Please wait - finding best movies...
When Thad Beaumont was a child, he had an operation to remove a tumour from his brain. during the operation, it was discovered that far from being a tumor, the growth was a twin brother of Thad's that never developed. Years later, Thad is a successful author, writing his serious books under his own β¦name, and his pulp money-makers under the pseudonum "George Stark". When blackmailed by someone who has discovered his secret, Thad publically "buries" George Stark. From that point on, Thad increasingly becomes the prime suspect in a series of gruesome murders. (Read More)
Subgenre: | independent film |
Themes: | blackmailsupernatural powerghostmurder |
Locations: | new york city |
Characters: | police |
Story: | straight razorbird attackprotagonist and antagonist played by same actorhole in handsparrowevil twinchrysler building manhattan new york citybrain tumorpencilmainealter egorazordual rolelightereye gouging β¦kicked in the crotchstabbed in the throatplanereverse footageanimal attacksurgeryskeletonauthorgraveyardbirdthroat slittingambulanceflashlightmanhattan new york citybookcatdreambased on novelgun (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
Subgenre: | independent film |
Themes: | blackmailsupernatural powermurder |
Locations: | new york city |
Story: | straight razorrazoranimal attackgraveyardflashlightmanhattan new york citycatdreambased on novel |
After discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre ocurrences happen and the group becomes trapped inside the ship, which they soon learn is inhabi β¦ted by a demonic creature. (Read More)
Themes: | supernatural powerghostmurder |
Story: | straight razorstabbed in the throatskeletonthroat slittingambulanceflashlight |
Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh β¦ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)
Themes: | murder |
Characters: | police |
Story: | stabbed in the throatauthorthroat slittingambulanceflashlightbook |
Dr. Constance Petersen (Ingrid Bergman) is a psychiatrist at Green Manors mental asylum. The head of Green Manors has just been replaced, with his replacement being the renowned Dr. Anthony Edwardes (Gregory Peck). Romance blossoms between Dr. Petersen and Dr. Edwards but Dr. Edwards starts to show β¦odd aversions and personality traits. It is discovered that he is an impostor, and amnesiac, and may have killed the real Dr. Edwardes. Dr. Petersen is determined to discover the truth through unlocking the secrets held in the impostor's mind, a process which potentially puts her and others' lives at risk. (Read More)
Themes: | murder |
Characters: | police |
Story: | straight razorrazorsurgeryauthormanhattan new york citybookdreambased on novel |
1000 feet below the ocean, navy divers discover an object half-a-mile long. A crack team of scientists are deployed to the site in Deepsea Habitats. What they find boggles the mind as they discover a perfect metal sphere. What is the secret behind the sphere? Will they survive the mysterious 'manife β¦stations'? Who or what is creating these? They may never live to find out. (Read More)
Themes: | supernatural powermurder |
Story: | animal attackskeletonflashlightbookdreambased on novel |
On his birthday, Walter Sparrow, an amiable dog-catcher, takes a call that leaves him dog bit and late to pick up his wife. She's browsed in a bookstore, finding a blood-red-covered novel, a murder mystery with numerology that loops constantly around the number 23. The story captivates Walter: he dr β¦eams it, he notices aspects of his life that can be rendered by "23," he searches for the author, he stays in the hotel (in room 23) where events in the novel took place, and he begins to believe it was no novel. His wife and son try to help him, sometimes in sympathy, sometimes to protect him. Slowly, with danger to himself and to his family, he closes in on the truth. (Read More)
Themes: | murder |
Story: | skeletonauthorthroat slittingflashlightbookdream |
The cynical and skeptical writer Mike Enslin writes books evaluating supernatural phenomena in hotels, graveyards and other haunted places, usually debunking the mystery. While writing his latest book, he travels from Los Angeles to New York to spend one night in the Dolphin Hotel's posessed room 14 β¦08, which is permanently unavailable for guests. The reluctant manager Mr. Gerald Olin objects to his request and offers an upgrade, expensive booze and finally relates the death of more than fifty guests over decades in the cursed room. However Mike threatens Mr. Olin, promising to sue the hotel, and is finally allowed to check into the room. Later in the night, he finds that guests of room 1408, once they have checked in, might never leave the room alive. (Read More)
Themes: | supernatural powerghostmurder |
Locations: | new york city |
Story: | eye gougingauthorthroat slittingmanhattan new york citybookdream |
Melanie Daniels is the modern rich socialite, part of the jet-set who always gets what she wants. When lawyer Mitch Brenner sees her in a pet shop, he plays something of a practical joke on her, and she decides to return the favor. She drives about an hour north of San Francisco to Bodega Bay, where β¦ Mitch spends the weekends with his mother Lydia and younger sister Cathy. Soon after her arrival, however, the birds in the area begin to act strangely. A seagull attacks Melanie as she is crossing the bay in a small boat, and then, Lydia finds her neighbor dead, obviously the victim of a bird attack. Soon, birds in the hundreds and thousands are attacking anyone they find out of doors. There is no explanation as to why this might be happening, and as the birds continue their vicious attacks, survival becomes the priority. (Read More)
Story: | bird attackeye gouginganimal attackbird |
While undergoing open heart surgery, a man's failed anesthetic leaves him completely alert, but paralyzed and unable to tell his doctors
Subgenre: | independent film |
Themes: | murder |
Locations: | new york city |
Story: | surgeryambulancemanhattan new york citydreamgun |
Themes: | supernatural powerghostmurder |
Story: | razoreye gougingstabbed in the throatthroat slitting |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
Subgenre: | independent film |
Themes: | supernatural powerghostmurder |
Characters: | police |
Story: | graveyardambulanceflashlightbased on novelgun |
Quadripeligic ex-cop Lincoln Rhyme was looking forward to his assisted suicide when he got the news: some sicko was abducting people in a taxi and leaving them to die in particularly sadistic ways. With time counting down between each abduction and possible death, Rhyme recruits rather-unwilling Ame β¦lia Donaghy, haunted by her cop father's suicide and thinking she's next, into working the crime scenes to track down the killer. (Read More)
Themes: | murder |
Locations: | new york city |
Characters: | police |
Story: | chrysler building manhattan new york cityanimal attackauthorambulanceflashlightmanhattan new york citybased on novel |
With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends β¦up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)
Subgenre: | independent film |
Themes: | murder |
Locations: | new york city |
Characters: | police |
Story: | animal attackauthorambulancemanhattan new york citybookgun |
Archeologist Lankester Merrin is asked to go to East Africa to excavate a church that has been found completely buried in sand. Merrin is also an ordained Roman Catholic priest who, still haunted by what he was forced to do during World War II in his native Holland, eschews any religion or belief. H β¦e's fascinated by what he finds and that it dates hundred of years before Christianity was introduced to the area. Accompanied by a young priest, Father Francis, to keep an eye on the religious elements of what they find, Merrin makes his way to the camp. There he meets a young doctor, Sarah and soon realizes there is an air of gloom that envelops the entire site. Workmen go mad and a young boy is mauled by a pack of hyenas while completely ignoring his younger brother Joseph. Inside the church itself they find signs of desecration. Merrin is forced to re-examine his lack of faith and come face to face with the devil. (Read More)
Themes: | murder |
Story: | lightereye gougingstabbed in the throatanimal attackgraveyardthroat slittingbased on novel |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
Themes: | supernatural powerghostmurder |
Characters: | police |
Story: | alter egoreverse footageskeletonthroat slittingambulanceflashlightdream |
An Easter story. Frank is a Manhattan medic, working graveyard in a two-man ambulance team. He's burned out, exhausted, seeing ghosts, especially a young woman he failed to save six months' before, and no longer able to save people: he brings in the dead. We follow him for three nights, each with a β¦different partner: Larry, who thinks about dinner, Marcus, who looks to Jesus, and Tom, who wallops people when work is slow. Frank befriends the daughter of a heart victim he brings in; she's Mary, an ex-junkie, angry at her father but now hoping he'll live. Frank tries to get fired, tries to quit, and keeps coming back, to work and to Mary, in need of his own rebirth. (Read More)
Themes: | ghost |
Locations: | new york city |
Story: | graveyardambulancemanhattan new york citydreambased on novel |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β¦p her from constantly getting visions of Jessica's fate. (Read More)
Subgenre: | independent film |
Themes: | supernatural powerghostmurder |
Story: | pencilreverse footagegraveyarddreamgun |
Earl Brooks is a highly respected businessman and was recently named Portland's Man of the Year. He hides a terrible secret however: he is a serial killer known as the Thumbprint Killer. He has been attending AA meetings and has kept his addiction to killing under control for two years now but his a β¦lter ego, Marshall, has re-appeared and is pushing him to kill again. When he does kill a couple while they are making love, he is seen and photographed by someone who also has his own death and murder fetish. In a parallel story, the police detective investigating the murder is having problems of her own. She is going through a messy divorce and a violent criminal who had vowed revenge some years before has escaped from prison and is after her. (Read More)
Themes: | blackmailmurder |
Characters: | police |
Story: | alter egostabbed in the throatthroat slittingflashlightdreamgun |
It's been six years since the Rollins family just up and left and now the troubled Solomon family has come from Chicago, to rebuild their lives following their sons hospitalization due to their daughter's drunk driving accident. But as they start to settle in something odd and strange begins to occu β¦r to their son. Could something supernatural be at work, and did the previous family just leave...or are they still here? Trapped in the only place they've ever known? And what did cause their deaths? Most of all...is this 'killer' still very much alive? (Read More)
Themes: | supernatural powerghostmurder |
Characters: | police |
Story: | bird attackanimal attack |
A hitman who lives by the code of the samurai, works for the mafia and finds himself in their crosshairs when his recent job doesn't go according to plan. Now he must find a way to defend himself and his honor while retaining the code he lives by.
Subgenre: | independent film |
Themes: | ghostmurder |
Characters: | police |
Story: | graveyardbirdflashlightbookdreamgun |
On the occasion of his fifth wedding anniversary, Nick Dunne reports that his wife, Amy, has gone missing. Under pressure from the police and a growing media frenzy, Nick's portrait of a blissful union begins to crumble. Soon his lies, deceits and strange behavior have everyone asking the same dark β¦question: Did Nick Dunne kill his wife? (Read More)
Themes: | murder |
Locations: | new york city |
Characters: | police |
Story: | authorthroat slittingflashlightmanhattan new york citybookcatbased on novel |
A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old β¦televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)
Themes: | supernatural powerghostmurder |
Story: | stabbed in the throatthroat slittingflashlight |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β¦ end up having to survive this swarm of evil until morning comes. (Read More)
Subgenre: | independent film |
Themes: | ghostmurder |
Story: | eye gougingreverse footageskeletonbook |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their β¦ courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Themes: | supernatural powerghostmurder |
Story: | pencilsurgeryskeletonflashlight |
A thought-provoking and haunting exploration of how reality and dream-states may combine to form complex interactions. The line between the imagination and reality blurs when an accomplished Psychiatrist takes on a patient that appears to be suicidal.
Themes: | ghost |
Locations: | new york city |
Story: | sparrowanimal attackambulancedreamgun |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | independent film |
Themes: | supernatural powermurder |
Story: | surgeryskeletonambulancedream |
A group of thieves steal a rare gem, but in the process, two of the men double cross the leader of the thieving group, Patrick, and take off with the precious stone. Ten years later, prominent psychiatrist Nathan Conrad is invited to examine a disturbed young woman named Elisabeth. Patrick immediate β¦ly kidnaps Nathan's daughter, forcing Nathan to attempt to get Elisabeth to reveal a secret number which will ultimately lead Patrick to the whereabouts of the precious gem that has eluded him. (Read More)
Themes: | murder |
Locations: | new york city |
Characters: | police |
Story: | kicked in the crotchskeletongraveyardambulanceflashlightmanhattan new york citybased on novel |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Themes: | blackmailghostmurder |
Characters: | police |
Story: | eye gougingskeletongraveyardbirdflashlightbookgun |
Sam Wheat is a banker, Molly Jensen is an artist, and the two are madly in love. However, when Sam is murdered by friend and corrupt business partner Carl Bruner over a shady business deal, he is left to roam the earth as a powerless spirit. When he learns of Carl's betrayal, Sam must seek the help β¦of psychic Oda Mae Brown to set things right and protect Molly from Carl and his goons. (Read More)
Themes: | supernatural powerghostmurder |
Locations: | new york city |
Characters: | police |
Story: | manhattan new york citycatgun |
Jeff is an anguished man, who grieves and misses his young son that was killed by a driver in a car accident. He has become obsessed for revenge against the man and reckless with his wife and daughter. When Dr. Lynn Denlon, who has troubles with her marriage, is abducted by the deranged Jigsaw's app β¦rentice Amanda, she is brought to a gruesome warehouse to keep John Kramer alive in spite of having a terminal brain tumor. Amanda puts a necklace gadget full of explosives around Dr. Lynn's neck connected to John Kramer's life support system, and tells her that if he dies the device will explode. Meanwhile, Jeff is submitted to a sick game of forgiveness with surprising dark consequences. (Read More)
Themes: | murder |
Characters: | police |
Story: | brain tumorreverse footagesurgerythroat slittinggun |
Set in contemporary New York City, a seemingly ordinary teenager, Clary Fray, discovers she is the descendant of a line of Shadowhunters, a secret cadre of young half-angel warriors locked in an ancient battle to protect our world from demons. After the disappearance of her mother, Clary must join f β¦orces with a group of Shadow Hunters, who introduce her to a dangerous alternate New York called the Shadow World, filled with demons, warlocks, vampires, werewolves and other deadly creatures. (Read More)
Subgenre: | independent film |
Themes: | supernatural powermurder |
Locations: | new york city |
Story: | chrysler building manhattan new york cityskeletonbirdthroat slittingbased on novelgun |
After many years of sleeping in his coffin, the vampire Lestat awakens only to find that the world has changed and he wants to be a part of it. He gathers a following and becomes a rock star only to find that his music awakens the ancient Queen Akasha and she wants him to become her king...
Themes: | supernatural powermurder |
Story: | reverse footageskeletonthroat slittingdreambased on novel |
Johnny Blaze, a man who made a deal with the Devil who called himself Mephistopheles at the time (now Roarke), is on the run trying to make sure no-one is harmed by his alter ego, The Ghost Rider. He is approached by a Monk named Moreau who tells him that he can help be him free of the Rider, but fi β¦rst, he needs Johnny's help to protect a boy, whom Roarke has plans for, to help him take human form. (Read More)
Themes: | supernatural powerghostmurder |
Story: | alter egoeye gougingskeletonambulance |
When a prisoner transport plane crashes, one prisoner, Mark Sheridan, skillfully escapes and saves lives at the same time. Deputy Sam Gerard and his team of U.S. Marshals pursue relentlessly, but Gerard begins to suspect that there is more to the exceptional fugitive than what he has been told. Mean β¦while, Sheridan struggles to avoid capture while seeking answers of his own. Until the final scene, both Gerard and Sheridan are in jeopardy of the unknown. (Read More)
Themes: | murder |
Locations: | new york city |
Characters: | police |
Story: | chrysler building manhattan new york cityplaneambulanceflashlightmanhattan new york city |
Det. John Hobbes is convinced that when killer Edgar Reese is executed, all of his troubles are over. But when people he knows and people on the street start to sing the same tune that Reese sang in the gas chamber, and those same people taunt him, he is told that maybe the cursed fallen angel Azaze β¦l is behind it all. Azazel is cursed to roam the Earth without a form, and he can switch bodies by any contact, making him hard to track. When Hobbes is forced to kill a man possessed by Azazel, he must clear his name while protecting his family and others from the evil, vengeful Azazel. (Read More)
Subgenre: | independent film |
Themes: | supernatural powermurder |
Locations: | new york city |
Characters: | police |
Story: | reverse footagethroat slittingflashlightbookcatgun |
An advertising executive is kidnapped and held hostage for 20 years in solitary confinement. When he is inexplicably released, he embarks on an obsessive mission to discover who orchestrated his punishment, only to find he is still trapped in a web of conspiracy and torment.
Themes: | murder |
Locations: | new york city |
Story: | straight razorkicked in the crotchstabbed in the throatthroat slitting |
Death stalks the dreams of several young adults to claim its revenge on the killing of Freddy Kruger. Chased and chastised by this finger-bladed demon, it is the awakening of old memories and the denials of a past of retribution that spurns this hellish vision of a dreamlike state and turns death in β¦to a nightmare reality. (Read More)
Themes: | murder |
Story: | eye gougingstabbed in the throatthroat slittingambulancedream |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r β¦eason too. (Read More)
Themes: | supernatural powerghostmurder |
Story: | maineflashlightcatdreambased on novel |
Based upon Richard Adam's novel of the same title, this animated feature delves into the surprisingly violent world of a warren of rabbits as they seek to establish a new colony free of tyranny and human intervention. Frightening and bloody in some scenes. Not recommended for young children.
Subgenre: | independent film |
Story: | bird attackanimal attackbirdcatbased on novel |
Dr. Joe Darrow is a recently widowed doctor. He is grieving due to the death of his pregnant wife in a Red Cross mission in Venezuela. Although being atheist, he began to believe that his dead wife wants to communicate with him, through her young patients in the Pediatrics of a Chicago hospital.
Themes: | supernatural powerghost |
Characters: | police |
Story: | graveyardbirdambulancedreamgun |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | independent film |
Themes: | supernatural powermurder |
Characters: | police |
Story: | eye gougingskeletongraveyardambulanceflashlightgun |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | independent film |
Themes: | murder |
Locations: | new york city |
Characters: | police |
Story: | chrysler building manhattan new york cityanimal attackambulanceflashlightmanhattan new york city |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | independent film |
Themes: | blackmailsupernatural powermurder |
Story: | maineambulanceflashlightdreambased on novel |
Robert and Katherine Thorn seem to have it all. They are happily married and he is the US Ambassador to Great Britain, but they want nothing more than to have children. When Katharine has a stillborn child, Robert is approached by a priest at the hospital who suggests that they take a healthy newbor β¦n whose mother has just died in childbirth. Without telling his wife he agrees. After relocating to London, strange events - and the ominous warnings of a priest - lead him to believe that the child he took from that Italian hospital is evil incarnate. (Read More)
Themes: | supernatural powermurder |
Characters: | police |
Story: | stabbed in the throatanimal attackskeletongraveyardgun |
Everything is connected: an 1849 diary of an ocean voyage across the Pacific; letters from a composer to his lover; a thriller about a conspiracy at a nuclear power plant; a farce about a publisher in a nursing home; a rebellious clone in futuristic Korea; and the tale of a tribe living on post-apoc β¦alyptic Hawaii far in the future. (Read More)
Subgenre: | independent film |
Themes: | murder |
Story: | skeletonauthorthroat slittingflashlightbookcatdreambased on novelgun |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | independent film |
Themes: | murder |
Story: | stabbed in the throatskeletonthroat slittingambulanceflashlight |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Themes: | supernatural powermurder |
Story: | stabbed in the throatreverse footagethroat slittingflashlightdreamgun |
It's been eight years since the events in the second film, we now see that Andy is a teenager who has been enrolled in a military school. Play Pals Toy Company decides to re-release its Good Guys line, feeling that after all this time, the bad publicity has died down. As they re-used old materials, β¦the spirit of Charles Lee Ray once again comes to life. In his search for Andy, Chucky falls into the hands of a younger boy, and he realizes that it may be easier to transfer his soul into this unsuspecting child. Andy is the only one who knows what Chucky is up to, and it's now up to him to put a stop to it. (Read More)
Themes: | supernatural power |
Story: | straight razorthroat slittingambulanceflashlight |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Themes: | supernatural powermurder |
Characters: | police |
Story: | lighterskeletongraveyardthroat slittingflashlightgun |