Best popular movies like The Fog:

Do you need specific genre & keyword selection to find films similar to The Fog?
<< FIND THEM HERE! >>

The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (1980)

As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β€¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)

Subgenre:
american horrorcreature featureparanormalcult filmindependent film
Themes:
evilsupernatural powermonsterescapefearghostrevengedeathmurder
Mood:
darkness
Locations:
ghost shipfishing boatcampfireshipsearural settingwatersmall townchurchbeachbar
Characters:
mysterious villaincatholic priestlittle boyemployer employee relationshipterrorsheriffvillainsingle motherpriestzombieboychildrenmother son relationship
Period:
year 19791970s1980s
Story:
horror movie remadefemale djfemale hitchhikergrindhouse filmcampfire storykilling spreetragic villainevil spiritwoman in jeopardyevil manwitching hourfoghorncentennialticking clockmutilated body β€¦corpsgrimhell on earthlepermusic score composed by directordrive in classicstained glass windowbayremadedemonicdisturbingphonograph recordcreepydocksmistradio broadcasthookbutcheryghoulmaggotvolkswagenhand over mouthlistening to a radioradio stationscalpelcoastslashingspiral staircaseblackoutjournalmysterious manliving deadbad guydjlighthousedark pastpiereye gougingslaughterfogautopsypsychotronicbutcherpower outagereverse footagecelebrationhitchhikervictimgrindhousemass murderstabbed in the stomachlifting someone into the airtreasurecrucifixmutilationtape recorderelectronic music scoregothicgoldpiraterecord playerundeadkillingcult directorcrossspeechstorytellingmicrophonecursechild in perilstabbed to deathimpalementwomanstabbingcaliforniadecapitationdemondead bodyswordcorpsesurprise endingchaseknifetwo word titlebloodviolence (See All)

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
american horrorcult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horror
Themes:
evilsupernatural powermonsterdeathmurderprisonpsychopathinsanitymurder of a police officer
Mood:
darknessgorecar chaseslasherbreaking the fourth wall
Locations:
small townforestcemeteryboatwoodslakeamerica
Characters:
terrorsheriffvillainzombiepoliceteenagerserial killerkillerslasher killerserial murderer
Period:
1980s
Story:
killing spreeevil manmutilated bodydrive in classicdemonicbutcheryghoulslashingbad guyslaughterbutchervictimmass murderlifting someone into the airmutilation β€¦gothicundeadkillingstabbed to deathstabbingdecapitationdemonsurprise endingviolencesexcharacter name in titlenumber in titlesequelflashbackblood splattermasknumbered sequelflashlightmassacreambulancesevered headchildlooking at the cameradrowningelectrocutionstalkingneck breakingmurdererunderwatersevered armdismembermentblood spattersplattermaniacmachetepsychoback from the deadmasked manrampagenew jerseyshovelstabbed in the headbody countsevered legsequel to cult favoritebloodbathmasked killerpsycho killerserial murderpsychopathic killerbeheadingmadmankillsummer camphomicidal maniacactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clichepaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdark and stormy nightgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
american horrorcult filmpsycho thrillerbody horrorindependent horrorsadistic horror
Themes:
evilsupernatural powermurderdeathtorturepsychopathbrutalityinsanitysadism
Mood:
goreslasherbreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
mysterious villainterrorvillainboybrother sister relationshipteenage girlteenage boyserial killerkillerslasher killerserial murderermysterious killer
Period:
1980s
Story:
grindhouse filmkilling spreeevil manmutilated bodydrive in classicdisturbingbutcheryslashingmysterious manbad guyslaughterbutchergrindhouselifting someone into the airmutilation β€¦killingchild in perilstabbed to deathimpalementdecapitationcorpsesurprise endingviolencebloodsexfemale nuditynumber in titlemale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiesunderwearblood splattermasklow budget filmsubjective camerastrangulationsevered headlooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotstalkingpremarital sexmurderercabinloss of motherobscene finger gesturemaniacsexual attractionragemorguefourth partpsychotowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentdisfigurementbody landing on a carbody countcharacters killed one by onemasked killerpsycho killerserial murderpsychopathic killercar troublemadmanstabbed in the handkillhuman monstersummer camphomicidal maniacshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualcrime spreedeeply disturbed personpsycho terrorhockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymanskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All)

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β€¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thriller
Themes:
evilfeardeathrevengemurderpsychopathbrutalityinsanitysadismexploitationpolice investigation
Mood:
darknessgorerainnightmarenightslasher
Locations:
small towncemeterywoodsamericabackwoods
Characters:
mysterious villainterrorsheriffvillainmother son relationshippoliceteenagerbrother brother relationshipserial killerkillerslasher killerserial murderermysterious killercountry boy
Period:
1980s
Story:
grindhouse filmkilling spreeevil mandrive in classicbutcheryslashingmysterious manbad guyeye gougingslaughterpsychotronicbutchervictimgrindhousestabbed in the stomach β€¦lifting someone into the airmutilationkillingchild in perilimpalementdecapitationdead bodysurprise endingchaseviolencebloodsexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancingpantiesdigit in titleblood splatterlow budget filmnumbered sequelsubjective camerasword fightaxemassacrethroat slittinggravestalkercharacter's point of view camera shotdeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetebarnpsychomasked manmental institutionrampagerednecknew jerseyitalian americanstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killercar troublemadmanlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstonehillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightcandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All)

Friday The 13th Part 2 (1981) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β€¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
american horrorcult filmsuspenseb horrorpsycho thrillerindependent horror
Themes:
evilfeardeathmurderpsychopathbrutalityinsanityexploitation
Mood:
darknessgoreslasher
Locations:
campfirewoodswheelchairpolice carlakebackwoodsrunning through the woodschase in the woods
Characters:
mysterious villainterrorvillainteenagerboyfriend girlfriend relationshipserial killerkillerslasher killerserial murderermysterious killer
Period:
1980ssummeryear 1984
Story:
horror movie remadegrindhouse filmcampfire storykilling spreeevil mandrive in classicdisturbingbutcheryslashingmysterious manbad guyslaughterpsychotronicbutchervictim β€¦grindhousemass murderlifting someone into the airmutilationgothickillingimpalementdecapitationdead bodycorpsesurprise endingviolencebloodsexfemale nuditynumber in titlesequelfemale frontal nudityflashbackkissfightnipplespantiestelephone calldigit in titleblood splatterblondeslow motion scenecatbikinimasksecond partnumbered sequelsubjective cameraswimmingbrastrangulationmassacrethroat slittingjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexsplatterchessmaniacchainsawfireplacespearnipples visible through clothingmacheteragevillainessphone boothmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchstabbed in the headbetrefrigeratorbody countlens flarecharacters killed one by onepsychoticmasked killerpsycho killernude swimmingserial murderpsychopathic killercar troublemadmanreturning character killed offhuman monstersummer campfreakskirtsexual violencehomicidal maniacwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichecrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdolifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymaneast coastsickolost dogice pickgruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
american horrorcult filmindependent filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickcanadian horror
Themes:
evilsupernatural powerfearghostmurderrevengedeathsuicidekidnappingtorturedrunkennesspsychopathdeath of fatherbrutalitydeath of mother β€¦insanityabductiontraumafear of water (See All)
Mood:
gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore
Locations:
small townforestcemeterypolice stationlakeschool nurse
Characters:
mysterious villainterrorsheriffvillainzombiemother son relationshipfather son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyserial killerlittle girlkillerslasher killer β€¦serial murderer (See All)
Period:
2000s
Story:
killing spreeevil spiritevil manhell on earthdemonicbutcheryghoulslashingmysterious manbad guyeye gougingslaughterpsychotronicbutchervictim β€¦mass murderlifting someone into the airmutilationundeadkillingchild in perilimpalementstabbingdecapitationdemoncorpsesurprise endingviolencebloodcharacter name in titlesequelflashbackphotographexplosionpartypistolshowerfirevoice over narrationdreamblood splatterslow motion scenebrawlfalling from heightmaskcar crashfoot chasesevered headdream sequenceunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover updeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentsplatterchild murdermaniacburned aliveheroinemachetecomaragepsychosevered handgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingmedicationmurder of a childalternate realitybody countdemonic possessioncharacters killed one by onegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbeheadingmadmanfinal showdownnecrophiliakilldockohiosummer camplockersexual violencehomicidal maniacstonerdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clichechild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementthrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

Henry: Portrait Of A Serial Killer (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β€¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerindependent horror
Themes:
evilmurderdeathdrugsrapetortureincestpsychopathbrutalityinsanityexploitationmurder of family
Mood:
goreslasher
Locations:
chicago illinois
Characters:
mysterious villainterrorvillainbrother sister relationshipprostituteserial killerkillerslasher killerserial murderermurder of a prostitute
Period:
1980s
Story:
female hitchhikergrindhouse filmkilling spreeevil manmutilated bodybutcheryslashingmysterious manbad guyslaughterpsychotronicbutcherstabbed in the stomachmutilationkilling β€¦stabbed to deathstabbingdecapitationsurprise endingviolencebloodfemale nuditycharacter name in titlenuditybare breastsgunshot to deathblood splattershot in the chestlow budget filmmarijuanacriminalbisexualstrangulationvideo cameradrug dealerstabbed in the chestchild abusesevered headcontroversypantyhosestalkerattempted rapestalkingneck breakingdismembermentsplattermaniacfemale stockinged legsragepsychorapistrampagelow budgetdark humorperversionmurder of a childstabbed in the eyeabusive fatherbody countpsycho killerpervertserial murdervillain played by lead actorpsychopathic killermadmankillhuman monstersexual violencehomicidal maniacnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickomurderer duotwo killersgraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
american horrorcult filmindependent filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horror
Themes:
evilfearrevengemurderdeathvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismcrueltytraumamysterious death
Mood:
darknessgorenightslasherblood and gore
Locations:
rural settingwatercarmotorcycleboatwoodspolice carlaketruck
Characters:
mysterious villainterrorsheriffvillainpoliceteenagerfriendteenage boypolice officerserial killerpolicemanartistkillermothertruck driver β€¦slasher killerserial murderer (See All)
Period:
1970s1950ssummer
Story:
grindhouse filmcampfire storykilling spreedrive in classicremadedisturbingbutcheryslashingmysterious manslaughterpsychotronicbutcherpower outagevictimgrindhouse β€¦stabbed in the stomachelectronic music scoregothickillingstabbed to deathwomanstabbingdecapitationdead bodycorpsesurprise endingviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlepantiesbeatingdigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunninglow budget filmmarijuanahallucinationvoyeurguitarsubjective camerabedroombracandleold manaxemassacrethroat slittingdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingdressjeepheavy rainmachetehathammervillainesspsychoswimsuitdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnessmutelostthunderstormbathingdisembowelmentsurpriseatticperversiondead manbody countlens flareaxe murderroomcharacters killed one by onearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troubleshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichemurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerlost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esquesadisticdark and stormy nightmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorgruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street (1984) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickteen movieteen horrorindependent horror
Themes:
evilsupernatural powerrevengemurdersurrealismfuneralpsychopath
Mood:
gorehigh schoolnightmareavant gardeslasher
Locations:
cemeterybathtubpolice station
Characters:
mysterious villainterrorvillainmother son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicpolice chaseself mutilationslasher killer β€¦serial murdererpolice lieutenant (See All)
Period:
1980s
Story:
horror movie remadegrindhouse filmevil mandrive in classicremadedemonicdisturbingbutcherymaggotbad guybutchervictimgrindhouselifting someone into the aircrucifix β€¦electronic music scoregothiccult directordemoncorpsesurprise endingbloodviolencebare chested malecigarette smokingdreamblood splattermirrorface slapslow motion scenearrestfalling from heightbedjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shothangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearestrong female charactermaniacfalling down stairsburned alivehatpsychostrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockserial murderpsychopathic killermadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violenceopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clicheplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerhanged boysevered facestreet in titleboiler roomevil deadserial child killerbroken backfurnacelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β€¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
american horrorparanormalcult filmindependent filmblack comedysupernaturaldark comedypsycho thrillerindependent horror
Themes:
evilsupernatural powermonsterescapeghostmurderdeathsurrealismdrugstorturepsychopathdeath of motherinsanitysadismamnesia
Mood:
darknessgorerainhigh schoolnightmareslasher
Locations:
small townairplaneroad trip
Characters:
terrorvillainchildrenfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillerself mutilationyounger version of characterdeafnessslasher killerserial murderer β€¦german americanevil father (See All)
Period:
1970s1990s1960s1940s1950s
Story:
killing spreeevil spiritevil mandrive in classicdemonicdisturbingcreepybutcheryghoulbad guydark pastslaughterbutchervictimmutilation β€¦gothicundeadkillingchild in perilimpalementdemonknifeviolencebloodf ratedcharacter name in titlesequelflashbackbare chested maletitle spoken by characterfirepunctuation in titletitle directed by femaledreamblood splatterrescueslow motion scenefalling from heightapostrophe in titlecriminalsubjective cameragood versus evilstrangulationstabbed in the chestboxingmapchild abusedrawingshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodymurdererchild murdermaniacfalling down stairsburned alivekilling an animalhead buttscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothpsychoorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childdisfigurementknife throwingraised middle fingerabusive fatherbody countpsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killermadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationhomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairsleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorywater towerchild murdererman punches a womanadopted childreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymanburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β€¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
american horrorcult filmindependent filmsupernaturalpsycho thrillerstop motion animation
Themes:
evilsupernatural powermonsterghostdeathmurderfuneralpsychopathinsanitysadism
Mood:
gorenightmareslasher
Locations:
churchbarcemeteryschool boy
Characters:
terrorvillainsingle motherchildrenfather daughter relationshipteenagermother daughter relationshipdoctorserial killernursetough guylittle girlkillerself mutilationslasher killer β€¦alcoholic fatherserial murdererevil nurse (See All)
Period:
1980s
Story:
killing spreeevil spiritevil mandrive in classicdemonicdisturbingcreepybutcheryghoulscalpelslashingbad guyfogbutchervictim β€¦lifting someone into the aircrucifixelectronic music scoreundeadkillingchild in perilstabbed to deathimpalementstabbingdecapitationdemoncorpsesurprise endingviolencefemale nuditynumber in titlesequelbondagebare chested malecigarette smokingfiredreamdigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequelfoot chasenewspaperdeath of friendsuicide attemptstabbed in the chestnundream sequenceradiotonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollskeletonisolationbasementmurderercharacter says i love yousplattermaniacfalling down stairsteen angstcomaragetied to a bedback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightdisfigurementstabbed in the eyebody countcharacters killed one by onepajamassmokepsycho killerserial murderpsychopathic killermadmanalleyreturning character killed offohioabandoned househomicidal maniacstabbed in the armgroup therapyboy with glassesburnt facebody in a trunkone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clichesolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropehospital gownmarionetteorderlychild murdererdead teenagerboneslifting a female into the airbad motherhanged boysedativestreet in titleboiler roomforced suicidesadisticboogeymansexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
american horrorparanormalcult filmindependent filmsuperherosupernaturalstop motion animationslasher flickbody horrorurban fantasy
Themes:
evilsupernatural powermonsterfearghostdeathmurderfriendshiprapepregnancyinvestigationpsychopathbrutalitydepressioninsanity β€¦sadismtrauma (See All)
Mood:
gorenightmareslasher
Locations:
waterchurchhospitalswimming poolcarmotorcyclecar on firedeath in a car accident
Characters:
little boyterrorvillainsingle motherboymother son relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorfemale protagonist β€¦girlserial killernursebabyartistreference to godlittle girlwaitresskilleralcoholicfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
grindhouse filmkilling spreeevil spiritevil manmutilated bodydrive in classicdemonicghoullistening to a radioslashingmysterious manbad guydark pastslaughtercelebration β€¦victimmass murderlifting someone into the airmutilationundeadkillingimpalementstabbingdemonsurprise endingchaseknifebloodviolencesexfemale nudityf ratednuditybare breastssequelflashbackbare chested malegunfemale rear nudityphotographpartypistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashhallucinationgood versus evilfoot chaseflashlightdisguiseambulancedeath of frienddinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentredheadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousebeer drinkinggay characterfaintingcomic bookmutantloss of friendspidercrying womanskateboardbirthfollowing someonepicnicback from the deadmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childdisfigurementbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partpsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthmental patientmadmantaking a photographreturning character killed offkillohioassumed identitytowerhomicidal maniacbroken windowdomineering motherhospital roommasturbation referencenewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facemidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymanhorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketcharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

Halloween (1978) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β€¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerslasher flickteen movieteen horrorholiday horror
Themes:
evilfeardeathmurdercorruptionpsychopathparanoiamurder of family
Mood:
high schoolnightslasher
Locations:
small towncarcar theftkitchen knife
Characters:
little boyterrorvillainboyhusband wife relationshipteenagerteenage girlteenage boyfemale protagonistgirlserial killerlittle girlkillerpsychiatristdoctor patient relationship β€¦slasher killerserial murderer (See All)
Period:
1970s1960syear 1963year 1978
Story:
horror movie remadegrindhouse filmkilling spreewoman in jeopardyevil manmusic score composed by directordrive in classicdemoniccreepybad guygrindhousestabbed in the stomachlifting someone into the airmutilationelectronic music score β€¦killingstabbed to deathstabbingsurprise endingknifeviolencefemale nuditynudityone word titledogguncigarette smokingtitle spoken by charactershot to deathblood splattershot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilhalloweenstrangulationthroat slittingchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shothalloween costumelong takestalkingmurdererfirst parthandgunmaniacpot smokingteen angstbulletbabysitterblockbusterpsychodead womanmasked manwatching televisioncouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endbody countdead woman with eyes openpumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killermental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessmurder spreevillain not really dead clicheescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettesmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonewoman strangled to deathfalling out a windowchild murders a childphone conversationcuttingboogeyman21 year oldpumpkin carvinglifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
american horrorparanormalcult filmsupernaturalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
evilsupernatural powermonsterescapefearghostrevengemurderdeathfriendshipsurrealismkidnappingvoyeurismpsychopathbrutality β€¦paranoiasadismpanicmysterious deathshower murder (See All)
Mood:
darknessgorerainhigh schoolnightmareslasherpoetic justice
Locations:
small townbarschoolswimming poolbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
terrorvillainboymother son relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationship β€¦teenage girlteenage boyteachergirlserial killerstudentpolicemanlittle girlkillerself mutilationdriverslasher killerserial murderergay teacher (See All)
Period:
1980syear 1985
Story:
grindhouse filmkilling spreeevil spiritevil manhell on earthdrive in classicdemonicbutcheryslashingbad guybutchergrindhousemass murderstabbed in the stomachlifting someone into the air β€¦mutilationelectronic music scoregothicundeadchild in perilstabbed to deathimpalementstabbingdemondead bodysurprise endingchaseknifeviolencebloodcharacter name in titlenuditynumber in titlemale nuditysequelmale rear nuditybondagedogbare chested malefightcigarette smokingpartyshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titleneighbornumbered sequelhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrebasketballfootballstabbed in the chestsnakeapologydream sequencebirdcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionkicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingwoundbeer drinkinggay characterlooking at oneself in a mirrorlistening to musicjoggingmousebarefoot malepsychovisitcovered in bloodsadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellaralarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in serieshomicidal maniacbroken windowfish tankbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facestreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagemale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerparanormal phenomenaslasher flickteen horror
Themes:
evilsupernatural powermonsterescapedeathmurderrevengepsychopathdrug addictionmurder of a police officer
Mood:
gorerainhigh schoolslasher
Locations:
seanew york cityboatwoodscityamericasewer
Characters:
mysterious villainterrorvillainzombieteenage girlteenage boypolice officerserial killerkillerteacher student relationshipslasher killerserial murderer
Period:
1980s
Story:
evil manmutilated bodybutcheryghoulbad guyslaughterbutcherlifting someone into the airmutilationundeadstabbed to deathimpalementstabbingdecapitationdemon β€¦violencebloodfemale nuditycharacter name in titlenumber in titlesequelbare chested maleexplosionpantiesblood splattermirrornumbered sequelhallucinationguitarmanhattan new york cityflashlightgangnew yorkstrangulationaxevideo camerathroat slittingsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotattempted rapeunderwatermaniachypodermic needlepsychoback from the deadmasked manmale underwearrampagenew jerseyblack bradead childdisembowelmentstabbed in the eyebody countcharacters killed one by onesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererbody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All)

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β€¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
american horrorparanormalcult filmindependent filmmartial artsblack comedysuspensesupernatural
Themes:
evilsupernatural powermurderrevengefuneralpsychopath
Mood:
gorerainhigh schoolnightmareslasher
Locations:
small townbeachhospitalcemeteryelevatorschool nurseblood in water
Characters:
terrorvillainchildrenfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshipserial killertough guylittle girlwaitresskillerslasher killer β€¦serial murderer (See All)
Period:
1980s
Story:
killing spreeevil spiritevil mandrive in classicdemonicdisturbingbutcheryslashingbad guybutcherstabbed in the stomachlifting someone into the airmutilationelectronic music scoreundead β€¦killingstabbed to deathdemoncorpsesurprise endingbloodnumber in titlesequelfemale frontal nuditydogbare chested malecigarette smokingphotographfiredreamdigit in titleblood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequelambulancedeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phonekicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armsleepingpizzamaniacsurgeryteen angstslow motionwoman with glasseskicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armpsycho killerserial murdervillain played by lead actorpsychopathic killerreturning character killed offneedlejunkyardohiodefecationold dark housecockroachhomicidal maniacbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimmurder spreetime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chesttorturerafrican american manoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotleserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

Halloween (2007) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
american horrortragedypsycho thrillerslasher flick
Themes:
evildeathmurdersuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismhome invasionpolice investigationmurder of a police officer β€¦mysterious death (See All)
Mood:
darknessgoreslasherblood and gore
Locations:
small townstrip club
Characters:
terrorsheriffvillainboyteenagerafrican americanboyfriend girlfriend relationshipserial killerhostagekillerpsychiatristslasher killerserial murderer
Period:
1970s
Story:
killing spreeevil manmutilated bodydisturbingcreepybutcheryslashingbad guydark pastbutchervictimmass murderlifting someone into the airelectronic music scorekilling β€¦child in perilstabbed to deathimpalementstabbingdead bodycorpsechaseknifebloodviolencesexfemale nuditymale nudityfemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterpistolwoman on topbeatingblood splatterremakeshot in the headfalling from heightmasktelevisionstrippershot in the backf wordsubjective camerastrangulationmassacrethroat slittingstabbed in the chestjokecontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanityteenage sexblood spattersplattermaniackilling an animalrageloss of friendpsychopsychologisthome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalheadphonesperversionmurder of a childbody countbroken armduct tapecharacters killed one by onepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killermadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichejack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdomichael myersdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manchoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Zombie (1979)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Zombie (1979)

A zombie is found aboard a boat off the New York coast which belongs to do a famous scientist. Peter West, a journalist, travels to the Antilles with Ann, the daughter of the scientist. On the way, they meet with with Brian, a ethnologist, and Susan. When they arrive at Matul Island, they find Dr. M β€¦enard, and discover a terrifying disease which is turning the islanders into horrifying zombies which devour human flesh and seem indestructible.... (Read More)

Subgenre:
creature featurecult filmindependent filmsuspensesurvival horrorbody horrorzombie apocalypsezombie survivalitalian horrorsadistic horrorzombie outbreak
Themes:
supernatural powerfearmurderdeathdeath of fatherbrutalitysadismcrueltydeath of wifeapocalypsecannibalismtraumamurder of a police officer
Mood:
darknessgoreblood and gorezombie film
Locations:
new york citycemeteryboat
Characters:
zombiehusband wife relationshipdoctornurse
Period:
year 19791970s
Story:
grindhouse filmmutilated bodyhell on earthdrive in classicmaggotcoastliving deaddark pasteye gougingslaughterautopsygrindhousemutilationundeadcurse β€¦stabbingdead bodycorpsesurprise endingchaseviolencebloodfemale nuditynumber in titlebare breastsfemale frontal nuditygunfemale rear nudityfightfemale full frontal nuditynipplesexplosionpistolshowerfireshootoutdigit in titleshot to deathblood splattermirrorshot in the chestface slapshot in the headshotgunslow motion scenecameragunfightthongbare buttheld at gunpointislandsciencemanhattan new york citycombatshot in the backnew yorkmassacredeath of friendthroat slittingstabbed in the chestfemale pubic hairsevered headpolice officer killedshot in the foreheadpainbeaten to deathscreamingperson on firescreamsevered armspearvirussharknaked womanend of the worldback from the deadeaten aliveinvasionobesitycannibalmercilessnessgash in the facegunshot woundshot in the facedeath threatstabbed in the headhit on the headexploding headdisembowelmentblood on shirtstabbed in the eyevoodoodeath of loved oneworld trade center manhattan new york cityintestinesmolotov cocktailhead woundhead blown offblood stainbullet ballethead bashed inscene of the crimestatue of liberty new york citybitten in the neckcrushed headscuba divingcarnagebody bagextreme violenceflesh eating zombiegraphic violencecut into piecesbloody violencezombie violencepool of bloodpsychotronic filmbreaking through a doorsevered footshark attacknewspaper reporteroutbreakzombie attackexploitation filmhead ripped offmad doctortropical islandbitebitten in the throatexit woundbitingdoomsdaypolice officer knocked unconsciousbitten on the armflesh eatingitalian cinemaeye injuryinfamygory violenceoxygen tankeast coastvideo nastyzombificationstab woundsequel by name onlyeating human fleshbitten in the faceflesh eating zombiesresident evilzombie bitedeadly diseasenotorietybitten by a zombienude reflected in mirrorwrapped in a bedsheeteye woundzombie invasioneye skeweringhuman eaten by zombiesleg bitingswim capdiving mask (See All)

The Texas Chain Saw Massacre (1974)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β€¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horrorindependent horror
Themes:
evilescapefeardeathmurderfriendshipkidnappingtorturepsychopathbrutalityparanoiadysfunctional familyinsanitysadismexploitation β€¦paniccannibalisminheritancemadnessnear death experience (See All)
Mood:
darknessavant gardeslasherambiguous ending
Locations:
carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country
Characters:
terrorvillainfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagekillerself mutilationtruck driverslasher killer β€¦serial murdererself inflicted injury (See All)
Period:
1970syear 1973
Story:
horror movie remadegrindhouse filmkilling spreewoman in jeopardyevil manhell on earthdrive in classicremadedisturbingcreepybutcheryslashingbad guypsychotronicbutcher β€¦hitchhikervictimgrindhouselifting someone into the airmutilationgothickillingcult directorimpalementdecapitationcorpsesurprise endingchaseknifeviolencebloodphotographvoice over narrationbeatingblood splatterurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegesurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercross dressingcowsplatterfreeze framemaniacpickup truckchainsawropegroup of friendsbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodproduced by directorskullhitchhikingmasked manfull moonrampageredneckdamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormuteescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killercar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltycar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdobanned filmdead teenagergeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehensadisticscreaming in horrorfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomeman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (1981)

In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.

Subgenre:
american horrorcult filmsuspensepsycho thrillerslasher flickholiday horror
Themes:
feardeathmurderjealousytorturevoyeurismmemoryseductionpsychopathbrutalityobsessionparanoiainsanityblindnesstrauma β€¦madnessmurder investigationmurder of a police officerpsychological trauma (See All)
Mood:
darknessgorenightslasher
Locations:
small townhospitalcarwheelchairpolice carhospital fire
Characters:
terrorsheriffvillainpoliceteenagerboyfriend girlfriend relationshipteenage girlpolice officerserial killernursedetectivepolicemankillerslasher killerserial murderer
Period:
1970syear 1978
Story:
grindhouse filmdrive in classicdemonicdisturbingbutcheryhand over mouthscalpelslashingmysterious manbad guydark pasteye gougingslaughterautopsybutcher β€¦victimgrindhousestabbed in the stomachlifting someone into the airmutilationelectronic music scorestabbed to deathstabbingchaseknifetwo word titlebloodviolencesexfemale nuditynuditynumber in titlemale nuditybare breastssequelmale rear nuditykissfemale rear nuditycigarette smokingnipplesexplosiontelephone callfirecryingblood splattercar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilhalloweenflashlightold manstrangulationambulancethroat slittingaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathstabbed in the backprologuescreamingperson on fireuniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapmurderersplattermaniactv newssyringedestructionhypodermic needlesexual attractioncowboy hatwalkie talkiehammerhidingbuttockscaucasianpoolpsychopsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationaccidental killinghot tubshadowdead mandisfigurementstabbed in the eyebody countcharacters killed one by onedead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerpsycho killerflat tirefemale stockinged feetdead girlserial murderpsychopathic killerconfusioncar troublemadmanstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonehomicidal maniacsuit17 year oldearringnurse uniformdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlcigarettekiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscaremurder spreenude bathingsilhouettevillain not really dead clichezippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myerscalling someone an idiotfragments of glasstorturersequel to cult filmboogeyman21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wolf Creek (2005) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β€¦are after the backpackers find a way to escape. (Read More)

Subgenre:
cult filmindependent filmsuspenseslasher flickaustralian horrorsadistic horror
Themes:
evilescapefearmurderdeathkidnappingrapedrinkingtorturedrunkennesspsychopathbrutalityinsanitysadismabduction β€¦exploitationcruelty (See All)
Mood:
darknessgorecar chasenightslasherblood and gore
Locations:
campfirebeachbarrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationroad movie β€¦australian outbackcar on fireshed (See All)
Characters:
mysterious villainterrorvillainhusband wife relationshipdoctorsingerserial killerhostagekilleraustralianself mutilationslasher killerserial murderermysterious killer
Period:
year 1999
Story:
grindhouse filmcampfire storykilling spreeevil manbutcheryslashingmysterious manbad guyslaughterbutchervictimmutilationkillingstorytellingstabbed to death β€¦impalementstabbingdead bodycorpsechaseknifetwo word titleviolenceblooddoggunkisscigarette smokingphotographtitle spoken by characterexplosionsingingpartybased on true storysongshot to deathblood splattercar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglasseslow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedmassacrevideo camerafalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadtentattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufogaragemaniacpickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencepsychostrangerhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionrainstormcapturecliffminetied feetbody countopening a doorsexual assaultcharacters killed one by onebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbarking dogcar troublemadmancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womanrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
ghostmurderdeathsurrealisminfidelityrapechristmasjealousydrinkingdrunkennessfuneralinvestigationangercorruptionpsychopath β€¦death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All)
Mood:
darknessgorenightslasher
Locations:
waterbarhospitalrestaurantschoolcarcemeterybathtubbicycleelevatorkitchenwheelchairaustraliapolice stationpolice car β€¦cityitalytruck (See All)
Characters:
mysterious villainterrorvillainboymother son relationshiphomosexualfather son relationshippolicefather daughter relationshipboyfriend girlfriend relationshipdoctorsingergirlserial killer β€¦policemanmusicianactresskillerpsychiatristmaidprofessorjewgermangay friendslasher killerserial murdererself pity (See All)
Period:
1970s
Story:
grindhouse filmkilling spreemutilated bodydrive in classicdisturbingbutcheryslashingmysterious mandark pasteye gougingslaughterbutchervictimgrindhousestabbed in the stomach β€¦tape recordergothicrecord playerkillingcult directorstabbed to deathimpalementstabbingdecapitationdead bodycorpsesurprise endingchaseknifetwo word titleviolencebloodflashbackgunkisscigarette smokingphotographsingingtelephone callfiresongshootoutbeatingblood splattermirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningcafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective camerasurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxedinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicionpsychiceuropearsonmaniactv newsfireplacedesirebreaking and enteringstreetdressrome italymagiciantoyarchitectpsychologycomposerdesperationdriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead mandisfigurementbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openvoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killerapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettehatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killerattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Suspiria (1977)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Suspiria (1977)

Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p β€¦revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)

Subgenre:
cult filmindependent filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror
Themes:
evilsupernatural powerescapefearmurderdeathfriendshipsurrealismdrunkennessdancedeceptionvoyeurismbrutalityparanoiaillness β€¦sadismunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All)
Mood:
darknessgorerainnightavant gardeslasherstylization
Locations:
schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver
Characters:
boyteenagerfrienddoctorteenage girlfemale protagonistteachergirlpolice officerstudentsister sister relationshipkillerpsychiatristprofessorwitch β€¦germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All)
Period:
1970syear 1977
Story:
grindhouse filmevil spirithell on earthdrive in classicremadedemonicghoulmaggotslashingspiral staircasepsychotronicpower outagereverse footagevictimgrindhouse β€¦electronic music scoregothickillingcult directorstabbed to deathimpalementwomanstabbingdemoncorpsesurprise endingchaseknifeviolencebloodone word titleflashbackdogcigarette smokingdancingexplosiontelephone callfirevoice over narrationblood splatterslow motion scenesecretfalling from heightshowdownbathroompianohallucinationvoyeurtelephonesubjective cameraswimminggood versus evilfoot chasewineambushstrangulationdeath of friendthroat slittingtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotmissing personcover upcollege studentlightningscreamhangingdisappearanceinjectionsuspicionmurdererfirst partthreatened with a knifeballetpubeuropeitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothinghypodermic needleheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodanimal attackdead womanschizophreniafull moonbloody noseblood on facestabbed in the throatfemale leadmercilessnessstabbed in the neckmutebroken glassescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilitygerman shepherdmetaphorpiano playingclimbing through a windowsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violenceknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackglowing eyesnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemamale dancerstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Fog (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (2005)

The inhabitants of Antonio Island, off the coast of Oregon, are about to unveil a statue honoring the four men (Castle, Wayne, Williams and Malone) who founded their town in 1871. Nick Castle is one of the descendants of the men, and owns a fishing charter company, using his vessel, the Seagrass, fo β€¦r tourism. When his girlfriend Elizabeth Williams returns to the island after spending six months in New York, a bizarre series of events begin to occur, including several gruesome deaths and the presence of a mysterious fog. When Elizabeth slips in Nick's boathouse and falls into the sea, she finds an old journal from 1871, written by Patrick Malone, one of the town's founders. It tells how a man named Blake bought half the island for use as a leper colony. While bringing his people to Antonio Island in their clipper ship, the Elizabeth Dane, Blake is betrayed by Castle, Wayne, Williams and Malone. The four men locked Blake and his people in the vessel, stole their money and possessions, and then set fire to the ship, killing everyone aboard. In the present day, the ghosts of Blake and his crew have risen from their watery grave to seeking revenge on the descendants of the four men. (Read More)

Themes:
supernatural powerfearghostrevengemurderdeathgriefwealth
Mood:
horror movie remake
Locations:
fishing boatshipseabeachhospitalcemeterysex in showership on fire
Characters:
little boysingle motherpriestmother son relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshippolice officermayor
Story:
leperphonograph recordghoulradio stationcoastjournallighthousepierfoglifting someone into the airrecord playerkillingstorytellingmicrophonestabbed to death β€¦corpseknifeflashbackbare chested maledancingphotographpantiesdreamcar accidentremakewatching tvcomputerheld at gunpointtearscar crashislandflashlightvideo cameraambulancefishwhite pantiesfishingperson on firestatuescreamcharacter says i love youunderwaterburned alivemorgueheadphonesrowboatthrown through a windowstabbed in the eyecharacters killed one by onecar troublefire extinguisherapparitionlighterwebcamwatchparamedicbellhit by a truckstretcherartifactfilmed killingoregonmetal detectordisc jockeywoman in a bikinimonumentdeath by drowningradarfootprintsailing shipmarinabedriddenpower failurestealing moneyoathdinner tableoil lamptwin sisterscaught in a netgoogleanchorremake of cult filmradio broadcastingexhibitleprosytown hallbeer canlost at seaweathermanknife in the headdeath by firejeopardyfoundationreflection in eyestabbed with glassturntablecar falls into waterseaweedpower stationthrown from a boatthrown into waterfounding fatherstrapped in a careyes sewn shutradio disc jockeyweighing scalesisolated townhallmark (See All)

Psycho (1960) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  β€¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
american horrorcult filmindependent filmsuspensepsycho thrillerpsychological horror
Themes:
fearmurderdeathmarriagemoneyfuneraldeceptionvoyeurismdivorcetheftpsychopathguiltinsanitydatingmental illness β€¦unrequited lovemadness (See All)
Mood:
darknessrainslasherbreaking the fourth wall
Locations:
rural settingsmall townchurchhotelbathtubdesertpolice carmotelcar in water
Characters:
terrorsheriffvillainmother son relationshipfamily relationshipsfriendserial killerpolicemansister sister relationshipthiefkillerpsychiatristsecretaryslasher killerserial murderer
Period:
1960syear 1960
Story:
horror movie remadegrindhouse filmmutilated bodydrive in classicremadedisturbingbutcheryslashingmysterious manbad guybutchervictimgrindhouselifting someone into the airmutilation β€¦killingstabbed to deathwomanstabbingcaliforniacorpsesurprise endingviolencebloodbased on novelone word titleinterviewflashbackbare chested malephotographshowertelephone callvoice over narrationunderweararrestundressingsecretbathroomjailhallucinationvoyeursubjective cameragood versus evilnewspaperbradisguisewidowtoiletstabbed in the chestbirdbathold womanstalkerwidowerfirst of seriescharacter's point of view camera shotmistaken identitymissing personscreamlong takefemale removes her clothescountrysidewitnessbasementtrapmurdererfirst partthreatened with a knifecross dressingmaniacprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintingblockbusterimpersonationphone boothpsychoskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormbody countextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathpsychoticpsycho killerfemale stockinged feetimpotenceserial murdervillain played by lead actorpsychopathic killermadmandirector cameoold dark househuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationhomicidal maniacdisposing of a dead bodydomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderbloody violencefemale victimreclusesadistic psychopathmurder of a nude womanmurder spreesilhouettefade to blackpeep holedisturbed individualcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in brapsycho terrorloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanscreaming in horrordragging a dead bodydriving in the rainfalse accusation of murderslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
evilfeardeathmurderfriendshipsurrealismkidnappingrapetorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadism β€¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
darknessgorenightmarecar chasenightslasherblood and gore
Locations:
rural settinghospitalforestbathtubwoodsroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
mysterious villainterrorvillainboymother son relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipfriendbrother sister relationshipteenage girlfemale protagonist β€¦serial killerstudentbest friendkillerfrenchslasher killerbest friendsserial murderermysterious killerdeath of boy (See All)
Story:
grindhouse filmkilling spreeevil manbutcherylistening to a radioslashingbad guyslaughterbutchergrindhousemass murderstabbed in the stomachmutilationkillingimpalement β€¦stabbingdecapitationdead bodycorpsesurprise endingchaseknifebloodviolencefemale nudityf ratedbare breastsfemale frontal nudityflashbackmasturbationdogguncigarette smokingphotographlesbian kissshowertelephone calldreamblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashlow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective camerasurvivalflashlightbound and gaggedaxemassacrethroat slittingstabbed in the chesthousesevered headscantily clad femalevanon the rundolldeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropeblood spattersplatterchild murdermaniacchainsawfireplacekilling an animallistening to musicsurvivorpsychosevered handstrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistperversionmurder of a childswingclassmatebody countaxe murdersexual assaultcharacters killed one by oneparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillanceearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathcornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Collector (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β€¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
american horrorindependent filmsuspenseindependent horrorsadistic horrorslasher horrorhorror b movie
Themes:
evilescapemurderdeathtorturepsychopathbrutalityinsanitysadismhome invasionexploitationcrueltymurder of a police officer
Mood:
gorenightslasherblood and gore
Locations:
strip clubtrying to escape
Characters:
mysterious villainterrorvillainhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlserial killerhostagethiefkillerself mutilationtalking to oneself in a mirrorthe family β€¦mysterious killerkiller dogdirector of photography (See All)
Story:
grindhouse filmwoman in jeopardyevil manmutilated bodybutcheryslashingmysterious manbad guyslaughterpsychotronicbutchervictimmutilationtape recorderchild in peril β€¦stabbed to deathimpalementstabbingdead bodycorpsesurprise endingknifetwo word titleviolencebloodfemale nuditycharacter name in titlebare breastsfemale frontal nudityflashbackfightcigarette smokingnippleslesbian kisspistolbeatingblood splattermirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbed in the chesthousetied to a chairscantily clad femalehit by a cardangerscreamingelectrocutiondebtscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrorhammerhidingspiderdesperationpsychocovered in bloodteddy bearhomeanimal attackhomicidemasked maneaten aliverampageburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the faceescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirewifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiredead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

Night Of The Living Dead (1968)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Night Of The Living Dead (1968)

Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou β€¦nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)

Subgenre:
american horrorcreature featurecult filmindependent filmsuspensetragedyallegorysurvival horrorzombie apocalypsezombie survivalindependent horrorzombie outbreak
Themes:
escapefeardeathmurderrevengemarriagemilitarybrutalityparanoiapanicapocalypsecannibalismcourageself sacrificepolice brutality β€¦near death experienceradiation (See All)
Mood:
darknessgorenightone night
Locations:
rural settingforestcarhelicoptercemeterywoodskitchenfarmtruckpennsylvania
Characters:
terrorsheriffzombiehusband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorbrother sister relationshipprofessorpolice dog
Period:
1960syear 1968year 1967
Story:
horror movie remadegrindhouse filmmutilated bodygrimhell on earthdrive in classicremadeghoulliving deadpsychotronicpower outagegrindhouseelectronic music scoregothicundead β€¦cult directorstabbed to deathwomanstabbingcorpsesurprise endingchaseknifeviolencebloodfemale nuditybare breastsfemale frontal nuditydoggunfemale rear nudityfightcigarette smokingexplosionpistolfiretopless female nudityhigh heelsbeatingshot to deathblood splatterfistfightfoodcar accidentshot in the chestface slapshot in the headshotgunrescuepunched in the facewatching tvbrawlbare buttrifleheld at gunpointrunninglow budget filmrevolvertelevisionscientistshot in the backsurvivalfoot chaseaxemassacrebridgearmystabbed in the chesthouseexploding carman with glassescultradiocontroversycreaturegraveyardpantyhosenews reporttransformationshot in the foreheadlimousinegravetreebeaten to deathdangerscreamingperson on fireattackfirst of seriesactor playing multiple rolesrace against timeknocked outscene during end creditsshot in the shoulderdeath of brotheramerican flagtragic eventexploding bodyisolationbasementdie hard scenariofirst partdirectorial debutsevered armgeneralhandgunvigilantewashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned alivemutantdiseasevirusbarnloss of loved onehammerimpersonationsevered handskulltorchend of the worldwhite housesocial commentaryback from the deadeaten alivecamera shot of feetseriescameobraverycannibalmercilessnesschaosresurrectionbroken glassinsectescape attemptscene after end creditsinfectionone daysiegegasolinemutationcellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterintestinesmolotov cocktailcremationgerman shepherdblack manpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillypatricidequarreloffscreen killingfriends who live togetherhandshocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manpsychotronic filmimprovised weaponfade to blackfamous lineheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieexpertnational guardmultiple cameosporchtire ironanthropophagusmass deathrefugeends with deathjarentrailszombificationhunting rifleheadshotlivermeat hooknon personbabehole in chestblack man white woman relationshipreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenusexplanationhit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All)

Friday The 13th Part III (1982) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  β€¦friends. (Read More)

Subgenre:
american horrorcult filmslasher flick
Themes:
murderdeathrevengepsychopathabductionexploitation
Mood:
darknessgoreslasher
Locations:
lake
Characters:
terrorvillainteenagerboyfriend girlfriend relationshipteenage girlteenage boyserial killerkillerslasher killerserial murdererlow self esteemmysterious killer
Period:
1980s
Story:
grindhouse filmkilling spreeevil mandrive in classicdisturbingslashingbad guyslaughterpsychotronicgrindhousemass murderlifting someone into the airimpalementbloodsex β€¦nuditynumber in titlesequelshowerdigit in titlebikinimasknumbered sequelsubjective cameraaxethird partcharacter's point of view camera shotmurderercabinsevered armdismembermentsplattermaniacmacheteragebarnroman numeral in titlepsychosevered handmasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storestabbed in the eyecharacters killed one by onesequel to cult favoritemasked killerpsycho killertorso cut in halfserial murderpsychopathic killercar troublemadmandefecationhuman monstersexual violencehomicidal maniacshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitysadistic psychopathpsychotronic filmbiker gangmurder spreemass murdererdisturbed individualcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titlehockey maskgiallo esquesequel to cult filmyo yoskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Witch (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witch (2015)

New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a β€¦ family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)

Subgenre:
american horrorindependent filmsuspenseconspiracybritish horrorfolk horror
Themes:
evilsupernatural powerfearghostmurderdeathkidnappingreligionmagicdeath of fatherdeath of motherredemptionguiltinsanityillness β€¦dyingdevilmadnesswildernessfather love (See All)
Mood:
darknessgorerain
Locations:
campfirerural settingchurchforestvillagewoodsfarmenglandnew englandbackwoods
Characters:
little boyterrorvillainboychildrenmother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipsingerbrother brother relationshipbrother sister relationshipteenage girl β€¦babysister sister relationshipchristianreference to godlittle girlbiblewitchbaby boythe familydeath of boymother loveasking for forgiveness (See All)
Period:
winter17th century1600s
Story:
killing spreebutcheryslashingslaughterbutchermass murdergothicwomanstabbingdemonknifeviolencebloodfemale nuditynudity β€¦male nudityfemale frontal nuditymale rear nuditydogbare chested malekisssingingcryingsongblood splatterfoodhorseundressingsecretlieriflehallucinationreference to jesus christprayersubjective cameracandlestrangulationaxeeatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessionrabbitdeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickendirectorial debutsleepingtwinwolfeggwitchcraftcrying womancrying manburialanimal attackgoatapplepromisetensionhypocrisysonhungershovelpridemurder of a childlanterndead boydemonic possessionfieldbonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismwhisperingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornchild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All)

Ghost Ship (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ghost Ship (2002)

After discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre ocurrences happen and the group becomes trapped inside the ship, which they soon learn is inhabi β€¦ted by a demonic creature. (Read More)

Subgenre:
cult filmsuspensesurvival horror
Themes:
supernatural powerghostdeathmurderbetrayaldrunkennessdeceptionangerguiltgreed
Mood:
gorerain
Locations:
ghost shipshipseabarocean
Characters:
little girllustghost in mirror
Period:
1960syear 1962zip line
Story:
demonicmaggotmass murdertreasuregoldstorytellingchild in perilimpalementwomandecapitationcorpseviolencebloodfemale frontal nudityflashback β€¦female rear nuditycigarette smokingphotographtitle spoken by characterexplosionpistolshot to deathblood splattermachine gunshot in the chestshot in the headshotgunpunched in the facefalling from heightvomitingheld at gunpointislandsubjective cameraflashlightmassacreambulancedeath of friendthroat slittingmapsevered headradiounderwater scenefemme fatalecigar smokingnecklacedrowningshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firepoisonknocked outdeath of childskeletondisappearanceexploding bodyhauntingratsevered armdismembermentchild murderitaliancaptainburned alivelooking at oneself in a mirrorshot in the stomachbuttocksfemale singersevered handwatching televisionstabbed in the throatstabbed in the legsoulsintorso cut in halfapparitionfemale removes her dressshipwreckburnt faceshot in the eyetavernpoisoningdripping bloodrazor bladescuba divingpassengeraltered version of studio logocruise shipsole black character dies clicheshape shifterimmortalexploding shipcut into piecessole survivorpool of bloodvillain not really dead clichelocketradarballroomstraight razorballroom dancingcruiseexploding boatfalling through the floorc4 explosivessliced in twostabbed in the foothundred dollar billfall to deathlocked inblowtorchmorphingfreak accidentocean linerstartledrock paper scissorssinking shiphead cut in halfshaving headspear gungold barindoor swimming poolrat poisonwoman wearing a red dresssalvagehanged childhung from a hookconstruction cranepile of moneytugboathit with a metal pipeavaricefalling to one's deathrustshell casingchild ghostlogbookdigital watchluxury linerpoisoned foodevil markfall through floorbering straitcan of beansfalling into poolhiding in a freezership collisionbenevolent spirittug boat (See All)

The Prophecy (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Prophecy (1995)

"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β€¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)

Subgenre:
cult filmindependent filmblack comedysuspensedark fantasychristian horrorreligious horror
Themes:
evilsupernatural powerescapefeardeathmurdersurrealismkidnappingreligionbetrayaljealousyfuneralinvestigationdeceptionpsychopath β€¦brutalityparanoiadepressioninsanitysadismhopepanicdyingapocalypsecannibalismhomelessnessdevilmurder of a police officernear death experienceghost townreligious conflict (See All)
Mood:
darknessneo noirarchive footage
Locations:
small townchurchhospitalschoolcemeterylos angeles californiadesertapartmentpolice stationpolice carrooftopcatholic churchschool busschool teacher
Characters:
catholic priestsheriffpriestzombiepoliceteachergirlsoldierpolice officernursedetectivepolicemanhostagechristianlittle girl β€¦native americanwaitresschristianitypolice detectiveteacher student relationshipbiblegrandmother granddaughter relationshiphomeless mancoronerdeath wish (See All)
Period:
1990s
Story:
killing spreeevil manmaggotliving deadeye gougingautopsyelectronic music scoregothicundeadkillingchild in perilimpalementcaliforniademondead body β€¦corpsesurprise endingknifeviolencebloodflashbackgunkissfightcigarette smokingphotographtitle spoken by characterexplosionfirevoice over narrationcryingbeatingshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewritten by directorbrawlfalling from heightshowdownheld at gunpointsunglasseshallucinationhandcuffsprayerrevolvershot in the backgood versus evilsurvivalorphanflashlightambulancesuicide attemptdinerdisarming someonecoffinnarrationhit by a carfictional wardouble crossritualpolice officer killedgraveyardshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerperson on fireliarfirst of seriesmissionpossessionangelrace against timestatuecover upknocked outskeletonmanipulationexploding bodyfirst partprofanitygrandmothernewspaper headlinehenchmanpizzamaniacpickup truckburned aliveshot in the stomachsociopathscene during opening creditsmorgueskullmind controlcolonelback from the deadcrime scenevisioncynicismcannibalmercilessnessresurrectionprophecyreference to satanbible quoteheavenhit on the headpunched in the chestjumping through a windowthrown through a windowaerial shotarizonachoirsoulhealingtribebody landing on a cardemonic possessionburned to deathexorcismnewspaper clippinglyingarrogancetelepathyclose up of eyesgothporn magazinelevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyshamanburnt bodybadgesymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingchantingtauntingchild with a gungrand canyoncourt martialluciferinvulnerabilitysatanhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithpyrokinesiskorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintpersonification of satandark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kalifornia (1993) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kalifornia (1993)

Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b β€¦egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thriller
Themes:
evilfeardeathmurderkidnappingrapetorturetheftpsychopathinsanitysadismphotographywritingmurder of a police officerrape and murder
Mood:
goreneo noirslasher
Locations:
barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car
Characters:
terrorvillainpoliceboyfriend girlfriend relationshipwriterhostagewaitresskillerslasher killerchinese foodserial murderershooting a police officer
Story:
killing spreeevil mandisturbingbutcherybad guybutchervictimstabbed in the stomachmutilationtape recorderkillingcrossstabbed to deathcaliforniadead body β€¦violencebloodsexfemale nuditynuditymale nudityone word titlemale rear nuditybare chested malegunfightcigarette smokingphotographtitle spoken by characterpistolshot to deathblood splattercar accidentshot in the chesturinationshot in the headshotgunbare buttbeersex standing upgay slurjournalistnarrationjourneyblack pantiesstabbed in the backon the roadautomobilemurdererarsonmaniacragepsychorape victimrapistmale underwearrampagerednecktensionstabbed in the throatgash in the facedark humorblack brabilliardsperversionrainstormbody countsexual assaultpsychoticblack bra and pantiesphysical abusepervertserial murderpsychopathic killermadmankillpistol whiphuman monsterpolice officer shot in the chestsexual violencehomicidal maniacknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countrybloody violenceabusive boyfriendlunaticsadistic psychopathmass murdererbreaking a bottle over someone's headcrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistpsycho terrorexposed breastparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All)

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β€¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedydark comedypsycho thrillersurvival horror
Themes:
evilmurderdeathkidnappingdeceptionincestpsychopathinsanitymental illnesssadismhome invasiongreedcannibalismwealthstarvation β€¦claustrophobia (See All)
Mood:
darknessgoresatireslashersocial satire
Locations:
los angeles californiaslum
Characters:
terrorvillainboychildrenpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog
Period:
1990s
Story:
grindhouse filmevil manmutilated bodyslashingbad guygrindhousestabbed in the stomachmutilationgothiccult directorchild in perilimpalementcorpseknifeviolence β€¦blooddogcigarette smokingtitle spoken by characterpistolshot to deathblood splattershot in the chestface slapshotgunbirthdayflashlightmansionhousechild abusevanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondolldeath of childskeletonbasementcharacter says i love youterminal illnessmaniacfalling down stairsfireplacekilling an animalbreaking and enteringscene during opening creditsragespiderpsychosevered handskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordpsycho killergothpervertserial murderpsychopathic killermadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowanimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

Day Of The Dead (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Day Of The Dead (1985)

Zombies rule the world, except for a small group of scientists and military personnel who reside in an underground bunker in Florida. The scientists are using the undead in gruesome experiments; much to the chagrin of the military. Finally the military finds that their men have been used in the scie β€¦ntists' experiments, and banish the scientists to the caves that house the Living Dead. Unfortunately, the zombies from above ground have made their way into the bunker. (Read More)

Subgenre:
american horrorcreature featurecult filmindependent filmblack comedyb moviepost apocalypsedystopiasurvival horrorzombie apocalypsezombie outbreak
Themes:
escapefearmurderrevengedeathsuicidebetrayaldeceptionmilitaryracismbrutalityparanoiaredemptioninsanitysadism β€¦exploitationhopeapocalypsecannibalismself sacrificeclaustrophobiaghost town (See All)
Mood:
goresatirenightmareblood and goresequel to cult horror
Locations:
beachhelicopterboatelevatorcavelaboratory
Characters:
zombieafrican americanboyfriend girlfriend relationshipsoldierreference to godbullylatinoalcoholicmilitary officerbabe scientistsexisthispanic americanzombie soldier
Period:
1980s
Story:
horror movie remadegrindhouse filmevil manhell on earthdrive in classicliving deadeye gougingautopsypsychotronicreverse footagegrindhousetape recorderelectronic music scoreundeadcult director β€¦impalementwomandecapitationcorpsesurprise endingchaseviolencebloodsequelfightcigarette smokingpistolcryingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headrescuebrawlshootingbookshowdownheld at gunpointsunglassesrunninglow budget filmislandrevolvertelephonescientistshot in the backf wordsurvivalgay slurmassacredeath of friendsevered headman with glassesdream sequenceradiothird partcigar smokingshot in the legshot in the foreheadlatex glovesracial slurtrainingone against manypilotscreamingclownattackmoaningtough girlskeletonbankshot in the shoulderinjectionglassesisolationtrapsevered armshot in the armnewspaper headlinedismembermentpowersurgerymachismoexperimentuzishavingcaptainsabotagehypodermic needlesociopathscene during opening creditsvirusmad scientistbeardcaucasianfloridadesperationcovered in bloodirishtorchend of the worldburialaction heroinemexican standoffsocial commentaryeaten alivefemale warriorrampagetensionu.s. armyresearchcynicismfight to the deathitalian americancannibalironydeath threatm 16despaircigarette lighterdead childdisembowelmentaccidental killingaerial shotblood on shirtracistsiegegasolinetrailersevered legethnic slursequel to cult favoritebrainpipe smokingtorso cut in halfintestinesyellingfemale fightercrocodilebunkertrailer homeshoutingbillboardflaskmercy killingbaseball capfemale herorazoramputationbitten in the neckeyeballcrushed headpalm treefriends who live togetherdeath of boyfrienddisembodied headfight the systemmoustacheshot through the mouthextreme violencemicroscopeflesh eating zombietwo way mirrorhit with a shovelrepeated linecurenervousnessdistrustsubterraneanbloody violencemorphinezombie violencepsychotronic filmcalendarfamous lineanti heroinefinger gunarmoryevil clownwalkmanoutbreaktechno musictoothbrushx rayed skeletonzombie attackhead ripped offpower strugglebitten in the throatfedorabandanahelicopter pilotmoney falling through the airthroat rippingbanishmentdoomsdayface ripped offbrandyprivatezombie childbodily dismembermentjamaicangoonreference to frankensteinabandoned carbitten on the armchorusham radiosedativemultiple cameossaluteanthropophagusirishmanwoman with a gunbullhornzombificationeating human fleshco pilotballadeercuban americandune buggysplit headchild shot in the headsobbingheadless corpseabandoned citydeadly diseaseamateur radioabandoned theatersinger offscreenr&bloose cannonright hand mandereliction of dutystabbed through the mouthmissile siloscally capradio operatorgroaningwhiningscary clowncursingwhimperingzombie clowndesolate cityshovel through headnewsboy capcauterymilitary jacketmurmuringtalking zombiebald zombiemaniacal laughshovel through throat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Amityville Horror (1979)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Amityville Horror (1979)

Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl β€¦osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)

Subgenre:
cult filmindependent filmparanormal phenomenasupernatural horror
Themes:
evilsupernatural powerfearghostmurderlovemarriageweddingtheftparanoiasurveillancepanicpolice investigationmurder of family
Mood:
nightmare
Locations:
churchbarmotorcyclecatholic church
Characters:
catholic priestterrorpriestchildrenhusband wife relationship
Period:
1970s
Story:
horror movie remadeevil spiritremadecoastgrindhouselifting someone into the aircrucifixgothiccrosscursedemonbloodsexfemale nudityflashback β€¦dogthree word titlepantiesbased on bookdreamshotgunvomitingbeerplace name in titleriverbedroomaxeambulancetoiletwhite pantiesnunvanparktreelibraryattacklightningscreamhauntingfirst parthaunted housechild murderoccultfireplacebabysitteragingbeardblockbustermale underwearreincarnationstairsthunderstormdemonic possessionbriefswedding receptionblindsuffocationreal estate agentclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwhite briefswoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgirl stripped down to pantiesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storycamel toetrailer narrated by percy rodriguezbare midriffevil forcemicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All)

The Evil Dead (1981) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Evil Dead (1981)

Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β€¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedysupernatural horror
Themes:
evilsupernatural powerghostmurderdeathrapedancesadismsupernatural rapebook of evil
Mood:
goreslasherone night
Locations:
forestcarwoodssinging in a car
Characters:
friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism
Period:
1980s
Story:
horror movie remadegrindhouse filmevil spiriteye gougingfogpsychotronicreverse footagegrindhousemutilationcult directorstabbed to deathstabbingdecapitationdemonsurprise ending β€¦violencebloodfemale nuditykissthree word titlefireblood splatterremakeshot in the headshotgunwritten by directorshootingbooklow budget filmcollegeriversubjective cameraaxebridgesnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutdismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendscaucasianblockbustersevered handblack humorburialtrappeddark humorstabbed in the legdead manh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womentelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationpart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All)

Blow Out (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blow Out (1981)

This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β€¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)

Subgenre:
american horrorcult filmindependent filmconspiracyb horrorpsycho thrillerpolitical thrillerpolitical conspiracy
Themes:
evildeathmurderpoliticstorturefilmmakinginvestigationpsychopathparanoiaguiltsadismsurveillanceexploitationtechnologyclaustrophobia
Mood:
neo noirnightslasher
Locations:
hospitaltrainsnowcityrooftoptrain stationpennsylvaniacar in water
Characters:
villaindoctorprostituteserial killerdetectivephotographerhitmankillerslasher killerserial murderermurder of a prostitute
Period:
1980swinter
Story:
grindhouse filmkilling spreewoman in jeopardyevil mandrive in classicdisturbingcreepyslashingblackoutbad guyslaughtervictimgrindhousemutilationtape recorder β€¦killingcult directorstabbed to deathsurprise endingchaseknifetwo word titlefemale nuditynuditybare breastsfemale frontal nudityflashbackbare chested maleguntitle spoken by charactershowerwoman on topcar accidenturinationrescuewatching tvlingerievoyeuralcoholtelephonereportercleavageassassindisguisebridgepoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessmurdererfireworksgraffititrustmaniacrecordingcaught having sexcrying womanmovie theaterphone boothpsychofrogparadedead womanmale underwearwatching televisionrampagedamsel in distressveteranmustachephiladelphia pennsylvanialonerbody countbriefscharacters killed one by onedead woman with eyes openreckless drivingpsychoticpolitical corruptionpsycho killerfilm industryinterrupted sexserial murderpsychopathic killermadmantruthsubway stationtelevision newsmotel roomhomicidal maniacrestroomgovernortv reporterwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathsadistic psychopathtapepsychotronic filmmurder spreetelevision reporterdisturbed individualbroken bottlewiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esquesadisticaudio recordingwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
paranormalsuspensesupernaturalpsycho thriller
Themes:
evilsupernatural powerescapefearghostdeathmurdersuicidekidnappingmarriagerapeprisontorturememorypsychopath β€¦paranoiadrug useinsanitymental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
darknessgorerainneo noirnightmareslasher
Locations:
hospitalswimming poolcarbathtubtaxipolice stationpolice car
Characters:
terrorsheriffvillainmother son relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipdoctortattoofemale protagonistserial killernursepoliceman β€¦lawyerreference to godkillersecurity guardpsychiatristself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
killing spreewoman in jeopardyevil mandemonicdisturbinglistening to a radioscalpelslashingblackoutbad guygothickillingmicrophonewomancorpse β€¦surprise endingchaseknifebloodviolencesexfemale nudityf ratedfemale frontal nudityinterviewflashbackbare chested malegunkissfightphotographexplosionpistolshowertelephone callfirecryingcell phonedreamblood splattercar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightaxevideo camerathroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murderscreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrusttherapypizzamaniacsyringehypodermic needleheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarreckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapemental patientmadmanelectricitykillmental breakdownhomicidal maniacsatanismblood stainspreadeagledenialhearing voicesstethoscopefallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gownbreaking glassfingerprintsnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

The Dead Zone (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dead Zone (1983)

Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...

Subgenre:
american horrorparanormalcult filmindependent filmsuspensesupernaturaltragedypsycho thrillerparanormal phenomenacanadian horror
Themes:
supernatural powerfearmurderdeathlovesurrealismsuiciderapechristmasinvestigationdeceptionpsychopathdeath of motherparanoiablackmail β€¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All)
Mood:
neo noirslasher
Locations:
churchhospitalschoolsnowwheelchairpolice cartrucktunnelschool teacherfire truck
Characters:
little boysheriffvillainmother son relationshiphusband wife relationshipfather son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officerserial killernursephotographerbaby β€¦psychiatristsnipergermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All)
Period:
1970s1980sworld war twowinterseeing the future
Story:
grindhouse filmdrive in classicslashingbad guyslaughterpsychotronicgrindhousemutilationelectronic music scoregothiccult directorchild in perilcorpsesurprise endingchase β€¦bloodfemale nuditybased on novelflashbackkissphotographtitle spoken by characterexplosionpistolfireshootoutdreamshot to deathblood splattercar accidentshot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffsrevolvertelephonef wordreportergood versus evilflashlightambulancemansionpoliticianstabbed in the chestman with glassesassassinationunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmanmaniaccold waricedestinydesireassassination attemptreference to adolf hitlerheavy rainsociopathcomaexploding buildingloss of wifepress conferencesevered handambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationscissorssenatordeath of protagonistdark herodead childrainstormbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebobased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All)

Dawn Of The Dead (1978) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dawn Of The Dead (1978)

Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the β€¦mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)

Subgenre:
american horrorcreature featurecult filmindependent filmblack comedydark comedyb moviepost apocalypseabsurdismdystopiasurvival horrorzombie apocalypseindependent horroritalian horrorzombie outbreak
Themes:
monsterescapefearrevengemurderdeathsuicidekidnappingmoneypregnancymilitaryrobberybrutalityparanoiasadism β€¦executionexploitationpanicapocalypsecannibalismpolice brutalityhuntingmurder of a police officernear death experience (See All)
Mood:
goresatirepoetic justicemurder of a boy
Locations:
restaurantcarhelicoptermotorcycleairplaneboatelevatorapartmentfarmtruckrooftoppennsylvaniafire truck
Characters:
villainpriestzombiepoliceafrican americanboyfriend girlfriend relationshipdoctorsoldierpolice officerpolicemanhostagetough guywarriorsecurity guardprofessor β€¦sniperpolice shootoutsexistpolice doghispanic americanhunting partymurder of a girl (See All)
Period:
1970s
Story:
horror movie remadegrindhouse filmhell on earthdrive in classicremadedocksspiral staircaseliving deadbad guyslaughterpsychotronicbutcherpower outagegrindhousemass murder β€¦electronic music scoreundeadcult directorstabbed to deathwomandecapitationswordcorpsesurprise endingchaseknifeviolencebloodsequeldogbare chested maleguncigarette smokingphotographexplosionpistolfireshootoutbeatingarcade gameshot to deathblood splatterfoodmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewatching tvcamerawritten by directorbattlegunfightfalling from heightvomitingrifleheld at gunpointsunglassessecond partbedlow budget filmrevolvertelevisioncombatkung fuscientistshot in the backsubjective cameragood versus evilsurvivalgangambushaxemassacreambulancebasketballdeath of frienddrug dealermontagebridgefootballtoiletstabbed in the chestexploding carsevered headnunradiohit by a carcontroversycreaturepolice officer killedvannews reportcigar smokingshot in the legshot in the foreheadracial slurtrainingone against manypilotbinocularscharacter repeating someone else's dialoguedangerstabbed in the backscreamingprotestsuburbperson on fireattackcharacter's point of view camera shotmoaningknocked outkicked in the facedeath of childtough girlbaseball batopening action scenebankscene during end creditsscarbasementdie hard scenariothreatened with a knifesevered armshot in the armhandgundismembermentchild murderstylized violencehenchmanrioteyeglassesdisasterhand grenadecard gamesupermarketgrenadebow and arrowburned alivehead buttlooking at oneself in a mirrormachetesociopathscene during opening creditshelmetdiseaseviruscowboy hatsecurity camerawalkie talkiehunterloss of loved onebeardhammerkicked in the stomachswat teamsevered handcovered in bloodend of the worldburialgun fuinterracial friendshipsocial commentarybikercannoneaten alivefemale warriorgas maskthugredneckstealing a cartarget practiceu.s. armycrossbowdual wielditalian americancannibalmercilessnesschaosstabbed in the neckshot in the faceshopping mallm 16escape attemptstabbed in the headcigarette lighterstabbed in the legexploding headpunched in the chestice skatingdisembowelmentoutlawghettoinfectionaerial shotblood on shirtracisttough copdisfigurementknife throwingsiegegasolinephiladelphia pennsylvaniapolice raideye patchbody countdead boymutationsevered legethnic slurdeath of loved oneburned to deathmoral dilemmamannequinmedia coveragefirefighterhit with a baseball batleather jacketdead girlbanditmexican americanblood on camera lensintestineshysteriasidekickcandyhiding in a closetvomithead blown offepidemicgolf clubquick drawstolen moneyplaguebroken windowmallstabbed in the armclimbing through a windowgang violencefalling into waterflaskflaredepartment storeshot in the eyeanarchyhit by a trucksawed off shotgunhillbillymercy killingoffscreen killingbitten in the neckpiecheesen wordfriends who live togetherconsumerismdeath of boyfriendmoustacheperfumecar set on firedirector also cinematographerextreme violencemeteorflesh eating zombiegraphic violencemotorcycle gangrepeated linewalking deadairfieldoutlaw gangcrowbarpuerto ricanradio newsbloody violencehit with a hammerzombie violencevending machinesledgehammertommy gunbiker gangshot through a doorgang leaderhedonismshopping cartcalendardreadlockselevator shaftfamous linekicking in a doorsocial decayberetoutbreaktechno musiczombie attackmotorcycle with a sidecarbitten in the throatlootingvinylice rinkhardware storejewelry storebandanabloody body of a childhelicopter pilotmacewrencharm ripped offrookie copdoomsdaynewscasterdecomposing bodysurprise during end creditsreanimationwheelbarrowbarricadedinner dateharley davidsonheadbandsecret passagewayvideo arcadezombie childmartial lawjamaicancircular sawblowtorchphoto boothflesh eatinghangarpolice vigilantismblockadehousing projectgas grenadegolf ballham radioloss of boyfriendmidnight moviescalpingabsurd violencenational guardtire irongun storeanthropophagusmass deathtennis racketcontemplating suicideentrailsgory violencezombificationsombrerotennis ballair ventbaseball glovehare krishnadumb policenewsroommorning sicknessleg ripped offderringergrowlingclaustrophobichordedeadly diseaseamateur radiogun shopstabbed in the eardouble child murderend of civilizationtelevision stationcomplainingevil nuncontemporary settingemergency broadcast systemright hand manfirearm pointed at the cameragang that lives togethermilitary jeepracist copbiker chickdereliction of dutysidecarpie fightscally capthompson gungroaningracket ballpropanebikersbitten in the armmorning starshort wave radioshot at the camerabattle cryshooting a childbitten in the leggearing uphelicopter landing padlooternewsboy capbiker womenknit capmass panicmilitary jacketabandoned shopping mallbald zombiebiker babelong haired bikermuzak (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Devil's Rejects (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β€¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
cult filmindependent filmblack comedypsycho thrillersadistic horror
Themes:
evilescapefearrevengedeathmurderfriendshipsuicidekidnappingrapebetrayaltorturedeceptionseductionanger β€¦psychopathdeath of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All)
Mood:
gorenightmareambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
terrorsheriffvillainmother son relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitute β€¦police officerserial killernursehostagetough guymaidpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
grindhouse filmkilling spreeevil manmutilated bodybutcherybad guyslaughterbutchergrindhousemass murderstabbed in the stomachcult directorchild in perilstabbed to deathimpalement β€¦dead bodycorpsechaseknifeviolencebloodsequelflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionpantiespistolshowerfireshootoutwoman on topbeatingdreamshot to deathblood splattermachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partlow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealerthroat slittingcocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herodouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcowfreeze framestylized violencemaniachead buttlooking at oneself in a mirrorscene during opening creditsragecowboy hatkicked in the stomachphone boothcovered in bloodrapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultsevered legdeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingmadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodnecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Dracula 2000 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula 2000 (2000)

In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β€¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)

Subgenre:
cult filmmartial artscoming of ageblack comedysuspensesupernaturalheist
Themes:
evilsupernatural powerescapefearrevengemurderdeathfriendshipsurrealismsuicidekidnappingbetrayaldeceptionseductionrobbery β€¦death of fatherparanoiasurveillancehome invasionpanic (See All)
Mood:
gorenightmare
Locations:
shipchurchschoolcemeteryairplanelondon englandtaxiairportpolice stationrooftopcatholic church
Characters:
catholic priestpriestfather daughter relationshipdoctorhostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholic
Period:
2000s
Story:
killing spreeevil manmistreverse footagecrucifixgothicundeadcrosscursestabbed to deathimpalementdecapitationswordcorpsesurprise ending β€¦chaseknifeviolencebloodsexcharacter name in titlenumber in titleflashbackbare chested malegunfightphotographexplosionpartylesbian kisspistoldreamshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the facearrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf wordgood versus evilsurvivalfoot chasebedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendthroat slittingmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotstabbed in the backkeyperson on fireproduct placementrace against timeknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationinjectionneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlescene during opening creditssecurity camerastealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romanceexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All)

Night Of The Living Dead (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Night Of The Living Dead (1990)

A remake of George Romero's 1968 black-and-white classic that begins in a cemetery, as the recently-dead return to life - from an unknown cause - and attack the living as their prey. One woman escapes the frightening zombies to take refuge with others in a farmhouse, as every cadaver for miles aroun β€¦d hungers for their flesh. Will they make it through the night...that the dead came back to life? (Read More)

Subgenre:
american horrorcult filmsuspensesurvival horrorzombie apocalypsezombie outbreak
Themes:
fearmurderdeathsuicideapocalypsecannibalismmadnesswilderness
Mood:
darknessgorehorror movie remakeblood and gorezombie film
Locations:
helicoptercemeteryamericapennsylvaniabackwoodsback country
Characters:
terrorzombieafrican americanboyfriend girlfriend relationship
Period:
1990syear 1990
Story:
hell on earthdrive in classicdisturbingcreepybutcheryghoulliving deadbutcherundeadkillingwomandead bodycorpsebloodmale nudity β€¦male rear nuditybare chested maleexplosionfireblood splatterremakeshot in the headshotgunbeerexploding cargraveyardpantyhoseshot in the foreheadperson on fireattackcountrysidebasementvigilanteblood spattersplatterchainsaweyeglassesvirusloss of loved oneloss of wifesevered handend of the worldback from the deadbikereaten alivecamera shot of feetredneckinvasionchaosdead childdead manloss of brotherfemale stockinged feetleather jacketloss of daughterfarmhousefoot closeuphillbillycarnagefriends who live togethersole black character dies clicheextreme violenceflesh eating zombiegraphic violencewalking deadbloody violencesole survivorzombie violencebiker gangbody partoutbreakzombie attackpittsburgh pennsylvaniabitten in the throatdoomsdayzombie childflesh eatingruralmultiple cameosanthropophagusgory violenceeast coastremake of cult filmzombificationeating human fleshgruesomebody partsflesh eating zombiesfighting womenzombie bitecult favoritedeadly diseaseflesh eaterloss of family memberzombie invasionbald zombie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween H20: 20 Years Later (1998) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β€¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerslasher flickteen horror
Themes:
evildeathmurderdrugspsychopathparanoiainsanityabductionalcoholism
Mood:
high schoolnightmareslasher
Locations:
small townschoolelevatorkitchentruck
Characters:
mysterious villainterrorvillainmother son relationshipfamily relationshipspoliceteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlserial killernursepoliceman β€¦security guardalcoholicsecretaryslasher killer (See All)
Period:
1990syear 1998
Story:
evil manslashingmysterious manbad guyvictimlifting someone into the airstabbed to deathstabbingcaliforniadecapitationdead bodychaseknifeviolenceblood β€¦number in titlesequelpistolcar accidentfalling from heightmaskbirthdayneighborhallucinationtelephonesubjective cameragood versus evilhalloweenflashlightwinecandleaxeambulancedeath of friendthroat slittingtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityactor shares first name with characterstalkingreunionflowersplattermaniacbreaking and enteringheroinesurvivorrageloss of friendhidingpsychofaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingbody countaxe murdercharacters killed one by onedivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen carserial murderpsychopathic killeranniversarybeheadingcar troublemadmanfire extinguisherreturning character killed offhiding in a closetgatehomicidal maniacbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All)

Prince Of Darkness (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Prince Of Darkness (1987)

A sinister secret has been kept in the basement of an abandoned Los Angeles church for many years. With the death of a priest belonging to a mysterious sect, another priest opens the door to the basement and discovers a vat containing a green liquid. The priest contacts a group of physics graduate s β€¦tudents to investigate it. Unfortunately, they discover that the liquid contains the essence of Satan himself, and they also discover that he will release HIS father - an all-powerful Anti-God! The liquid later comes to life itself, turning some of the students into zombies as the Devil comes forward to release his father. Will these students be able to stop him? (Read More)

Subgenre:
cult filmblack comedysuspensesupernaturalsupernatural horrorchristian horror
Themes:
supernatural powerescapefeardeathmurdersurrealismsuicidereligionpregnancydeceptionparanoiafaithunrequited loveapocalypsephilosophy β€¦self sacrificedevilnear death experiencescience versus supernatural (See All)
Mood:
darknessnightmareambiguous ending
Locations:
churchlos angeles californiapolice carcatholic church
Characters:
catholic priestpriestzombiefather son relationshipafrican americanboyfriend girlfriend relationshipdoctorstudentbibleprofessorcatholicasian americanself mutilationengineerhomeless man β€¦babe scientistreligious icon (See All)
Period:
1980s1990s
Story:
music score composed by directormaggotliving deadpower outagecrucifixelectronic music scoreundeadcult directorstabbed to deathimpalementdecapitationdemoncorpsesurprise endingchase β€¦knifebloodbare chested malefightcigarette smokingsingingthree word titlebeatingdreamblood splatterfistfightmirrorrescuepunched in the facecomputerbrawlsecretfalling from heightcollegeclassroomsciencescientistgood versus evilsurvivalflashlightcandleaxeambulancethroat slittingstabbed in the chestsevered headnundream sequencenews reporttransformationracial slurlimousinestabbed in the backkeypay phonepossessionrace against timecover upcollege studentlightningdiarydisappearancedeath of sonbasementneck breakingpremarital sexsevered armtypewriterdismembermentpizzaoccultcard gamelooking at oneself in a mirrorkicked in the stomachsevered handmind controlend of the worldfull moonwatching televisioncrime scenevisionblood on facestabbed in the throatgash in the faceinsecttitle appears in writingescape attemptreference to satanthrown through a windowdisfigurementsiegestabbed in the eyelooking at self in mirrordemonic possessionsevered legbruiseethnic slurtelekinesisplaying cardstranslatorcartoon on tvhiding in a closethit in the facedefecationcomputer crackerportalbugcomic reliefsecret societybroken mirrorinsomniainterracial kisslatinwormantphysicsstabbed in the shouldertitle in titleparasitehomeless persondead birdsymbolarm cut offhoboimprovised weaponbreaking through a dooralternate dimensionsectliquidantichristclimbing out a windowsocial decayregenerationstabbed with scissorsbeetlecard trickphysicisttranslationinvulnerabilitygraduate studenthomeless womantelling a jokequantum physicsentrapmentsubliminal messagebroadcastevil godstabbed through the chestvagrantrecurring dreamabandoned churchdream within a dreampessimismtrapped in a buildingcontainerastral projectionshared dreamlovecraftianclaustrophobicreanimated corpsesupernovabreaking through a wallunicyclehit with a brickchinese takeoutuniversity campustheoretical physicsmarkresearch scientistcylinderyawntachyonradiologistscience vs religiondefying gravity (See All)

The Shallows (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Shallows (2016)

In the taut thriller The Shallows, when Nancy (Blake Lively) is surfing on a secluded beach, she finds herself on the feeding ground of a great white shark. Though she is stranded only 200 yards from shore, survival proves to be the ultimate test of wills, requiring all of Nancy's ingenuity, resourc β€¦efulness, and fortitude. (Read More)

Subgenre:
american horrorcreature featureblack comedysuspensefound footagefish out of wateraustralian horrorspanish horror
Themes:
monsterescapefearmurderdeathdeceptiondeath of motherparanoiacancerpaniccouragenear death experience
Mood:
darknessgorepoetic justice
Locations:
seawaterbeachforestoceanmexicotexasblood in watersea water
Characters:
little boyterrorvillainboyfather son relationshipfather daughter relationshipfemale protagonistsister sister relationshipthiefhispanicamericansingle fatherdriverself surgery
Story:
grindhouse filmwoman in jeopardyhell on earthvictimimpalementstabbingcorpsesurprise endingchasetwo word titleviolencebloodflashbackphotographfire β€¦cell phoneblood splatterrescueslow motion scenecamerabikinishowdownislandf wordsubjective cameraswimmingsurvivalbranonlinear timelineno opening creditsunderwater scenelooking at the cameranecklacetalking to the cameraracial slurflash forwarddangerscreamingwidowerelectrocutionattackrace against timetough girlstalkingsplit screendie hard scenarioloss of mothersingle parentstrong female characterrocktouristhelmetstealingwristwatchdesperationsurfingsharkladderstrong female leadanimal attackeaten alivemexicanfemale warriordivingtensiontrappedbraverysandhungerescape attemptdrunkaerial shotsexy womancellphonechainethnic slurfast motion scenetorso cut in halfclose up of eyestext messagingfinal showdownminimal castvomitwhaledead animalhomagesurferearringseagullyoung womandrunkardflarefoot closeupdolphinpursepredatorcoughingfemale heroepiloguesurfboardpalm treemedical studentcrabsoccer ballvideo footageold photographtextingin medias rescamera phonepsychotronic filmimprovised weaponflare gunmurder spreeanimal killingwavebilingualismshark attackextreme close upleg woundcat and mousejellyfishtalking to selfrescue attemptwine bottletime limitflesh eatingsingle set productiontalking to an animaltijuana mexicotidal wavestopwatchkiller sharkanchorlittle sistershoredehydrationhypothermiayelling for helpeating human fleshgreat white sharkpreyagainst the oddsman eaterreefbody partstidecut off jeansbuoyjawsripped in halfcellular phonegangreneamerican touristtough womancontainmenthumpback whalesmiley faceflare gun as weaponman versus naturesunscreensurfer girlthrowbackone year lateropening creditsreference to steven seagal1 year latergoprofemale surfertalking to a birdalone against the oddsshark bitelow tidebitten in the legtext messaging on screenbig wavehigh tidebroken wingcalling someone buddy (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Fright Night (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fright Night (1985)

For young Charley Brewster, nothing could be better than an old horror movie late at night. Two men move in next door, and for Charley with his horror movie experience, there can be no doubt that their strange behavior is explained by the fact that they are a vampire and his undead day guardian. The β€¦ only one who can help him hunt them down is a washed-up actor, Peter Vincent, who hosts Charley's favorite TV show, Fright Night. Vincent doesn't really believe that vampires exist, but does it for the money... (Read More)

Subgenre:
cult filmpost modernstop motion animationteen movieteen horrorhorror spooflgbt horrorvampire comedy
Themes:
supernatural powerdeathherovoyeurismseductionfaithpolice investigation
Mood:
gorespoofnight
Locations:
small townnightclub
Characters:
villainsingle mothermother son relationshippoliceteenagerboyfriend girlfriend relationshipteenage boyserial killerdetectivepolicemanactorvampiregirlfriendparent child relationshipneighbor neighbor relationship
Period:
1980s
Story:
horror movie remadegrindhouse filmwoman in jeopardyremadeghoulreverse footagelifting someone into the aircrucifixundeadcrossimpalementsurprise endingchasetwo word titleblood β€¦violencefemale nuditynuditymale nuditymale rear nuditybare chested maleguntitle spoken by characterpistoltopless female nudityshot to deathmirrorshot in the chestpunched in the facewatching tvwritten by directorundressingfalling from heightpaintingheld at gunpointneighborvoyeurgood versus eviltoplessstabbed in the chesthousesevered headcoffinnews reporttransformationshot in the foreheadbinocularsvirginsuburbskeletonscarhigh school studentstalkingexploding bodywitnessbasementcharacter says i love youfirst partwerewolffalling down stairswolfburned alivehunterteenage protagonisthypnosisjumping through a windowfriendship between boysdead boylevitationstabbed in the handhorror hostmale friendshipcamera shot of bare feetbroken mirrorkiss on the lipsrhyme in titlebitten in the necksuper powerbra removingbloody violencevampirismhomosexual subtextvampire hunterpsychotronic filmblack coplifting person in airglowing eyesholy watervampire slayerjumping out a windowtv hostthroat rippingolder man young girl relationshiphand injurystakelifted by the throatnext door neighborgarlichowlingsunlightnew neighbortv starwashed up starstabbed in the heartshort haired femalevampire bitered eyesthreatening telephone calldead body in a car trunkteenage sonpointing a gun on someonevampire batseductive manboyfriend girlfriend conflictreflection in a mirrorgrabbed by the throatstabbed with a pencilfanboyeviction noticeusa horror hosttv personalitymale vampireseductive dancereflection in mirrormelting manbat attackreference to bela lugositeenager in dangerhuman versus vampirestake through the heartno reflectionvampire driving a carthrown across a roomtruth taken as a liereference to christopher leenosy motherpunch catch (See All)

Critters (1986) is one of the best movies like The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Critters (1986)

A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.

Subgenre:
creature featurecult filmindependent filmblack comedysuspenseb moviesurvival horrormonster movie
Themes:
supernatural powermonsterescapefeardeathmurderlovesurrealismkidnappingdrunkennessdeceptionparanoiahome invasionpaniccourage β€¦near death experiencespace travel (See All)
Mood:
satirenight
Locations:
small townchurchbarhelicopterbicyclekitchenpolice stationfarmpolice carrooftopouter spacebicycle accident
Characters:
little boysheriffpriestmother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlpolice officeralien β€¦hostagealcoholicalien monster (See All)
Period:
1980s
Story:
woman in jeopardypsychotronicpower outagereverse footageelectronic music scorechild in perilimpalementcorpsesurprise endingknifeviolencebloodone word titlecigarette smokingphotograph β€¦title spoken by characterexplosionfireshot to deathblood splattercar accidentshot in the chestshotgunrescueslow motion scenewatching tvcatrifleheld at gunpointbombcar crashrevolveralcoholtelephonesubjective camerasurvivalbedroomflashlightambushaxetoiletradiospaceshipcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionfirst of seriespay phonefugitivepoisoncharacter's point of view camera shotmissionrace against timeknocked outbaseball batlightningprankexploding bodyfirst partfireworkscowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveeggscene during opening creditsbarnjail cellspacecrafteccentricphone boothlasersocial commentarybroken legeaten alivemechanicredneckwhiskeyalien invasiondamsel in distressstealing a carbraveryimpostormercilessnesschaospool tableevacuationhousewifeescape attemptcigarette lighterhologramone daybounty huntersiegebowlingbroken armdead boymutationlaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All)

It (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It (2017)

In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.

Subgenre:
american horrorsupernatural
Themes:
evilsupernatural powermonsterfearmurderdeathmemoryracismpsychopathbrutalitysadismbullyingabductionhomophobiacruelty β€¦childhoodcannibalismmadnessmissing childunlikely friendshipschool bullyingsupernatural powers (See All)
Mood:
gore
Locations:
small townschoolforestbicyclesewernew boy in town
Characters:
little boyvillainzombiechildrenpoliceteenagerserial killerbullyjewchildhood friendbar mitzvahboy in underwearevil father
Period:
1980ssummeryear 1989year 1988
Story:
killing spreehell on earthleperdisturbingghoulbad guybutchermutilationkillingchild in perildemonviolencebloodbased on novelone word title β€¦flashbackkisstitle spoken by characterblood splattercatbattlepaintingbookbathroompianogay slurnewspaperchild abusechildcoffincreaturelibraryclownmissing persondeath of brotherbasementbrothermurdererfirst partsevered armgaragesplattermaniacsistereyeglassesballoonstreetsexual abuseoverallspsychocovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatpedophilemurder of a childturtleabusive fatherbroken armcellarloss of brotherpsycho killerheroismunderdogpervertspittingpsychopathic killergirl in bra and pantiesoutcastwoodabandoned housebicyclinghomicidal maniacwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringbloody violenceteenage girl in underwearpool of bloodreference to michael jacksonoverbearing mothersadistic psychopathold houseglowing eyesevil clowncreepsidewalkdeeply disturbed personarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearpocket knifechild killercamaraderiemonsterschild murdererhypochondriachit with a rockmissing person posterscreaming in horrorsinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the faceinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to The Fog?
<< FIND THEM HERE! >>