Louis must learn from Lestat the ways of the vampire. (Read More)
| Subgenre: | cult filmblack comedylgbt horror |
| Themes: | supernatural powerguiltangerfearmurderdeathrevengebetrayalescapetheatremurder of family |
| Mood: | raingorenightdarkness |
| Locations: | watercarhelicoptercemeteryparis francepolice carfrancesan francisco californiaamerica |
| Characters: | little girlamerican abroadartistboyfather daughter relationshipprostituteactorvampireamericanvampire girlsame sex parents |
| Period: | 19th century20th century18th century1870s |
| Story: | ritelostratdolllibraryritualdead bodyrescuecryingfiresurprise endingbased on novelbloodviolencenudity …interviewdancingsingingpistolvoice over narrationcorpsehorsemirrormaskrunningbedpianodecapitationgood versus evilorphancandleweaponanimalcoffintreedangercostumescreamingcharacter's point of view camera shotpianistautomobileneck breakingcinemaundeadchild murderdestinydressgothicslow motiontape recorderlifting someone into the airhatslaverywatching a moviebuttocksblockbusteraudiencetorchslavenew orleans louisianaimmortalitytheatre audiencestairsswampdark herosundead childshadowhomoeroticismhorse and carriagelaughingvoodooplaying cardsreflectionvictorian erastage showyellingtablelouisianaglovesplaguefemale vampirechandelieraudio cassetteteethgolden gate bridgemind readinghouse firescytheliquidplantationsailing shipcurtaincustomsittinglifting female in airwoman's neck brokensexual innuendopoodlesliced in twocmnfbisexual mantwilightcandelabralifting male in aircarrying someonelifting an adult into the airclothed male naked femaleeroticismcmnf scenepleadingvampire human lovemarquee1790sbisexual malesiren the alarmdangerous friendmississippi rivergrand guignolgeorgian erachild vampireburial at seamonster as victimgirl in dangercostume horrorvampire driving a carreference to river phoenixtheater audiencetheater curtaindancing with dead body (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
| Subgenre: | supernaturalcult filmblack comedyconspiracy |
| Themes: | supernatural powerpanicfearmurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyescapewedding …deceptionseductionrobberypsychopathbrutalityparanoiaredemptionsadismunrequited lovepolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
| Mood: | gorecar chaseslasherpoetic justice |
| Locations: | waterbathtubhotelcemeterykitchenpolice stationpolice carroad tripmotel |
| Characters: | teenage girlpolice officertattooteenagerhomosexualpoliceboyfriend girlfriend relationshipteenage boyserial killerdetectivepriesthostagethiefpolice detective …maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
| Period: | 1990s |
| Story: | cigarette smokingblood on faceback from the deadfireplaceratdollritualdrawingimpalementflashlightf wordtelephonedead bodyrescuecrying …firesurprise endingphotographviolencebloodsexcharacter name in titlesequelbare chested malegunkissfightknifechasepistolcell phonebeatingcorpseshot to deathblood splattercar accidentmirrorshot in the chestslow motion scenewatching tvbare buttlettershowdownheld at gunpointrock musiccar crashmarijuanahandcuffsrevolverorphanambushstrangulationmansionmontagethroat slittingbridgestabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffinhit by a cardouble crosspolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timeknocked outbaseball batlightningskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagehead buttgothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killermale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseymisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
A small, seemingly innocuous plastic reel of film leads surveillance specialist Tom Welles down an increasingly dark and frightening path. With the help of the streetwise Max, Welles relentlessly follows a bizarre trail of evidence to determine the fate of a complete stranger. As his work turns into … obsession, he drifts farther and farther away from his wife, family and simple life as a small-town private eye. (Read More)
| Subgenre: | cult filmsuspenseconspiracyfish out of waterpsycho thriller |
| Themes: | death of daughterpanicobsessionangerinvestigationtorturefearsuicidemurderdeathrevengekidnappingmoneybetrayalprison …escapefilmmakingdeceptioncorruptionpsychopathbrutalityparanoiasadismsurveillanceevilhome invasionhollywoodcruelty (See All) |
| Mood: | neo noirdarkness |
| Locations: | hospitalnew york citybarswimming poolcemeterylos angeles californiabustaxiairportwheelchairmotelstrip clubbrothelfire truck |
| Characters: | tattoohusband wife relationshipprostitutedetectivebabyhostagelawyerfilm directorpimp |
| Period: | 1990s |
| Story: | microfilmcigarette smokingunderworldloss of daughterheadphonesdiarymissing personlibraryimpalementfoot chasef wordtelephonefalling from heightfiresurprise ending …photographviolencebloodsexfemale nuditynumber in titlemale nuditymale frontal nuditymale rear nuditybondagebare chested malegunfemale rear nudityfightfemale full frontal nuditynipplestitle spoken by charactermale full frontal nudityknifechasepistoltelephone callcell phonebeatingcorpsedigit in titleshot to deathblood splatterfistfightshot in the chestpunched in the facebrawlbare buttmasklettershootingshowdownheld at gunpointsunglassesinterrogationprostitutioncriminalstrippershot in the backgay slurbound and gaggedstrangulationambulancemansionthroat slittingwidowstabbed to deathprisonerstabbed in the chestman with glassesnundisarming someoneacronym in titledouble crosslimousinebinocularsbeaten to deathdangerstabbed in the backsuburbperson on firepay phoneundercovercover upevil mankicked in the facelightningshot in the shoulderbodyguardthreatpremarital sexcharacter says i love youthreatened with a knifesilencerarsonrunawayprivate detectiveeavesdroppingpornographyuzianswering machineundergroundburned aliverevelationheavy raintape recordersociopathscene during opening creditssexual abuserecordingstabbed in the stomachhollywood californiakicked in the stomachvideotapedesperationsadomasochismbrooklyn new york cityfaked deathhomicidemasked manmechanicduct tape over mouththugcrossbowcynicismhatredkickingstabbed in the neckmiami floridabutlersenatorpunched in the chestsafethrown through a windowbookstoreknife fightfilm producerrainstormgasolineburned to deathmasked killerprivate investigatorsouthern accentdead girlimpersonating a police officerpervertabandoned buildingmysterious mansidekickporn magazineshot in the neckpistol whipvideo storepictureporn industrybrooklyn bridgesexual perversionfilm projectormasochismclimbing through a windowdegradationmessagebody in a trunkpornographercrashing through a windowsnuff filmpalm treekicked in the headstabbed in the shoulderfilmed killingdecadencegarbage truckknife murderwatching a videosex shopprivate eyecleveland ohiocriminal investigationabandoned warehousewiretappingguillotinedepravityvinylred light districtmistreatmentsuper 8mmsexual sadismsexual torturesexual crueltyfilm reelporn directorvideotaped sexfiendviolent sexwall safepornographic videodeviant sexunusual sex act8mmpainful sexporno shopsadomasochism clothingback alleyadult bookstoregimp maskhall of recordsmeat processing plantharrisburg pennsylvania (See All) |
This is the story of three well-meaning but flawed people: Paul Rivers, an ailing mathematician lovelessly married to an English emigre; Christina Peck, an upper-middle-class suburban housewife, happily married homemaker with two young daughters, with hiding a secret past; and Jack Jordan, an ex-con …vict who has found in his Christian faith the strength to live a law-abiding life and raise a family. They will be brought together by a terrible accident that will change their lives. By the final frame, none of them will be the same as they will have learnt harsh truths about love, faith, courage, desire and guilt, and how chance can change our worlds irretrievably, forever. (Read More)
| Subgenre: | independent filmsuspensetragedymelodrama |
| Themes: | death of daughterdyinggriefguiltangerreligionsuicidemurderdeathloverevengemarriageinfidelitydrugsbetrayal …adulteryprisonpregnancydrinkingdrunkennessextramarital affairlonelinessdeath of motherdrug useredemptionunfaithfulnessillnessfaithalcoholismhopeabortionvengeancedrug addiction (See All) |
| Mood: | rain |
| Locations: | hospitalbarrestaurantchurchswimming poolsnowdesertbicyclepolice carmotelsuvcar theftnew mexico |
| Characters: | little girllittle boyboytattoodoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipteenage boyteachernurse …policemanlawyersister sister relationshipreference to godbibleprofessorsheriff (See All) |
| Story: | cigarette smokingloss of daughterpillscaucasianunderwater scenedrawingswimmingtearsvomitingsecretface slapcryingphotographtwo word titleflashback …bloodfemale nuditynumber in titlemale nudityfemale frontal nuditymasturbationmale rear nuditygunkissnipplessingingpartyknifepantiespistoltelephone callvoice over narrationfondlingcell phonebeatingcorpsedigit in titleunderwearfoodcar accidentwatching tvcomputerdrinksex in bedshootingbirthdaycafebathroomjailvoyeurreference to jesus christprayerrevolvercleavagebreast sucklingambulancebasketballwidowcocainesuicide attemptdinerprisonertoiletaccidentnonlinear timelinebirdhit by a carbirthday partylatex glovespaingunshotflash forwardattempted murderdrug addictmicrophoneumbrellahangingscarcrossdeath of husbandex convicthandgunobscene finger gesturetherapyheart attackprivate detectivepickup trucksurgerybirthday cakepoemgolfmedicinehypodermic needleslow motionsexual attractioncomapatientdrug abusearchitectbuttockslosstimeguardministermourningdespairmedical examinationevidenceheartthirty somethingmarital separationprison cellred pantiesbowlingloss of husbandrelease from prisonsirensymbolismhit and runsaving a lifehysteriamultiple storylinestoredinner partyplaying poolphysicianlightermathematicsclinicnewspaper articlestonedinfertilityreverendbleedingmonitorgolf coursewakeallergywashing machineartificial inseminationswimmericonschizophrenicprivate eyemortalityfanaticasphyxiationliquor storenightgownmercyhamsterbedriddenfired from a jobwashingexaminationheart transplantrecovering alcoholicjoke tellingmathematicianpityorgan donationoxygen tankspeeding vehicleheart surgerychocolate barporn videoorgan donorrafflejail visitationbarbed wire fencehummingbirdorgan transplantationrefusing to eatheart failuresmall time crookketamineshot in sequenceborn againleaf blowerstepping on glasscutting selfracket ballheart donorsuicide attempt by hangingsports clubcutting armflatliningracquetskull fractureaccidentally shooting oneselfwork detailmouth sprayorgan rejection (See All) |
The pediatrician Alexandre Beck misses his beloved wife Margot Beck, who was brutally murdered eight years ago when he was the prime suspect. When two bodies are found near where the corpse of Margot was dumped, the police reopen the case and Alex becomes suspect again. The mystery increases when Al …ex receives an e-mail showing Margot older and alive. (Read More)
| Themes: | griefguiltobsessioninvestigationtorturesuicidedeathmurderlovefriendshipkidnappinginfidelityrapepoliticsadultery …drinkingescapeweddingvoyeurismmemoryextramarital affaircorruptiondeath of fatherblackmaildrug useunfaithfulnesssurveillancedeath of wifeforgivenesspolice brutalitymurder investigationpolice corruptionmysterious deathmurder of father (See All) |
| Mood: | night |
| Locations: | hospitalbarrestaurantforestparis francebusairportelevatorwoodspolice stationpolice carfrancelakerooftop |
| Characters: | police officergirlboydoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipfriendbrother sister relationshipserial killernurse …detectivepolicemanphotographerbabylawyerwaitresskillerfrenchamericanpolice chasechildhood friendcoronerfather in law son in law relationshipmother in law son in law relationshipboy girl kiss (See All) |
| Story: | driving a carcigarette smokingcigarettedivinginjuryratmissing personkeysearchswimmingtelephonedead bodytearssecretface slap …cryingphotographbased on novelviolencedogbloodflashbackfemale nuditynuditymale nudityfemale frontal nuditymale frontal nuditymale rear nuditybare chested malegunfemale rear nudityfightfemale full frontal nuditymale full frontal nuditylesbian kisschaseshowertelephone callcell phonebeatingcorpseshot to deathunderwearfoodhorsecar accidentmirrorshotgunslow motion scenepunched in the facewatching tvcomputercameradrinkarrestundressingbare buttshootinglieriflerunningcafejailvoyeurmale pubic hairrevolvershot in the backsubjective cameracleavagegay slurnewspapervideo cameramansioneatingfemale pubic hairinternetnonlinear timelinefalse accusationapologyman with glassesscantily clad femalecoffinassassinationforeign language adaptationvanlatex glovesflash forwardconfessionparkskinny dippingsmokingbinocularsprologuecover upbaseball batfemale full rear nuditylong takegymdisappearancepursuitcountrysidedeath of sonthreathorse ridingsadnesssuspicionmurderertied upflowerhandguntypewritergraffitiheroinapplausetv newsbow and arrowrevelationred dresswalkie talkieloss of loved onedrug abusehidingloss of wifedesperationfaked deathstreet lifeclockhomicidepresumed deadpassportretirementcamera shot of feetphoto shoothaunted by the pasttensioninnocencesurveillance cameraplaygroundmourningburglarylesbian coupleautopsye maildeerhighwaycellphonesuspectpolice raidduckbruisenude woman murderedbenchsports cartan linechildhood memoryframed for murderdead dognude swimminganniversaryhandshakedark secretcremationstreet gangrepeated sceneabuse of powerstairwaystreet marketbitternessgun held to headframedtraffic jamfemale lawyermale rapehired killernude girlfallingscene of the crimeplaying a video gamednastableemergency roominsurancebody bagnaked dead womandocumentmurder of wifemultiple murderhitchcockiancircular staircasedead catanguishwoman undressingchild rapecriminal investigationtreadmillclimbing out a windowfinding a dead bodysurveillance footageintercomtelephone numbertrophy wifecrotch shotapple computerfemale in a showerstun gunhand kissingpocket knifealibistreet kidwife abusesafe deposit boxman undressingpokiesperjurydoor bellwood carvingequestrianransackinghitting a womanphoto studiosidewalk cafeaudio recordingbroken windshieldblood sample911 callwalking a dogwall safeinternet cafewiretapdead body in a car trunki.d.pediatricianbox cutterchildhood lovearm injuryprime suspectinsurance policyhemophiliahorse jumpingplanted evidencewatching a video on a computergarbage dumpsterbreaking a glassbluffingslipping and fallingwife beatingbandstandhorse stableidentifying a dead bodybody in a car trunkhunting accidentparisian outskirtsballisticsstreet riotoff screen suicidecar pileupcomputer storehiding in a dumpsterstate senatorcomputer searchhunting trophymounted deer headautopsy reportflower deliverymidnight swimdna sampledragged by hairheroin userinternal bleedingparc monceau paris (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int …ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
| Subgenre: | cult filmblack comedysuspensetragedymedicalpsychological thrillerpsychological horror |
| Themes: | supernatural powerafterlifepanicguiltfearsuicidedeathrevengesurrealismbetrayalescapememorydeath of fatherparanoiaredemption …bullyingcrueltychildhoodtraumavengeancedrug addictionforgivenessnear death experienceregretchildhood traumasuicide of father (See All) |
| Mood: | nightmareneo noir |
| Locations: | hospitaltrainschoolforestsnowcemeterywoodsurban settingapartmenttruckchicago illinoismuseumlaboratory |
| Characters: | little girllittle boygirlboydoctorfather daughter relationshipafrican americanboyfriend girlfriend relationshipchildrensoldiernursebullywaitressfiance fiancee relationshipsuicide by gunshot …self surgerystudent nurse (See All) |
| Period: | 1990s |
| Story: | cigarette smokingscalpelvisionback from the deadimpalementflashlightfoot chasef wordtelephonefalling from heightrescuecryingsurprise endingphotographflashback …blooddogsexone word titlebare breastsbare chested malekissinterracial sextitle spoken by characterpartyknifechasepistoltelephone calltopless female nuditybeatingcorpseshot in the headslow motion scenepunched in the facewatching tvbedbathroomhallucinationsciencesubjective camerahalloweenmountainvideo cameramansionmontagedinersubwayapologyman with glassesgraveyardcigar smokingmarriage proposaltreedrug addictbeaten to deathdangerscreamingpay phonecharacter's point of view camera shotrace against timestatuedeath of childbaseball batcollege studentuniversityhalloween costumelong takemanipulationscaramerican flaginjectiontragic eventdeath of husbandloss of fatherpremarital sexcharacter says i love youheroinfreeze framesurgeryhugginganswering machinesyringerevelationelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorcaketape recorderwoman with glassesgroup of friendsvideotapeaccidental deathphone boothwomanizercrushed to deathreverse footagehaunted by the pastplaygroundattempted suicidepower outagegash in the facepunched in the stomachresurrectionconvenience storejunkietaking a picturefalling to deathkicked in the crotchblack and white scenepunched in the chestengagementautopsyaccidental killingaerial shotswingfemale doctorinsultlooking at self in mirrordead boyfieldloss of husbandsurgeonhalloween partymoral dilemmachildhood memorypromiscuityatheistfast motion scenehit with a baseball batclose up of eyesintestinesreference to elvis presleyvietnam veteranalleyspit in the faceremorsename callingbully comeuppanceyoung version of characterclimbing through a windowbroken mirrorteasinggreenhousemedical studentbiologyfrankensteinexperiment gone wronghome videocamcorderoperationmenacehuman experimentheroin addicthoodieswingingbrain damageanimal killingscience runs amoktrenchcoatmedical professionmedical experimentrenovationanswering machine messageel trainfall to deathjumping roperepressed memorycadavercprmedical schoolred lightdefibrillationdefibrillatorvideotaped sexdying womanhit with a rockskeleton costumeremadepickaxefalling from a treescience experimentdissectionhockey stickout of body experienceneondumped by girlfriendsecret laboratorybelief in the afterlifehorror movie remadeadrenalinebullet holeconfettichildhood flashbacksplit lipswing setinside the mindvirtualitythrowing a rockmullet haircutescalationhopscotchtambourinegrade schoolnitrous oxidepathologybreaking up with boyfriendplaying godtrailer narrated by don lafontainepickup linesecret filmingwelcome home partyblue lightmedical examurban gothicbrain deadfighting with selfsweatshirtwounded dogred hoodpicture of jesusstitching one's own woundreligious imagery (See All) |
In Pasadena, Mrs. Davis sends her daughter Aubrey Davis to Tokyo to bring her sister Karen Davis, who is interned in a hospital after surviving a fire, back to the USA. After their meeting, Karen dies and Aubrey decides to investigate what happened to her and gets herself trapped in the same situati …on, being chased by the ghost of the house. Meanwhile in Tokyo, the three high school mates Allison, Vanessa and Miyuki visit the famous haunted house and are also chased by the ghost. In Chicago, Trish moves to the apartment of her boyfriend Bill, who lives with his children, the teenager Lacey and boy Jake. On the next door, weird things happen with their neighbor. (Read More)
| Subgenre: | ghost story |
| Themes: | supernatural powerangerfearghostmurderdeathrevengemysterious death |
| Mood: | high school |
| Locations: | rural settingbathtubhospitaltrainvillagejapancitychicago illinois |
| Characters: | little boyteenage girlpolice officerboymother daughter relationshiphusband wife relationshipteenagerfamily relationshipsfather son relationshipteachernursestudentterrorstepmother stepson relationship |
| Story: | spiritdiarydrowningritualfalling from heightfiresurprise endingphotographflashbacknumber in titlesequelpantiestelephone callcell phonecorpse …mirrorurinationwatching tvcatcondomsecond partclassroomgood versus eviljournalistbracurseneck breakingschoolgirlhaunted housepsychicbreaking and enteringgothicphone boothdead womantokyo japanpastdead childdeath of sisterdead woman with eyes opennewspaper clippinggothreturning character killed offphysicianaltered version of studio logoloss of sisterkiller childdarkroomvideo cassettewoman's neck brokenevil childdead woman on groundinter culturalremake by original directordefenestrationpasadena californiawraithurinating in fearfamily violencefemale urinatingestranged family memberrecords (See All) |
In Tokyo, Shigeharu Aoyama is a widower that grieves the loss of his wife and raises his son Shigehiko Aoyama alone. Seven years later, the teenage Shigehiko asks why his middle-aged father does not remarry and Shigeharu meets his friend Yasuhisa Yoshikawa, who is a film producer, and tells his inte …ntion. However, Shigeharu has difficulties to approach to available women to date and Yasuhisa decide to organize a sham audition for casting the lead actress for the fake movie. They receive several portfolios of candidates and Shigeharu becomes obsessed by the gorgeous Asami Yamazaki. Despite the advice of the experienced Yasuhisa, Shigeharu calls Asami to date and he falls for her. But who is the mysterious Asami? (Read More)
| Subgenre: | independent filmcult filmpsychological thrillersadistic horror |
| Themes: | abusegriefobsessionangertorturefeardeathmurderfriendshipsurrealismmarriagedrinkingdivorcelonelinesspsychopath …death of motherparanoiadrug usedatinghumiliationsadismcrueltydeath of wifestarvationreligious cult (See All) |
| Mood: | nightmarerain |
| Locations: | beachhospitalbarrestauranthotelelevatorwheelchairjapansearooftop |
| Characters: | little girllittle boyteenage girlboydoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipfriendboyfriend girlfriend relationshipteenage boynursedanceractress …japaneseolder man younger woman relationshipfathersingle fatheruncle niece relationshipaunt niece relationshipself destructivenessstepfather stepdaughter relationship (See All) |
| Period: | 1990s |
| Story: | child abusecigarette smokingritepet dogmissing personsearchold manfoot chasetelephonevomitingdreamphotographbased on noveldogflashback …violencebloodsexfemale nuditynudityone word titlefemale frontal nudityinterviewbare chested malekissdancingnipplestitle spoken by charactererectionpantiestelephone callcell phoneunderwearmirrorwatching tvcomputerdrinkundressingliebeerbedcafepianohallucinationsubjective cameradecapitationbedroombraconcertstrangulationvideo cameraambulancesuicide attemptfishdinnersevered headfishingtonguecontroversyfemme fatalemarriage proposalcoffeebartenderpaintrainingflash forwardbusinessmanwidowerliarumbrellaauditionscreamscarpianistdisappearanceinjectiondateballetdismembermentfalling down stairssyringekilling an animaldesirehypodermic needlelooking at oneself in a mirrorhappinessmutilationoverallslosssadomasochisms&mtokyo japansufferingsevered fingersonco workerscissorsschool uniformlaughterpedophilefilm producerperversionstabbed in the eyehousekeeperroommisogynyplaying pianodead dogceremonypiano playerpervertvideo tapewifeneedleparalysiskilling a dogmen's bathroomstairwaysubtitlesstepfathersexual perversionfemale psychopathmasochismtraffic jamyoung womanhusbandpiercingunhappinessballerinadruggedamputationlollipopmissingbleedingfilm productionbody bagextreme violencemurderesswoman in a bikiniscriptwoman undressingscreenplayflashback within a flashbacksevered footbroken neckgrindhouse filmbody partremarriageballet dancerman in a wheelchairtelephone numbermiddle aged manpassing outbedriddenparallel worldsevered eargarroteburnweirdoacupuncturepneumoniafemalespiked drinkleg bracesevered tonguegolf ballclose up of mouthrecord companydance studioincensewashroomagonyrubber glovesbeaglemystery womanshorelineburn scarcasting callsackpushed down stairspaleontologistreference to julia robertsreference to katharine hepburnresumeyogurtvoice over readingballet dancingballet shoesdioramasit inupright pianocamera shot of a woman's legsjob applicantforebodingclinking glassesmace spraymissing fingerspasmpiano wireclothes cut offmissing limbbaton twirlerbody in bagrod and reeltongstuning forkbroken collarboneburning oneselfawakened by a phonefoot amputationnegativismturning self in to the policefake auditionpracticing golfpretty woman (See All) |
After winning a custody battle for her daughter, Yoshimi tries to make a new start. The apartment she moves into seems perfect at first. Soon though, strange things begin happening. Huge water stains appear on the ceiling and drip constantly, more liquid oozing into the rooms every day. She calls th …e landlord in but he refuses to do anything about it. A child's red bag shows up in odd places and soon the child herself starts appearing. Yoshimi then discovers the origin of the ghost... (Read More)
| Subgenre: | asian horror |
| Themes: | supernatural powerfearghostmarriagedivorcemissing child |
| Mood: | nightmarerain |
| Locations: | waterbathtubtrainschoolbustaxielevatorapartmentrooftopnew apartment |
| Characters: | little girlteenage girlmother daughter relationshipfather daughter relationshiphusband wife relationshipchildrenteacherstudentlawyersister sister relationshipdaughteraunt niece relationshipparent child relationship |
| Period: | 2000s |
| Story: | cigarette smokingdrowningdrawingflashlighttearscryingbased on novelflashbackfighttelephone callcell phoneclassroomsubjective camerabathflash forward …screamingattackumbrellaringdarkclassanswering machineslow motionapartment buildingsurveillance cameraschool uniformbuildingbrushing teethlandlordposterdead girlschool principalchild custodysurrogate mothersleepwalkinghide and seekfloodingtalking to selffamily abandonmentkindergartenwater towerraincoatcustody battleremadesparklerrepairmanmoving vanhorror movie remadehearing noiseswater tankfootstepsdripping waterstrange noisestainskippinglost and foundhumiditypsychiatric treatmentproofreadingproofreaderschool bagapartment managerwater stain (See All) |
Curtis, a father and husband, is starting to experience bad dreams and hallucinations. Assuming mental illness, he seeks medical help and counseling. However, fearing the worst, he starts building an elaborate and expensive storm shelter in their backyard. This storm shelter threatens to tear apart …his family, threatens his sanity and his standing in the community, but he builds it to save his family's life. (Read More)
| Themes: | panicobsessionfearfriendshipmoneydrinkingdeath of fatherparanoiaillnessmental illness |
| Mood: | nightmarerainambiguous endingatmosphere |
| Locations: | beachchurchsmall towngas stationstorm |
| Characters: | little girldoctormother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipafrican americanfriendchildrenbrother brother relationshipbabyreference to godpsychiatrist …employer employee relationshipgrandmother granddaughter relationshipgrandfather granddaughter relationshipdeafness (See All) |
| Period: | year 1986year 2011 |
| Story: | drug overdosesleeping in a carlocked doorpremonitionwhisperingpillskeylibraryflashlightf wordtearsvomitingface slapdreamcrying …photographdogfightknifeshowertelephone callunderwearfoodcar accidentmirrorurinationpunched in the facedrinkbookbeerhallucinationreference to jesus christclassroomsubjective cameracookingambulanceeatingapologybirdpainargumentfired from the jobvacationreadinglightningbanksuspicioncharacter says i love yousleepingblack americanpickup truckdisastertv newshuggingsupermarketswimsuitvisitladderschizophreniabreakfastgas maskwatching televisionwindthunderboxer shortsshoppingshovelco workerdelusionmedicationlooking at self in mirrorlanternfieldnervous breakdownsirensign languageweatherholding handscrowbarking doglevitationimperative in titleconstruction workerohiofencestreet marketlooking out a windowtornadoseagullloanparamediccloudsoupsense of smellinsuranceseizurecrazinessbackyardfilling stationwashing machinedead birdsleeplessnessdog attacksnoringpanic attackhardware storewrenchcerealcloudsrearview mirrorwheelbarrowbatteryblue collaroxygen maskpadlockhard hatcounselorembroiderybreaking a car windowtalking to an animalfireflylanguage learningsedativekiss on the foreheadpickaxeworryingbed wettingflea marketswarmwatching news on tvfly the insectjackhammerprescription drugsmysterious eventcrayonhealth insuranceodorslidesandcastlebird attackcolumbus ohiodoghousebolt upright after nightmarecanned foodbank loancat scandeaf childrestlessnesswindshield wiperlibrary booksix year oldfor sale signdeaf girlhole in the ground35 year oldbackhoedrillingearth movercotdog cagescrambled eggsgenetic disordercochlear implantsore throatconstruction foremanassisted living facilityoverturning a tablestorm cellarbuilding a sheltergasping for breathrunning latestorm sheltercanton ohiodrilling site (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com