Please wait - finding best movies...
Married realtors Jim and Sara with their children go to Gracey Manor and Mr. Gracey is enamored with Sara and they discover that Sara looks like Mr. Gracey's old girlfriend, Elizabeth, who died young and they think it was a suicide but discover something more sinister.
Themes: | fearghost |
Locations: | cemetery |
Period: | 1800s |
Story: | pipe organgiant spidernew orleans louisianahaunted mansionhaunted housebased on theme park attractionbarbershop quartetscared to deathhorror for childrencrystal ballsuit of armormausoleumballroomorgansingle player β¦evil spiritlouisianafortune tellernintendo gamecubelanternplaystation 2pool tablespiderspin offchessbased on filmskeletongravegraveyardhousemansiongood versus evilpianosinging (See All) |
300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. β¦.. (Read More)
Subgenre: | cult film |
Themes: | fearghostrevengemagicangersupernatural powerhumiliationunrequited lovefalling in lovebook of magic |
Mood: | high school |
Locations: | cemeterymotorcyclemuseumsewer |
Characters: | brother sister relationshipteenage girlteenage boyzombiesister sister relationshiplittle girlbullywitchevil witch |
Period: | 1990s17th century1700s |
Story: | haunted househorror for childrenspiderhousegood versus evilsingingtwo word titlecigarette smokingtitle spoken by charactersurprise endingfirecryingcatbedsubjective camera β¦decapitationhalloweencandletied to a chairtransformationpainvirginproduct placementdeath of childscreamscene during end creditshanginghalloween costumecabinundeadfalling down stairsburned alivetalking animallifting someone into the airhatwitchcrafttorchsevered fingerrejectionimmortalityhypnosischairhalloween partyarrogancemale virginspellcandydead animaltrick or treatingdoubtlighterbicyclingtombstonecottageshoerhyme in titlecabin in the woodssunrisepotionwarningnoosebus rideblack catpillowsaltlobsterwitch costumeliquidvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumelifting a female into the airroadkillcaged humanspit taketalking catchased by a dogevil laughterpet foodblown coverflying broomcurseddisbelieving adultlightingsiren the alarmsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettsmagical broomstickwitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All) |
Subgenre: | cult filmsuspense |
Themes: | fearmurderdeathrapepregnancyescapedeceptionevildevilmurder of family |
Mood: | goreslow burn |
Locations: | cemeteryhospitalkitchen knifeblood in carrunning water |
Characters: | husband wife relationshipfemale protagonistnurseterrorpregnanttalking to oneself in a mirrorself inflicted gunshot woundself cutting |
Period: | 1980syear 1982 |
Story: | haunted housepool tablegraveyardhousepianobloodflashbackbare chested malecigarette smokingdancingphotographknifechasesurprise endingpanties β¦pistolcorpseblood splatterblondeshot in the headwatching tvsecretdead bodycollegedemoncleavagefoot chasebound and gaggeddeath of friendthroat slittingstabbed to deathsuicide attemptfishwhite pantiesscantily clad femaleritualroommatevanstabbed in the backprologuepay phoneproduct placementknocked outcollege studentshot in the shoulderwigdeath of sonbasementpremarital sexpizzagirl in pantiesocculteavesdroppinghypodermic needlebabysitterpatientstabbed in the stomachwitchcraftcovered in bloodattempted suicidepower outageshot in the faceanxietyheadphonesbilliardsmurder of a childeye gougingcanetrophywilhelm screamlyingceremonyhairshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishfilm starts with textlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestoneritetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in feardrinking bloodrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultsatanic ritualstained glass windowstartledstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All) |
In Japan, when the volunteer social assistant Rika Nishina is assigned to visit a family, she is cursed and chased by two revengeful fiends: Kayako, a woman brutally murdered by her husband and her son Toshio. Each person that lives in or visits the haunted house is murdered or disappears.
Subgenre: | supernaturaljapanese horror filmsupernatural horrorasian horror |
Themes: | fearghostmurderdeathsuicidemarriageangersupernatural powerparanoiasadismcrueltypanictraumamurder investigationmurder of a police officer β¦missing childmysterious deathpsychological trauma (See All) |
Mood: | goredarknessmurder suicide |
Locations: | hospitalrestaurantschoolelevatorwheelchair |
Characters: | policemother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteacherpolice officerpolice detectiveghost girlmysterious girlghost in mirrorghost boy |
Story: | haunted houseevil spirithousebloodflashbackphotographshowercorpseremakewatching tvcatbedbedroomnonlinear timelinebrunette β¦searchold womanpainscreamingpossessionthreatsuspicionfirst partarsonmass murderragemutilationdesperationvisitteddy bearhomedead womansufferingsonstairsatticgasolinesocial workerpsychoticvideo surveillanceclosetdark secretlong hairstairwayrestroomblood stainpremonitionwrathmysterious womanmultiple murderchapter headingstenantblack catcrime investigationhusband murders wifemurder victimdeeply disturbed personmultiple homicideghost childremadehorror movie remadecatatoniamystery womansakewraithfear of ghostsretired copwoman journalisthomicidalhome care (See All) |
A gripping story of a family in search of help for their son, Dalton, who fell into a coma after a mysterious incident in the attic. Little do they know that there is much more to this endless sleep than meets the eye as they explore the paranormal, and rediscover the past; the key to getting their β¦son back once and for all. (Read More)
Themes: | fearghostsurrealismsupernatural powermurder of familymissing child |
Mood: | nightmaremoving |
Locations: | hospital |
Characters: | husband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipboyteacherbabyterrorcrying babymother in law daughter in law relationship |
Story: | haunted houseevil spiritlanternhousepianobloodflashbackphotographtitle spoken by charactersurprise endingshot in the chestcamerafalling from heightbookrifle β¦demonflashlightstrangulationvideo cameradream sequencedrawingchild in perilsearchflash forwardcharacter repeating someone else's dialoguecharacter's point of view camera shotpossessionfreeze framerevelationlooking at oneself in a mirrorcomagas maskbarefootheadphoneshypnosisscene after end creditsattictitle at the endplaying pianophoto albumapparitionhiding in a closetwoman cryingspiral staircasepiano playingyoung version of charactersecurityheld captivemediumclawhiding under a bedcandlelightnew houseshacklesscreaming in feardigital camerachildhood photosecurity systemmarionetteghost childwoman strangled to deathfurnaceout of body experiencenew homebaby monitorparanormal investigatoranimate objectsketchbookrocking horsemetronomefireplace pokerastral projectionhouse warmingfalling off a ladderhandprinthiding under the coversbloody hand printdoor handleviewfindernether worldnight terrorscomposing musicfeeding tubewriting a songmurder of an old woman (See All) |
A young hospice worker helping care for an invalid who lives in a remote mansion in the Louisiana bayous finds herself caught in the middle of morbid happenings centered around a group of Hoodoo practitioners.
Subgenre: | suspense |
Themes: | fearghostdeathkidnappingmarriagemagicpanic |
Mood: | rainnightmare |
Locations: | cemeteryhospitalbathtubnightclubelevatorkitchenwheelchairrooftopgas station |
Characters: | police officernursemusicianbabylawyerlittle girllittle boymaidfrenchwitch doctor |
Period: | 1920s |
Story: | new orleans louisianalouisianaskeletonmansionbloodflashbackfightdancingphotographpartyknifesurprise endingpantiescell phonedream β¦car accidentmirrorblondeshotguncamerasecretfalling from heightriverflashlightbound and gaggedcandleold manstrangulationmapritualroommategunshotattempted murderkeyumbrellalightningringhangingdomestic violencecountrysideisolationloss of fatherstagetied uprecord playeroccultropefalling down stairshypodermic needlegothicpatientservanttorchhaircutthunderjob interviewheadphonesrowboatswampsuperstitionatticrainstormvoodooblack magicmusic banddrugged drinkspellwifegardeningparalysisgateelderlycanoelizardlaundromatno title at beginningponytailparamedichusbandstrokefall from heightbusiness cardpotionnursing homenoosehouse partydumpsterritesymbolpigtailslynchinglockhatchetphonographsecret roomamerican southvolkswagen beetledustbedriddenphonograph recordshackstreetcarbayouspiked drinkinvalidpeacocksouthern gothicchalkbraidscandlelight dinnerhospicesoul transferenceincantationbedsheetvictim invited to dinnerconjurerwant addouble barrel shotgunparalyzedskeleton keyhoodoogumbo (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their β¦ courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Subgenre: | black comedyconspiracysupernaturalsurvival horror |
Themes: | fearghostmurderdeathrevengesurrealismmarriagemoneybetrayaldrinkingdrunkennessescapedeceptionseductionsupernatural power β¦paranoiainsanitysurveillanceunemploymentcourageself sacrificenear death experience (See All) |
Mood: | goreone nighthorror movie remake |
Locations: | barlos angeles californiabathtubelevatorwheelchaircave |
Characters: | husband wife relationshipafrican americandoctornursesecurity guardalcoholic |
Period: | 1990s1930s |
Story: | haunted houseevil spiritskeletonhousefemale nuditybloodfightphotographtitle spoken by characterpartyknifechasesurprise endingpistol β¦firecell phonecorpseshot to deathblood splatterfistfightshot in the chestremakerescuepunched in the facewatching tvcomputerdrinkbrawlheld at gunpointsunglassesbirthdaydemonhallucinationf wordsubjective cameradecapitationsurvivalflashlightjournalistambushaxeimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologuescreamingelectrocutioncharacter's point of view camera shotknocked outbasementhauntingsuspicionriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerskullfaked deathpresumed deadmental institutioncameobraveryguestimpostorstabbed in the neckbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothstabbed in the handfake identityabandoned houseroller coastertv reporterbillionairecameramaninsane asylumbubble bathscalpeloffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All) |
A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.
Subgenre: | cult filmparanormal investigation |
Themes: | ghostvoyeurismsupernatural powerdysfunctional familyafterlifemissing childscience versus supernatural |
Mood: | moving |
Locations: | cemeteryswimming poolkitchen |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlgirlphotographersister sister relationshiplittle girllittle boyemployer employee relationship β¦blonde girl (See All) |
Period: | 1980s |
Story: | haunted houseskeletonhousegood versus evilone word titleinterviewpantiescorpsemirrorblondewatching tvcameralingeriemarijuananeighbor β¦hallucinationvoyeurtelevisioncleavagevideo camerawhite pantiesscantily clad femalecoffinchild in perilclownsuburbfirst of serieshauntingfirst partobscene finger gesturecult directorpsychicgirl in pantiespot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieverlifting a female into the airsource musicparanormal investigatoranimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All) |
A woman named Grace retires with her two children to a mansion on Jersey, towards the end of the Second World War, where she's waiting for her husband to come back from battle. The children have a disease which means they cannot be touched by direct sunlight without being hurt in some way. They will β¦ live alone there with oppressive, strange and almost religious rules, until she needs to hire a group of servants for them. Their arrival will accidentally begin to break the rules with unexpected consequences. (Read More)
Subgenre: | suspenseparanormal phenomena |
Themes: | ghostmurderdeathsuicidereligionsupernatural powerphotographyafterlifeclaustrophobia |
Mood: | nightmare |
Locations: | cemetery |
Characters: | mother son relationshipmother daughter relationshipfemale protagonistgirllittle girllittle boybible |
Period: | world war two1940s |
Story: | haunted housegravemansionpianotwo word titlesex scenephotographtitle spoken by charactersurprise endingshotgunsuicide attemptkeyscreamhauntingpsychic β¦single parentspiritgothicdiseaseservantchild's point of viewmutesuperstitionfoghousekeepergunfirenannyphoto albumdirector cameominimal castold dark houseseancegardenermediumallergysick childnazi occupationpillowschizophrenicinfanticidecurtainlord's prayermaster servant relationshipghost childembroideryfilicidesunlightbad motherable to see the deadchild murderessrealizationenglish channelskin diseasebook of the deadfor sale signphotosensitivityxeroderma pigmentosumdeliberatejersey islandautomatic writing (See All) |
Renai is interrogated by a police detective about the supernatural events in the house. While the police investigate the house, the Lambert family temporarily moves to the old house of Lorraine Lambert. Renai is haunted by a woman in white and Josh has a strange behavior at home. Meanwhile Lorraine β¦seeks out Elise's partners Specs and Tucker expecting to find answers. (Read More)
Subgenre: | supernatural |
Themes: | ghostmurdersuicideinvestigationpsychopath |
Mood: | nightmare |
Locations: | hospitalpolice station |
Characters: | husband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipboyserial killerbabypolice detectivegrandmother grandson relationship |
Period: | 1980syear 1986 |
Story: | haunted houseevil spiritlanternhousepianonumber in titlesequelflashbackphotographknifesurprise endingcorpseface slappunched in the facesecond part β¦interrogationdemonfoot chaseflashlightbound and gaggedstrangulationvideo cameranonlinear timelinechild abusechild in perilcharacter repeating someone else's dialoguepossessionevil manknocked outbasementcross dressingmaniacsyringescene during opening creditsgas maskstabbed in the legthrown through a windowtitle at the endfemale doctordark pastnewspaper clippingmannequinhit with a baseball batclose up of eyesbad guyfire extinguisherapparitiontaserhiding in a closethuman monsterseancepiano playinghomicidal maniacyoung version of characterwhisperingmediumvhshit with a hammerdicebreaking through a doorvcrabusive mothertoothhidden roomdollhousered lightgrand pianovhs tapestartledhit with a frying panwearing a sound wireout of body experiencetranquilizerbaby monitorlucid dreamabused childabandoned hospitalrocking horsemetronomeimposterbookcasebone sawbreaking through a wallother worldtea kettleattacked with a knifetooth ripped outboy dressed as a girlfalling chandelierwooden chestsurgical tooltalking dollpipe wrenchmoving furniturestabbed with a needletooth falling outbarricading a doorroshambo (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
Subgenre: | independent filmsuspense |
Themes: | fearghostmurderdeathlovesuicidekidnappingpregnancydrinkingdrunkennessfuneralmemoryobsessionsupernatural powerparanoia β¦drug usedysfunctional familyguiltafterlife (See All) |
Mood: | rainnightmaremurder suicide |
Locations: | cemeterybathtubchicago illinois |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipchildrenboyteenage girlteenage boypolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationshipsuper hero β¦seeing a ghost (See All) |
Story: | haunted housegravegraveyardhousesexbased on novelbloodbare chested malegunfemale rear nudityfightpartyknifeerectioncrying β¦songwoman on topcorpseshot to deathblood splattershot in the chestwatching tvdrinksecretshootingvomitingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backsubjective cameraflashlightbandambulancesuicide attemptnonlinear timelinecoffinsearchtalking to the cameraproduct placementmissing personcover upattempted rapedisappearancesleepingpsychicgamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewblood on faceunderage drinkingshoveldelusionhypnosissuperstitionfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismbreaking a windowhearseloss of sisterpsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel β¦ Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
Subgenre: | suspensegothic horror |
Themes: | fearghostmurderdeathfriendshiprevengesuicidebetrayaldrinkingsupernatural powergriefadoptiondeath of wifevengeanceforgiveness β¦madnessdeath of daughterafterlifedeath in childbirth (See All) |
Mood: | rainnightmarehorror movie remake |
Locations: | beachtrainforestcarbathtublondon englandvillagewoodsrural settingengland |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboygirlsister sister relationshipreference to godlittle girllittle boysingle fathersuicide by hangingbaby boy β¦ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All) |
Period: | 1910s |
Story: | haunted housemausoleumlanternskeletongravegraveyardhousemansionbased on novelbloodviolenceflashbackdogphotographfire β¦cryingcorpsefoodmirrorrescueslow motion scenedrinksecretletterpaintingtearsrunningdead bodycolor in titletelephonenewspapercandleaxeeatingwidowaccidentdrivingchildbirdcoffindrawingsearchjourneydrowningflash forwardcurseprologuescreamingkeywidowerperson on firedolldeath of childhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of mothersleepingsingle parentfireplacelooking at oneself in a mirrorcrucifixtoyloss of wifeeccentriclossrailway stationclockthunderloss of sonwizardlostthunderstormsuperstitiondead childatticfogmurder of a childvoice over letterbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionold dark housemental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorhearing voicespocket watchloss of childlocked doorbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All) |
In Pasadena, Mrs. Davis sends her daughter Aubrey Davis to Tokyo to bring her sister Karen Davis, who is interned in a hospital after surviving a fire, back to the USA. After their meeting, Karen dies and Aubrey decides to investigate what happened to her and gets herself trapped in the same situati β¦on, being chased by the ghost of the house. Meanwhile in Tokyo, the three high school mates Allison, Vanessa and Miyuki visit the famous haunted house and are also chased by the ghost. In Chicago, Trish moves to the apartment of her boyfriend Bill, who lives with his children, the teenager Lacey and boy Jake. On the next door, weird things happen with their neighbor. (Read More)
Subgenre: | ghost story |
Themes: | fearghostmurderdeathrevengeangersupernatural powermysterious death |
Mood: | high school |
Locations: | hospitaltrainbathtubvillagerural settingjapancitychicago illinois |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother daughter relationshipteenage girlteacherpolice officernursestudentlittle boyterrorstepmother stepson relationship |
Story: | haunted househousegood versus evilnumber in titlesequelflashbackphotographsurprise endingpantiestelephone callcell phonecorpsemirrorurinationwatching tv β¦catcondomfalling from heightsecond partclassroomjournalistbraritualdrowningcursediaryneck breakingschoolgirlpsychicspiritbreaking and enteringgothicphone boothdead womantokyo japanpastdead childdeath of sisterdead woman with eyes opennewspaper clippinggothreturning character killed offphysicianaltered version of studio logoloss of sisterkiller childdarkroomvideo cassettewoman's neck brokenevil childdead woman on groundinter culturalremake by original directordefenestrationpasadena californiawraithurinating in fearfamily violencefemale urinatingestranged family memberrecords (See All) |
Dr. Markway, doing research to prove the existence of ghosts, investigates Hill House, a large, eerie mansion with a lurid history of violent death and insanity. With him are the skeptical young Luke, who stands to inherit the house, the mysterious and clairvoyant Theodora and the insecure Eleanor, β¦whose psychic abilities make her feel somehow attuned to whatever spirits inhabit the old mansion. As time goes by it becomes obvious that they have gotten more than they bargained for as the ghostly presence in the house manifests itself in horrific and deadly ways. (Read More)
Subgenre: | suspenseparanormal phenomenasupernatural horrorgothic horror |
Themes: | fearghostsuicidemarriagelesbianismobsessionsupernatural power |
Locations: | new england |
Characters: | female protagonistsister sister relationshippsychiatristbibleanthropologist |
Period: | 1960s1940s19th century20th century1870s |
Story: | haunted househousemansionbased on noveldancingvoice over narrationcar accidentmirrorbookhallucinationalcoholorphanflashlightlibrary β¦prologuestatuehangingloss of motherpsychicgraffitimaniacexperimentfalling down stairsgothicloss of wifecrushparking garageresearchboston massachusettsbalconygateold dark housespiral staircasepsychic powermagnifying glassnoisepoltergeistvoice over inner thoughtscountry estateharpnurseryremadehorror movie remadeinternal monologuedeliberate crueltyparapsychologycontemporary settingovernight in a haunted househarbinger of deathprivate libraryfeeling one is being watchedcarriage accident (See All) |
A remake of the classic 1963 movie "The Haunting" about a team of paranormal experts who look into strange occurrences in an ill-fated house. Through the course of the night some will unravel, some will question, and all will fight for their lives as the house fights back.
Subgenre: | paranormal activity |
Themes: | fearghostdeathsuicidemoneylesbianismseductionsupernatural powereviltrauma |
Mood: | horror movie remake |
Locations: | rural settingcastle |
Characters: | doctorchildrenfemale protagonistsister sister relationship |
Story: | haunted houseskeletonhousemansionbased on novelbloodtwo word titleknifesurprise endingface slapremakepaintingdecapitationbisexual β¦womanmapsevered headstatuehangingpianisthauntinggardensacrificechild murderexperimentspiritfireplacepsychologypsychologistbarefootwindresearchconfrontationdelusionsculpturelonerphoto albumposterhysteriaapparitionfountainspiral staircaseinsomniagreenhouseashesshockorchestral music scorecaretakeraccusationold housebonestupid victimpoltergeiststory tellingresearcherchild laborsecret doorperceptionghost childancestorchimneyaudio recordinginfluenzareference to martha stewartnewspaper adsheethair brushinsomniacbedsheetcurtainspsychological experimentstrange noisetalking to a ghosthall of mirrorsfuguespookovernight in a haunted houselogbookpiano wirereference to auguste rodincherubobject floats in the air (See All) |
Adam and Barbara are a normal couple...who happen to be dead. They have given their precious time to decorate their house and make it their own, but unfortunately a family is moving in, and not quietly. Adam and Barbara try to scare them out, but end up becoming the main attraction to the money maki β¦ng family. They call upon Beetlejuice to help, but Beetlejuice has more in mind than just helping. (Read More)
Subgenre: | cult filmblack comedystop motion animation |
Themes: | ghostsurrealismartsupernatural powerdysfunctional familyafterlife |
Characters: | husband wife relationshipteenagerteenage girlzombie |
Period: | 1980s |
Story: | haunted houseskeletongraveyardhousesingingcharacter name in titledogphotographcar accidentcar crashdemonman with glassespossessionhauntingpsychic β¦agentcarnivaleaten aliveministeratticdead manexorcismirreverencegothpervertdoubtgiant monsterseanceportal14 year oldyuppiefootball teamrealtornewlywedscrewballgoth girlghoulmodern arthardware storeminiaturizationreanimationlife after deathfemale ghostgiant snakeable to see the deadcandy barpleadingmouthrotting corpsecharadeschild bridegiant wormappointmentsaturnfunhousehead spinmusical sequence in non musical workcovered bridgecommunicating with the deadshrunken headcalypsodrink as titlefamily friendmale ghostskeleton keygrabbed in the crotchtwisting one's head completely aroundmediumshipflattenedspinning head (See All) |
Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing β¦ voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)
Subgenre: | suspense |
Themes: | fearghostmurderdeathfriendshiprevengemarriageinfidelityadulteryvoyeurismextramarital affairangersupernatural powerunfaithfulnesspanic |
Mood: | rain |
Locations: | cemeteryrestaurantswimming poolsnowboatbathtubrural settinglakelaboratoryyacht |
Characters: | husband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendteenage girlteacherstudentmusicianteacher student relationshippsychiatristprofessorghost in a mirror |
Period: | 2000s |
Story: | haunted housegravegraveyardhousebloodinterviewdogphotographpartythree word titlesurprise endingshowertelephone callcryingcell phone β¦car accidentmirrorwatching tvcomputercatsecrettearsbathroomcollegeneighborwinecandlewomanbathunderwater sceneroommatedrowningbinocularskeyelectrocutionpossessionmissing personcollege studentdeath of husbandhauntingratsuspicionmurderergardentherapyrunawaypickup truckoccultteafireplacegothicmousehammertherapistblockbusterdrug overdoseresearchboston massachusettspet doganxietyspyingpieropening a doorphoto albumlaptop computervillain played by lead actordockseancefireballphysicianfencesailboatparamedicshoedruggedcelloouija boardgeneticshitchcockiansleeplessnesspet catpoltergeistcellistfootprintmissing girl911power failurevermonthair dryervisionswriting on a wallsteamcocktail partyouijasource musiclock of hairvaliumglass shardmurder by drowningalimonyprinceton universityempty neststepping on glasssound systemhair dryer falling into a bathtubreference to jonas salkreference to madame curie (See All) |
Subgenre: | supernaturalparanormalslapstick comedyparanormal phenomenaparanormal investigation |
Themes: | fearghostfriendshipsurrealismsuicideescapemonsterinvestigationdeceptionsupernatural powerparanoiasurveillancepanicapocalypsenear death experience β¦unlikely hero (See All) |
Locations: | new york citybarrestauranthotelmotorcycletaxipolice carrooftoptaxi driverlaboratorytunnelfire truckchinese restaurantfire station |
Characters: | policeafrican americanfemale protagonistpolice officersecurity guardprofessorsecretaryaustralianmayorengineerfemale scientist |
Period: | 2010s |
Story: | haunted mansionhaunted houseevil spiritbased on filmmansiongood versus evilf ratedone word titleflashbackbare chested malefightdancingphotographtitle spoken by characterexplosion β¦knifechasesurprise endingpistoltelephone callfirecell phonefistfightmachine guncar accidentface slapremakerescueslow motion scenepunched in the facebattlebrawlfalling from heightbookvomitingshowdownbombrock musiccollegemanhattan new york citycombattelephonescientistreporterflashlightnew yorkconcertmontagearmydinersubwaymapexploding carman with glassesno opening creditsdrawingdouble crosscontroversycreaturevannews reporttransformationcoffeeracial slurone against manylibraryauthorcharacter repeating someone else's dialoguedangerscreamingfired from the jobelectrocutionuniformpossessionproduct placementdragonrace against timecover upknocked outopening action scenescene during end creditsexploding bodybasementtraphauntingfeminismobscene finger gesturegraffitibattlefieldpizzaocculttv newsanswering machinefalling down stairsgrenadeflyingballoonwoman with glassessociopathgroup of friendswalkie talkiemad scientistexploding buildingeccentricwristwatchgiantyoutubepress conferenceflatulenceimprovisationmind controllasercgiend of the worldaction heroineinterracial friendshipblack womanrampagecameojanitorstealing a cartarget practicerock concertinvasionmisunderstandinginventorjob interviewpower outage3 dimensionalevacuationmentoraquariumscene after end creditsthrown through a windowassault rifleaerial shotwisecrack humorbody landing on a carraised middle fingerdressing roomgadgetethnic slurgovernment agenttelekinesisexorcismunclegrenade launchersurprise after end creditsmedia coveragefirefighteralleyfinal showdownfire extinguishertimebombvomitsubway stationarmored cargiant monsterfriendship between womenportalworld dominationmegalomaniacfish tankcheering crowdcameo appearancereceptionistinternet videohearsecollege professortour guiderunning gagfinal battletimes square manhattan new york cityteamworkcamcorderreference to googlenewscastdance scenerealtorcrowbarfart jokeimprovised weapondelivery manspray paintalternate dimensionreference to batmanglowing eyesslimepoltergeistrevolving doorhit by a trainslow motion action scenephysicistgadgetryportrait paintingsurprise during end creditsnypdfemale vomitingmob of reportershot dog standphone ringingweaponrycollapsing buildingblowtorchexploding motorcyclecharacter appears on tvgiant creaturegrandfather clockvortexrebootspit takenational guardaudio recordingclichelogosecret laboratorydisco dancingparanormal investigatorringing phoneskepticreference to peter panhit in the groinghostbusterman wearing a tuxedogongcharacter appears on front page of a newspaperdisbelieving adultlovecraftiancollege deanghostbustersemployee dismissalparanormal phenomenonresearch facilitywhite hairappeared on tv newsfour friendsoccultismprojectile vomitingreboot of seriescareer changereference to the titanicsubway tunnelcrowd surfinginanimate object comes to lifeexperimental technologychinese takeoutswiss army knifedisaster in new yorkguided tourauthoresswoman slaps a womanmannequin comes to lifeparanormal expertreference to clark kentreference to p.t. barnumsmashing a guitarmale secretaryproton packbelief in ghostsgrafittifull bodied apparitionmaking coffeeparanormal investigation teamreference to amazon.comstage divingback hand slapcompany logofemale inventorreference to patrick swayzethrown through the airyear 1894fartingghost hunting equipmentenergy beamfaraday cagefemale business ownerfemale engineerkilled by ghostselfie stickpopping a balloon (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | independent filmcult filmdark comedyslasher flickcreature featuresadistic horror |
Themes: | fearmurderdeathsurrealismkidnappingrapejealousytorturefuneralmonsterseductiontheftdeath of fatherinsanitymental illness β¦sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
Mood: | gorerainnightmareslasher |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | family relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | lanternskeletongravegraveyardhousenumber in titlebloodviolenceflashbackbare chested maledancingphotographknifechasesurprise ending β¦pistolfirebeatingdreamcorpsedigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesttied to a chairmapsevered headman with glassescoffinritualshot in the foreheadcharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightninghanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerdead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
Subgenre: | independent filmcult filmsupernaturalpsychologicalpsychological horrorsupernatural thriller |
Themes: | murderdeathdrugsreligioninvestigationmagicincestmemorycorruptionsupernatural powerblackmailgamblingcannibalismamnesiadevil β¦murder investigationdeath of daughterfather daughter incest (See All) |
Mood: | goreneo noir |
Locations: | hospitalnew york citybarbeachrestauranttrainchurchhotelsnowbathtubbuselevatorfarmtrain station |
Characters: | father daughter relationshipdoctorsingerteenage girlsoldierserial killernursedetectivemusicianbabypriestlawyerinterracial relationshiplustpolice detective β¦biblemaidfrenchself discoverypolice arrestfather daughter sex (See All) |
Period: | 1950s |
Story: | new orleans louisianalouisianafortune tellergravegraveyardmansionpianosingingcharacter name in titlebased on novelbloodfemale frontal nudityflashbackmale rear nuditydog β¦two word titlebare chested malesex scenefemale rear nuditycigarette smokinginterracial sexdancingnipplesphotographsurprise endingpantiespistolcryingdreamcorpseshot to deathblood splatterfistfightmirrorcatwritten by directorvomitingtearsrunninginterrogationdemonhallucinationrevolverrivermanhattan new york cityfoot chaseflashlightbracandleold manbridgestabbed to deathdinertoiletstabbed in the chestsevered headnundream sequenceritualsearchdrowningbartenderracial slurgunshotdrug addictmicrophonekeyuniformstatuemissing personscreamringscene during end creditspianistpursuitcountrysideglassesratstagechickenjazzprivate detectiveapplauseoccultidentityspiritkilling an animalhead buttbreaking and enteringcophypodermic needleeggtape recorderperformancecomamutilationpatientguitaristbuttocksmovie theatersevered handtimecovered in bloodnew year's eveaudiencebrooklyn new york cityparadeanimal attackpreachermental institutionwatching televisionfanjunkiescene after end creditssuperstitiondisembowelmentheartblood on shirtchoirsoulrainstormcanecastrationlooking at self in mirrorpastorvoodooblack magicmusic bandprivate investigatorposteratheistwoman in bathtubdrumsgarterbeing followedceremonyinvestigatorfountainbaptismspiral staircasehorse racingperformerarcadeanimal crueltysatanismbroken mirrormaking outclinichearing voicesinterracial kissgramophoneshot in the eyelistening to radiowhistlingrazormarching bandafrican american womanstablecleaning ladyolder man younger woman sextimes square manhattan new york citycrabbettingritecrowbarmorphinesymbolheart ripped outhorse and wagoniconpentagramaltarprivate eyecut handmurder of a nude womankicking in a doorpart of the body in titletrenchcoatharlem manhattan new york citydeal with the devillockworld war two veteranstraight razortap dancingevil childgenital mutilationfuneral processionluciferphonograph recordshackstreetcarbody part in titlesatanic ritualincestuous sexdevil worshipcajunconey island brooklyn new york citydog bitenylonswashroomsouthern gothicafroelectric fananimal sacrificeblood on the floorcockfightyear 1955ice pickpriestesssoul transferencemarqueeherbincantationtarot cardsbloodstainoccult ritualmedicine cabinetfreight elevatorlost soulconey islandpit bullharlemfaustianjubilationscaldingpalm readerpick up truckfoot bridgeslumscongafather murders daughteroccult detective17 year old girlbongosposing as a doctorid tagsearch for selfbreaking a lockhoodoopoughkeepsie new yorkfaustian bargaingumboself search17 year old daughterfather kills daughter (See All) |
Set back in the late 1800s in a Victorian village, a man and woman by the names of Victor Van Dort and Victoria Everglot are betrothed because the Everglots need the money or else they'll be living on the streets and the Van Dorts want to be high in society. But when things go wrong at the wedding r β¦ehearsal, Victor goes into the woods to practice his vows. Just as soon as he gets them right, he finds himself married to Emily, the corpse bride. While Victoria waits on the other side, there's a rich newcomer that may take Victor's place. So two brides, one groom, who will Victor pick? (Read More)
Subgenre: | cult filmblack comedystop motionstop motion animationdark fantasypuppet animationgothic horror |
Themes: | ghostrevengesurrealismjealousyangerabuseafterlifebeyond death |
Locations: | churchwoods |
Characters: | zombievillain |
Period: | 1800s19th century |
Story: | horror for childrenspiderskeletonpianodogtitle spoken by characterfirecorpseswordpaintingwinecandlepoisonevil maneurope β¦undeadhategothicgossipbridearranged marriagehatredresurrectionbutlerfat manwedding ringabusive fatherhorse and carriagearrogancetorso cut in halfdead dogliving deadfencingunderworldwormeyeballmeat cleavergroomdisembodied headmaggotmusketstutteringclumsinessex wifeproposalabusive mothersnobdecomposing bodyangrydisembodied handinterrupted weddingfolk talepoisonedbad temperex husbandscaredreunited familyblack widowhot temperangry fatherbranchanger issuesfishmongerangry motherabusive parentsrefusing to believehateful (See All) |
Furious that her late father only willed her his gloomy-looking mansion rather than his millions, Carrigan Crittenden is ready to burn the place to the ground when she discovers a map to a treasure hidden in the house. But when she enters the rickety mansion to seek her claim, she is frightened away β¦ by a wicked wave of ghosts. Determined to get her hands on this hidden fortune, she hires afterlife therapist Dr. James Harvey to exorcise the ghosts from the mansion. Harvey and his daughter Kat move in, and soon Kat meets Casper, the ghost of a young boy who's "the friendliest ghost you know." But not so friendly are Casper's uncles--Stretch, Fatso and Stinkie--who are determined to drive all "fleshies" away. Ultimately, it is up to Harvey and Kat to help the ghosts cross over to the other side. (Read More)
Subgenre: | supernaturalabsurdismslapstick comedy |
Themes: | ghostfriendshipsurrealismdrunkennesssupernatural powergriefinheritance |
Locations: | bardesertlaboratory |
Characters: | father daughter relationshipteenagerpriestlawyerself referential |
Period: | 1990s |
Story: | haunted househousemansioncharacter name in titleone word titletitle spoken by characterpartychaseshotgunswordfalling from heightbased on comichalloweenbased on comic bookno opening credits β¦news reportbased on tv seriesdangerwidowerangellightninghauntingnewspaper headlinefalling down stairsspiritfireplaceheavy rainfaintingmad scientistblockbusterback from the deadcameochild's point of viewresurrectiondemonic possessionnewspaper clippinghalloween partylighthouseforename as titlecartoon on tvold dark housespiral staircaselast will and testamenttween girlbased on cartoonteasingheiressfriends who live togetherheirpart computer animationmainesecret passagemiddle schoolsledsecret doorstudio logo segues into filmghost costumesecret passagewaybaseball glovesecret tunneltoy trainghostbustertalking to a ghostsecret labbreakfast machinefriendly ghostmeowingcasperghost of wife (See All) |
When a bottle containing a plea for help from a little girl named Penny makes its way to the Rescue Aid Society, a mouse organization in the basement of the United Nations building dedicated to the rescue and well-being of anyone in need, it is up to the brave mouse Miss Bianca and her chosen partne β¦r, the shy janitor Bernard, to rescue the girl. Searching for clues at Penny's home at Morningside Orphanage in New York City, the two mice discover that the girl has been kidnapped by the evil pawn shop owner Madame Medusa and her companion Mr. Snoops. On the back of Orville the albatross, Miss Bianca and Bernard travel to the terrifyingly gloomy Devil's Bayou where they learn the shocking truth: the innocent young girl is being forced down into a dangerous, dark underground pirate's cave where she must find the Devil's Eye, the world's largest diamond and Madame Medusa's greatest obsession. Before returning safely home, Miss Bianca, Bernard, and Penny will have to combat Madame Medusa's two ferocious pet alligators Brutus and Nero with the help of Ellie Mae and Evinrude the dragonfly, as well as survive the raging tides inside the horrible pirate's cave. (Read More)
Subgenre: | tragedy2d animationpolitical satiredisney |
Themes: | fearfriendshipangerfaithbullyinghopegreedadoptionfalling in loveprejudicejusticecourage |
Mood: | rainaffection |
Locations: | new york citycarairport |
Characters: | female protagonistlittle girlself esteem |
Story: | pipe organnew orleans louisianalanternspiderskeletongood versus evilinterviewflashbackdogkissexplosionchasetelephone callcryingbased on book β¦underwearshotgunrescuecatswordfalling from heightliebedprayersubjective cameraorphanmapchild abuseradiosearchnews reportumbrellamissionpassionsuitcaserabbitscreamthreatsadnesstrapfirst partunderwaterwhippingtrustpoemropeloyaltytalking animalhatmouseblockbusterskullteddy bearorphanageembarrassmentanthropomorphismjanitortensiondiamondinnocencestarhatredanthropomorphic animalironybroken glassanxietydespairescape attemptthunderstormhit on the headlaughtersuperstitiondynamitelipstickfogdeerturtlecanechairboxlightreckless drivingowlshamebatjoycar troubletablerunning awayunited nationsbottlesarcasmdiggingearringraftbus stopfalling into waterhugmessageshoewhistlingblizzardcookiekidnapperstatue of liberty new york citymailboxkindnesspotionmale protagonistfriends who live togetheralligatorperfumehammockpawnshoprainbowsorrowpitchforkrescue from drowningspoonmoleclumsinessegohandbagdeterminationhungariannoisecurtainbroomexploding boatnightgownchild laborbucketcoatcuriosityfireworkdamagehostilitybayoulazinessleafconfidenceexhaustionimitationstar died before releasecollapsemockerycastle thunderaudio flashbackblameanimal protagonistenthusiasmpsychological abusechild driving a carair ventcuckoo clockhalf dressed cartoon animalriverboatballadeercombtextbookanthropomorphic mousedefiancedragonflytidefishing rodrailgratitudespiderwebstringfriday the thirteenthcomforthumilitywhirlpoolmisadventurebootfishing polewater pipepledgediversionalbatrossencouragementimpatienceanthemmessage in a bottlerolling pinbluebirdlost luggagesweepingsmokestackelectrical shockgoofy hollereleganceguide bookrescuermalevolenceelectrical wiresophisticationvalveabandoned boatassertivenessheadlampunderground caverncage elevatorinternational organizationmuskrat (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | independent filmcult filmblack comedydark comedypsycho thrillersurvival horroramerican horror |
Themes: | murderdeathkidnappingdeceptionincestpsychopathinsanitymental illnesssadismevilhome invasiongreedcannibalismwealthstarvation β¦claustrophobia (See All) |
Mood: | goresatireslasherdarknesssocial satire |
Locations: | los angeles californiaslum |
Characters: | policefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipvillainterrorkiller dog |
Period: | 1990s |
Story: | scared to deathspiderskeletonhousemansionbloodviolencedogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathblood splatter β¦shot in the chestface slapshotgunbirthdayflashlightimpalementchild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childbasementcharacter says i love youcult directorterminal illnessmaniacfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragemutilationstabbed in the stomachpsychosevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordpsycho killergothpervertserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
In December 1975, George and Kathy Lutz along with their three children move into an elegant Long Island house. What they don't know is that the house was the site of a horrific mass murder a year before. They decide to keep the house and attempt to keep the horror in the past, but are now haunted b β¦y a murderous presence. This is until, George starts to behave weirdly and their daughter, Chelsea starts to see people. What follows is 28 days of sheer, unbridled terror for the family with demonic visions of the dead. Based on the true story of George and Kathy Lutz, The Amityville Horror remains one of the most horrifying haunted house stories ever told - because it actually happened. (Read More)
Subgenre: | ghost story |
Themes: | ghostmurderdeathsuicidetortureparanoiainsanitymurder of family |
Mood: | nightmarearchive footagehorror movie remake |
Locations: | restaurantbathtubkitchenrooftop |
Characters: | family relationshipshusband wife relationshipmother son relationshipmother daughter relationshipteenage girlteenage boypriestlittle girllittle boycatholic prieststepfather stepdaughter relationshipstepfather stepson relationship |
Period: | 1970s |
Story: | haunted househousesexbased on novelblooddogbare chested malegunchasepantiesblood splatterurinationremakeshot in the headshotgun β¦slow motion scenefalling from heightvomitingrifleplace name in titlemarijuanashot in the backaxethroat slittingsuicide attemptchild in perilshot in the foreheadattempted murderpossessionscreambasementunderwaternewspaper headlinechild murderoccultpot smokingkilling an animalbabysittercovered in bloodteddy bearfamily dinneraxe murderdemonic possessionalarm clockdead dogdead girlreal estate agentbonghead woundmotorboatpotbullet woundmoving inrealtorholy waterbloody body of a childchild killedtortured to deathtorture chamberfamily in dangerbased on supposedly true storyabusive stepfatherable to see the deadwood choppinglocked in a closetchild shotmeat hookburial groundchild shot in the headboathousechild knocked unconsciouslakesidehole in the wallhanged childvillage name in titlebackwardsdeath of a petinsect attackwalking on a roofancient burial groundrefrigerator magnetmonster in mirrorupside down crucifix (See All) |
It hasn't even been a year since a plantation owner named Louis lost his wife in childbirth. Both his wife and the infant died, and now he has lost his will to live. A vampire named Lestat takes a liking to Louis and offers him the chance to become a creature of the night: a vampire. Louis accepts, β¦and Lestat drains Louis' mortal blood and then replaces it with his own, turning Louis into a vampire. Louis must learn from Lestat the ways of the vampire. (Read More)
Subgenre: | cult filmblack comedylgbt horror |
Themes: | fearmurderdeathrevengebetrayalescapeangersupernatural powerguilttheatremurder of family |
Mood: | gorerainnightdarkness |
Locations: | cemeterycarhelicopterparis francewaterpolice carfrancesan francisco californiaamerica |
Characters: | father daughter relationshipboyprostituteactorartistvampirelittle girlamericanamerican abroadvampire girlsame sex parents |
Period: | 19th century20th century18th century1870s |
Story: | new orleans louisianalouisianagood versus evilpianosingingbased on novelnuditybloodviolenceinterviewdancingsurprise ending β¦pistolfirevoice over narrationcryingcorpsehorsemirrorrescuemaskrunningbeddead bodydecapitationorphancandleweaponanimalcoffinritualtreelibrarydangercostumescreamingcharacter's point of view camera shotdollpianistautomobileneck breakingratcinemaundeadchild murderdestinydressgothicslow motiontape recorderlifting someone into the airhatslaverywatching a moviebuttocksblockbusteraudiencetorchslaveimmortalitytheatre audiencestairsswampdark herosundead childshadowhomoeroticismhorse and carriagelaughingvoodooplaying cardsreflectionvictorian erastage showyellingtableglovesplaguefemale vampirechandelieraudio cassetteteethritegolden gate bridgemind readinghouse firescytheliquidplantationsailing shipcurtaincustomsittinglifting female in airwoman's neck brokensexual innuendopoodlesliced in twocmnfbisexual mantwilightcandelabralifting male in aircarrying someonelifting an adult into the airclothed male naked femaleeroticismcmnf scenepleadingvampire human lovemarquee1790sbisexual malesiren the alarmdangerous friendmississippi rivergrand guignolgeorgian erachild vampireburial at seamonster as victimgirl in dangercostume horrorvampire driving a carreference to river phoenixtheater audiencetheater curtaindancing with dead body (See All) |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
Subgenre: | independent filmmockumentaryfound footagefake documentary |
Themes: | fearmurdersupernatural powerpanic |
Mood: | nightmarenightdarkness |
Locations: | swimming poolkitchen |
Characters: | boyfriend girlfriend relationshipself mutilationself absorption |
Period: | 2000syear 2006 |
Story: | haunted housespiderhousebloodinterviewtwo word titlebare chested malephotographknifesurprise endingfirecomputercamerawritten by directorlow budget film β¦demonguitarf wordsubjective camerabedroomvideo camerano opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguemicrophonescreamingsuburbfirst of seriescollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst partsevered armobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixblockbusterladdermale underwearbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerdemonic possessionexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All) |
After a car accident in which his wife, Debra, was killed and he was injured, Frank Bannister develops psychic abilities allowing him to see, hear, and communicate with ghosts. After losing his wife, he then gave up his job as an architect, letting his unfinished "dream house" sit incomplete for yea β¦rs, and put these skills to use by befriending a few ghosts and getting them to haunt houses in the area to drum up work for his ghostbusting business; Then Frank proceeds to "exorcise" the houses for a fee. But when he discovers that an entity resembling the Grim Reaper is killing people, marking numbers on their forehead beforehand, Frank tries to help the people whom the Reaper is after! (Read More)
Subgenre: | cult filmblack comedyparanormalsupernatural horror |
Themes: | ghostfriendshipfuneralsupernatural powerdeath of wifenear death experience |
Locations: | cemeteryhospitalmuseum |
Characters: | serial killer |
Story: | haunted househousemansionbloodflashbacktwo word titletitle spoken by charactercar accidentshotgunbedcar crashinterrogationwidowfalse accusationjudge β¦anti herofbiwidowerpsychicnerdfbi agentarchitectloss of wifecrying manheavencon artistsoulbulletproof vestfemale doctorfencegun held to headprison visitmatricidegrim reaperscythepoltergeistfemale journalistdefibrillationdefibrillatorafrican american manhuman asheshypothermiaabandoned hospitalghostbusterastral projectionprison visitationnumbersparapsychologybuilding demolitionreference to ted bundytalking to a ghosteccentric manectoplasmreference to jesse jacksonpassing through a wallforeheaddead husband ashespsychopathic copafro hair stylecold storage roomfear of womenflickering lightsreference to john wayne gacy (See All) |
When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa β¦rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)
Subgenre: | stop motion animationpuppet animation |
Themes: | feardeathmonstergrief |
Mood: | rain |
Locations: | cemeteryswimming poolsmall townbicyclepolice carbaseballsewer |
Characters: | husband wife relationshipfather son relationshipmother son relationshipteacherstudentbabylittle girllittle boymayor |
Story: | horror for childrenspidergravesingingone word titledogphotographexplosionfirecryingcorpserescuewatching tvcatsecret β¦tearsrunningneighborclassroomscienceflashlightcandleambulancecoffindrawinghit by a carcreaturesearchmicrophonesuburbumbrelladollbaseball batlightningscreamspeechratstagenewspaper headlinerecord playerexperimentapplauseballoonwatching a movielifelossphone boothfrogaudiencehome moviecarnivaltorchfull moonpromisethunderpet dog3 dimensionalshovelaquariumturtlechainuncleposterbatfiremantombenergyelectricitynotebookgategiant monsterfencepopcornelementary schoolgoldfishbellblackboardbaseball gamekitebased on short filmfrankensteinbackyardwindmillroller skatesgravestoneanguishpigtailsmovie cameradog moviebaseball fieldfairpet catslimearm slinghunchbackangry mobphonograph recordreanimationfairground3 dmovie projectorexhumationniececadaverloftbanneromenscience experimentspeakerclotheslineumpiregrave robbingscreenauditoriumbaseball gloveremake by original directorscience teacherschoolhousebaby strollerscience fairbaseball pitcherscience projectnerd boydeath of a petsurgical stitchesvacuum cleaningmanhole coverpet cemeteryfrench poodleback to lifefrankenstein spoofboltelectric kiss (See All) |
Five tales of terror are presented. The first deals with a demented old man returning from the grave to get the Father's Day cake his murdering daughter never gave him. The second is about a not-too-bright farmer discovering a meteor that turns everything into plant-life. The third is about a vengef β¦ul husband burying his wife and her lover up to their necks on the beach. The fourth is about a creature that resides in a crate under the steps of a college. The final story is about an ultra-rich businessman who gets his comeuppance from cockroaches. (Read More)
Subgenre: | cult filmblack comedyamerican horror |
Themes: | feardeathrevengesurrealismadulterytorturemonstersurveillancevengeancehunting |
Mood: | gorepoetic justice |
Locations: | cemeterybeachwheelchairfarmseacity |
Characters: | family relationshipszombievillainterror |
Period: | 1980sfuture19th century1830s |
Story: | skeletongravegraveyardbloodviolenceone word titlecigarette smokingshowermirrorbased on comicriflealcoholtelephonehalloweenwine β¦based on comic bookvideo camerachild abusesevered headcreatureanthologycigar smokingshot in the foreheadattackfirst of serieslightningsplit screentrapfirst partunderwatercult directorfreeze framekilling an animaljeepcakecomic bookvisitgrindhousepart of trilogyvictimpart animationback from the deadfull moonwhiskeyjanitorthunderanimated sequencedark humorinsecttitle appears in writingaquariumseasidebordercanefamily dinneropening a doorpumpkinvoodooliving deadburied alivehomagehorror hostfamily reunioncockroachweedbottleblackoutbillionairepatricidetyrantmeat cleaveractual animal killedcrabmacabrematchmeteoranimated creditsbroken necktrilogycomeuppancefurbucketmeteoritemistreanimationwoman shot in the foreheadcrategrandfather clocktrashcanauthor cameobased on the works of stephen kingdouble murderskull crushingcontrol freakbourbondisco musiccomic book artman eaterwraparound storyhorror comicseaweedmental abusespadefather's daytracksuitgallows humorsalt waterwoman smoking cigarlincolntropical fishkelpbloody corpsealien lifecontrol paneldaughter kills fatherdeath by shotgunantisepticfamily patriarchfather's gravespeech bubblestage lightingburied up to one's neckcake decoratinghigh tidejust dessertsmopping up blood (See All) |
The continuing quest of Frodo and the Fellowship to destroy the One Ring. Frodo and Sam discover they are being followed by the mysterious Gollum. Aragorn, the Elf archer Legolas and Gimli the Dwarf encounter the besieged Rohan kingdom, whose once great King Theoden has fallen under Saruman's deadly β¦ spell. (Read More)
Subgenre: | sword and sorcerydark fantasysword and fantasy |
Themes: | monsterheromagicself sacrifice |
Mood: | archive footage |
Locations: | forestcavesea monster |
Story: | single playernintendo gamecubeplaystation 2spin offbased on filmbased on novelflashbackexplosionbased on bookshot to deathshot in the headbattleswordcombatsword fight β¦axethroat slittingfictional warduelbattlefieldbow and arrowspearhelmetwitchcraftclubdwarfcrossbowwizardarmorsiegefighting gamesword duelarrowelfxboxgiant monsterstandoffadventure herofortressfantasy worldbehind enemy linessuicide bombertrollsword and sandalgoblinarcherbowmulti playerstaffgame boy advancespin off from filmshot with a bow and arrowepic battlelast standaxe fightbattle axesteel helmetcatapultaction adventure gameorchobbitmiddle earthaxe throwingtentacleswizardrylord of the ringshack and slash (See All) |
After the first massacre in 1974, the townspeople suspected that the Sawyer family were responsible. A vigilante mob of enraged locals surrounded the Sawyer house, burning it to the ground and killing every last member of the family. Decades later, a young woman named Heather learns that she has inh β¦erited a Texas estate from her grandmother. She decides to bring her friends along on the road trip to investigate her inheritance. On arrival, she discovers she has inherited a mansion, but is yet to uncover the terrors that lurk in the basement underneath it. (Read More)
Subgenre: | b movieslasher flick |
Themes: | murderdeathrevengevoyeurismmurder of a police officer |
Mood: | gorerainslasher |
Locations: | cemeterybarpolice stationroad triptexas |
Characters: | father son relationshipbabylawyerkillerinterracial relationshipsheriffcousin cousin relationshipmayoryounger version of characterslasher killer |
Period: | 1990s1970s |
Story: | pool tablegraveyardhousemansionfemale nuditynuditybloodbare breastssequelfemale frontal nudityflashbackbare chested malephotographpantiespistol β¦topless female nudityshootoutcorpseshot to deathblood splattershot in the chestremakeshot in the headshotgunslow motion scenecar crashdead bodyvoyeurshot in the backcleavagehalloweenfoot chasebound and gaggedmassacrestabbingimpalementstabbed to deathstabbed in the chestsevered headscantily clad femalehit by a carnecklaceshot in the foreheadblack pantiescharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on fireknocked outkicked in the facescarfemale removes her clothesdismembermentcorrupt copbralessgirl in pantieschainsawfalling down stairssupermarketrevelationscene during opening creditsbarnstabbed in the stomachsevered handcarnivalhitchhikermasked manduct tape over mouthpump action shotguninterracial romancebra and pantiessevered finger3 dimensionalscene after end creditssevered legchaincharacters killed one by onefifth partmasked killertorso cut in halfmarijuana jointliving deadreturning character killed offmolotov cocktailgateplaying pooldouble barreled shotguninterracial kissnude girlhead bashed indeputywoman in bra and pantiesferris wheelwoman wearing only a man's shirtcrotch grabgraphic violencedeath of grandmothercheating boyfriendslaughterhousecut into pieceshit with a hammerpsychotronic filmhouse firebonegrindhouse filmhatchetvinylwoman wearing black lingerieangry mobtrail of bloodshot through a wallhidden doorwine cellarmidnight moviesevered facehorror icontape over mouthduct tape gagbreast kissingchain link fencechainsaw murderblack man white woman relationshipwoman undressing for a manmeat grinderhung from a hookachilles tendon cuthacked to deathdead body in a freezerleatherface3d sequel to 2d filmopen graveskinningwearing human skinadopted girlretconstabbed with a pitchforkblood trailblack man white woman kissblack man white woman sexgroup photographhiding in a coffin (See All) |
James' happy life at the English seaside is rudely ended when his parents are killed by a rhinoceros and he goes to live with his two horrid aunts. Daringly saving the life of a spider he comes into possession of magic boiled crocodile tongues, after which an enormous peach starts to grow in the gar β¦den. Venturing inside he meets not only the spider but a number of new friends including a ladybug and a centipede who help him with his plan to try and get to New York. (Read More)
Subgenre: | cult film |
Themes: | surrealismmagictravelrivalryblindness |
Mood: | nightmare |
Locations: | new york cityseaengland |
Characters: | family relationshipsfriendlittle boy |
Story: | giant spiderspiderskeletoncharacter name in titlebased on novelbased on bookdreammirrordrinkswordfalling from heightbirthdaymanhattan new york cityorphanchild abuse β¦transformationtreegiftloss of fatherloss of motherrunawayropewhat happened to epiloguelifting someone into the airsharkpart animationviolinchild's point of viewanthropomorphic animalhungerscene after end creditssurprise after end creditsauntcar troublehot dogseagullcheesefriends who live togetherpart live actionbagcalendarmysterious strangerfruit in titlerhinocerosgiant insectempire state building manhattan new york citylifting male in airpart animatedneglected childvagabondpeachcentipedegrasshopperearthwormgiant wormchicken as foodanthropomorphic insectpart stop motion animationroald dahlshark fin above water (See All) |
Christine Brown is a loans officer at a bank but is worried about her lot in life. She's in competition with a competent colleague for an assistant manager position and isn't too sure about her status with a boyfriend. Worried that her boss will think less of her if she shows weakness, she refuses a β¦ time extension on a loan to an old woman, Mrs. Ganush, who now faces foreclosure and the loss of her house. In retaliation, the old woman place a curse on her which, she subsequently learns, will result in her being taken to hell in a few days time. With the help of a psychic, she tries to rid herself of the demon, but faces several hurdles in the attempt. (Read More)
Subgenre: | cult filmdark fantasygross out comedysupernatural horror |
Themes: | fearrevengefuneralangersupernatural powerevilpanictrauma |
Mood: | rainnightmare |
Locations: | cemeterylos angeles californiakitchen knife |
Characters: | father son relationshipmother son relationshipboyfriend girlfriend relationshipfemale protagonistsecurity guardwitchyounger version of charactercountry girl |
Period: | 1960s2000s20th century21st centuryyear 1969year 2009 |
Story: | fortune tellergravegraveyardhousemansionbare chested malefightsurprise endingcell phonedreamcorpseblood splatterblondecatfalling from height β¦car crashdemonhallucinationdinerchild in perilritualcurseprologuedeath of childbankcult directorsacrificepsychicsubtitled scenespiritkilling an animalmachetecakelifting someone into the aircrucifixwitchcraftdesperationcovered in bloodpsychologistrailway stationparking garagegoatambitiongypsybloody nosestabbed in the throatdark humorco workerhit on the headdeath of protagonistexploding headshadowtitle at the endvegetarianeye gougingwedding ringstabbed in the eyedemonic possessionexorcismengagement ringshamejewelrylevitationinsecurityhit in the faceimperative in titleseancebeggaranimal abusekittenflyeyeballcrushed headmediumcollege professorhumorpawnshopeating disorderhit with a shoveldigging a gravebeggingweight losshungarianextreme close uppoltergeistthrown from a carenvelopedutch anglejob promotionmortgagespaniardskepticismbitten handhandkerchieffalse teethentityobituarybreaking a car windowlifting a female into the airrich familystartledwind chimeanimal sacrificevomiting bloodpossessed humananvilsplit lipstaplerchoke holddenturesespdefenestrationseven deadly sinspasadena californiabank employeesleeping womanclosing eyes of dead persongross outillustrationseerhand through headpush buttonloan officerunderground parking garagepulling hairovercoatpalm readervisual impairmentcoin collectionorgan musiciron gatelevitatingfalling onto train tracksmexican womanbank officersteamer trunkassistant managerdigging up a dead bodyforced decisionphysical assault (See All) |
Harry, Ron, and Hermione continue their quest of finding and destroying the Dark Lord's three remaining Horcruxes, the magical items responsible for his immortality. But as the mystical Deathly Hallows are uncovered, and Voldemort finds out about their mission, the biggest battle begins and life as β¦they know it will never be the same again. (Read More)
Subgenre: | cult filmcoming of agedark fantasy |
Themes: | fearghostdeathfriendshipbetrayaltortureherodeceptionmagicmemorycorruptionterrorismredemptionself sacrificeunlikely hero |
Locations: | trainforestcastleschool of magic |
Characters: | teenagerteacherteacher student relationshipwitchchildhood friend |
Period: | 1990s2010s20th centurynear future21st centuryyear 1997year 1998 |
Story: | giant spiderspidergood versus evilcharacter name in titlebased on novelnumber in titlebloodviolencesequelflashbackkissexplosionfirerescuebattle β¦swordfalling from heightshowdowndead bodycombatspyambushterroristdisguisedeath of friendsnakefictional wardouble crossduellegendcurseattackdragonrace against timetough girlbankscarthreatwaterfallarsonbattlefieldpowerstrong female characterwerewolfdisasterdestinyloyaltydestructionrevelationloss of friendroman numeral in titleexploding buildinggiantfrograilway stationstrong female leadback from the deadpresumed deadbraveryimpostorresurrectionwizardimmortalitydark pastdead woman with eyes openblack magicteleportationelfheroismfinal showdownreturning character killed offdark secretassumed identityyoung version of characterboy with glassessorcererartifactfemale heroepiloguefinal battlevaultinfiltrationsnake bitechosen oneforce fielddouble agentteenage herodying wordsdead woman on floorbroomcupbank vaultcult figurepretending to be deadmagic wandeighth partlast of seriesmass destructionbased on young adult novelfire breathing dragonlimboenglish subtitles in originalgiant snakepythonevil sorcereryear 2017wet jeansdeath by fireevil wizardwandaftermathexploding bridgehereditary gift of witchcraftthroat slashedkilling a snakebitten by a snakesoaked clothesmagical broomstickmain characters killed offdeath of relativeanimate statuebildungsromaneighth in serieshobgoblininspirational speechmoving statuelife and death battleduel to the death (See All) |
Charts one family's encounter with the dark forces of the supernatural. When the Campbell family moves to upstate Connecticut, they soon learn that their charming Victorian home has a disturbing history: not only was the house a transformed funeral parlor where inconceivable acts occurred, but the o β¦wner's clairvoyant son Jonah served as a demonic messenger, providing a gateway for spiritual entities to crossover. Now terror awaits when Jonah, the boy who communicated with the dead, returns to unleash horror on the innocent and unsuspecting family. (Read More)
Subgenre: | paranormal phenomena |
Themes: | ghostsurrealismdrunkennesssupernatural powercanceralcoholism |
Mood: | gore |
Locations: | cemetery |
Characters: | mother son relationshipteenagerteenage girlteenage boypriestreference to godalcoholiccatholiccousin cousin relationship |
Period: | 1980syear 1987 |
Story: | haunted househousebloodflashbackbare chested malephotographchasebased on true storyfirevoice over narrationcorpsemirrorvomitinghallucinationaxe β¦four word titlebirdchild in perilritualinjectionhauntingfirst partterminal illnessoccultspiritsyringewhat happened to epiloguegothictold in flashbackcaucasianatticdemonic possessioncellartaking a showerapparitionold dark houseseanceterritory name in titleburnt facecatholicismreverendmediumfuneral homemaggotold photographfamily homefinancial problemhouse firemortuarymale vomitinghide and seekestranged fatherchemotherapyends with biographical notesrosaryfalling through the floorstate name in titlecrematoriumbased on supposedly true storyrecovering alcoholicburned bodycancer patientpsychiatric wardmutilated corpseextended familyexperimental drugteenage sonboy in perilends with historical notesshower curtainisolated housevisual hallucinationpost mortemmopping a floordesecrationgrave robberlocked roomfuneral parlorchild cancerhidden corpselost soulrosary beadsoncologistrotten foodrunning a car off the roadincineratorsome scenes in sepiaauditory hallucinationwriting on a bodyectoplasmflashbulbhousehold cleaning glovesbody hidden behind a wallembalming fluidbehavior changeembalming roomfoot through floorboard (See All) |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
Subgenre: | cult filmconspiracytragedyasian horror |
Themes: | ghostdeathlovefriendshipsurrealismsuicidebetrayaljealousypoliticsmemorybrutalityobsessionparanoiacancerredemption β¦guiltinsanitysexualitymental illnesstheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All) |
Mood: | rainnightmaredownward spiral |
Locations: | small townbuselevatorvillagewheelchairrooftop |
Characters: | childrenboyfemale protagonistnursedancersister sister relationshiplove trianglesuicide by hangingstepmother stepdaughter relationship |
Story: | haunted housechesshousef ratednumber in titlebloodviolenceinterviewflashbackfightcigarette smokingphotographsurprise endingpunctuation in titlecrying β¦horsemirrorremakelierunningdead bodyhallucinationcolor in titlenewspaperorphanflashlightstabbingmontageaccidentdream sequencedrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicioncult directorheroinhatechild murdersistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatpatientdemonstrationloss of loved onedrug abusecommunityhomehomicidepresumed deadmental institutionreverse footagesevered fingernostalgiamental hospitaldelusionscissorsbribemedicationblack brasibling rivalrydead childdeath of sisterperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationdockcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All) |
Edith Cushing's mother died when she was young but watches over her. Brought up in the Victorian Era she strives to be more than just a woman of marriageable age. She becomes enamored with Thomas Sharpe, a mysterious stranger. After a series of meetings and incidents she marries Thomas and comes to β¦live with him and his sister, Lady Lucille Sharpe, far away from everything she has known. The naive girl soon comes to realize not everything is as it appears as ghosts of the past quite literally come out of the woodwork. This movie is more about mystery and suspense than gore. (Read More)
Subgenre: | ghost storysupernatural horrorgothic horrorperiod film |
Themes: | ghostmurderlovefuneralincestpsychopathdeath of mothergriefnovel writing |
Mood: | rainnight |
Locations: | hotelsnowelevatorrural settingwheelchaircityenglandusafuneral in the rain |
Characters: | husband wife relationshipfather daughter relationshipdoctorbrother sister relationshipserial killerwriting a novel |
Period: | winter |
Story: | haunted mansionhaunted housemansionbloodmale nudityviolenceflashbackmale rear nuditydogtwo word titlesex scenedancingtitle spoken by characterknifeface slap β¦bare buttletteralcoholcandlestabbed in the chestdinnerchild abuseno opening creditsvoice overlibrarybeaten to deathportraitpoisonumbrellaautomobileloss of mothertypewritereuropestrong female characterapplauseteagothicdemonstrationmorguevillainessbrother sister incestcoitusstrong female leadhomicideshovelballvoice over letterhorse and carriageplaying pianolocation in titlewoman in bathtubnarrated by characterheartbreakpiano playingwhisperingpartial female nuditytaking a bathtoastblizzardwalkingwarningcowgirl sex positionaltered version of studio logomanuscriptredhit with a shovelstabbed in the facewoman slaps mancoughing bloodwoman slaps a mantrunkhorse drawn carriagereading a letterstabbed multiple timesborderline personality disorderbigamymissionary positionrainy nightwaltzcandelabramothstray dogstabbed in the bellyman carrying a womanbloody handpoisonedhuman skeletonbegins with narrationlock of haircleaverclaymurderer duowoman wearing a red dressfemale murderercholerawoman in bathfacial cutbuffalo new yorkreading letterwraithfancy dressfountain penincestuous overtonesarchitectural modelcowboy sex positionold mansionreference to jane austenexcavatorscale modelstabbed with a penself defencebegins with a flashbackblowing out a candlekey ringbloody hand printpiano recitalpomeranian dogyear 1893brutal murderophthalmologistford model tfather murderedformal danceformal dinnergothic romanceplaying fetch with a dogpushed off a balconyreference to arthur conan doyleseveral time periodsdead flyyear 1887year 1896camera shot of a woman's bare feetdisrepairgraveside ceremonyoverflowing sinkpersonal checkman wearing a top hatwax cylinder (See All) |
When Nick Parsons appears to be murdered his wife Libby is tried and convicted. Six years later Libby is paroled and with the help of Travis Lehman (her parole officer) she sets out to find her son and the truth behind the "murder".
Themes: | fearmurderrevengebetrayalprisonescapepsychopathpanic |
Mood: | goreneo noirmurder trial |
Locations: | cemeteryhospitalbarbeachschoolswimming poolnightclubpolice stationfarmpolice carcourtroomsan francisco californiacar in water |
Characters: | husband wife relationshipfather son relationshippolicemother son relationshipdoctorsingerfemale protagonistteacherpolice officerlawyersheriffpolice chasepolice arrest |
Story: | new orleans louisianamausoleumsingingsexfemale nuditynuditybloodtwo word titlesex scenecigarette smokingdancingphotographtitle spoken by character β¦knifechasepistolshootoutshot to deathshot in the chestshot in the headwatching tvcomputercameraarrestpaintingshowdownheld at gunpointtearshandcuffsislandrevolverf wordfoot chasesoccerambulancemontageprisonerinternetjudgetrialcoffinfishingsearchnews reportcoffeebartenderon the rungunshotfugitivemistaken identitymoaningevil manknocked outnewspaper headlinebreaking and enteringsociopathbabysitterjail cellbuttocksfaked deathcarnivalremote controlprison guardmisunderstandingframe upwomen's prisonevidenceboarding schoolhorse and carriageinjusticeferryframed for murdermusic bandauctionburied alivetestimonyset upassumed identitysouthern u.s.sailboatsailingjuryframedtape recordinghandcuffedwrongful convictiongeorgiainmategravestonegolden gate bridgefundraiserwrongful arrestcryptcar salesmaninsurance frauddecoyfuneral processioncurfewreference to pablo picassocriminal mastermindfalse nameferry boatart dealerparole officercoast guardcajunmardi grasconvicted felonhalfway houseparoleeinsurance policycanoeingoil paintingparole hearingfrench quarter new orleansbeneficiarylifesaverreference to marc chagallburied moneyreference to wassily kandinskyreference to joan miroseemingly widowedwomen's correctional facility (See All) |
A modern day retelling of the classic story The Frog Prince. The Princess and the Frog finds the lives of arrogant, carefree Prince Naveen and hardworking waitress Tiana crossing paths. Prince Naveen is transformed into a frog by a conniving voodoo magician and Tiana, following suit, upon kissing th β¦e amphibian royalty. With the help of a trumpet-playing alligator, a Cajun firefly, and an old blind lady who lives in a boat in a tree, Naveen and Tiana must race to break the spell and fulfill their dreams. (Read More)
Subgenre: | based on fairy tale |
Themes: | deathdanceweddingpoverty |
Locations: | restaurant |
Characters: | father daughter relationshipmother daughter relationshipafrican americanwaitressvillainyounger version of characterwitch doctor |
Period: | 1920s |
Story: | new orleans louisianaevil spiritlouisianabased on novelblooddogkissdreamcatanimal in titlesubjective cameradeath of friendsnakeno opening creditstongue β¦old womanprincessfive word titleloss of fathersacrificeprincejazztalking animalrace relationscookhunterworking classfrogparadeinterracial friendshipstarswampfirst kissbased on storycapturevoodoospelljazz musiccostume partyfriendship between girlsblind womanalligatortrumpettitle in titleamuletreciperich manworkaholicnethuman becoming an animaltalismanbayouspiritsfireflyspoiled childcajunjazz combosavingsamphibianstorybookpet snakedisney princessukelelehard workerwishing on a startalking froggumbotalking insectfrog princemucusanthropomorphic frogtabasco sauce (See All) |
A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old β¦televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)
Subgenre: | supernaturalfound footage |
Themes: | ghostmurderdeathdrunkennessdeceptionsupernatural powerevilhome invasionreligious cult |
Mood: | goredarknessone night |
Locations: | barforestroad triplakemotel |
Characters: | husband wife relationshipzombiealienkillerghost in mirror |
Period: | year 1998 |
Story: | haunted housefortune tellerhousefemale nuditybloodmale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudityfemale full frontal nudity β¦title spoken by charactermale full frontal nudityknifelesbian kisstopless female nuditycorpserescuedemontelevisionsubjective cameradecapitationhalloweenflashlightgangvideo camerathroat slittingimpalementcocainestabbed to deathsevered headritualanthologylooking at the cameratalking to the cameraskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love yourevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmenthandheld cameraone daytitle at the endknife throwingcastrationlooking at self in mirrorlens flareabbreviation in titlecharacters killed one by onemarijuana jointblood on camera lenswoman cryingwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All) |
One morning at an isolated mansion in the snowy countryside of 1950s France, a family is gathered for the holiday season. But there will be no celebration at all because their beloved patriarch has been murdered! The killer can only be one of the eight women closest to the man of the house. Was it h β¦is powerful wife? His spinster sister-in-law? His miserly mother-in-law? Maybe the insolent chambermaid or the loyal housekeeper? Could it possibly have been one of his two young daughters? A surprise visit from the victim's chic sister sends the household into a tizzy, encouraging hysterics, exacerbating rivalries, and encompassing musical interludes. Comedic situations arise with the revelations of dark family secrets. Seduction dances with betrayal. The mystery of the female psyche is revealed. There are eight women and each is a suspect. Each has a motive. Each has a secret. Beautiful, tempestuous, intelligent, sensual, and dangerous...one of them is guilty. Which one is it? (Read More)
Subgenre: | melodramaromantic novel |
Themes: | murderdeathsuicideinfidelitychristmasmoneybetrayaladulterypregnancylesbianismdrinkingdrunkennessincestseductionrobbery β¦extramarital affairtheftdysfunctional familyguiltunfaithfulnesshumiliationgreedinheritance (See All) |
Locations: | snowkitchenwheelchairfrance |
Characters: | family relationshipshusband wife relationshippolicefather daughter relationshipmother daughter relationshipsingerbrother sister relationshipteenage girlprostitutegirlpolicemandancersister sister relationshipthiefmaid β¦frenchdaughterex husband ex wife relationshippregnant womangrandmother granddaughter relationshipaunt niece relationshipbrother in law sister in law relationshipmother in law son in law relationshipthe family (See All) |
Period: | 1950s |
Story: | housemansionpianosingingsexf ratednumber in titleflashbackdoggunkissfightcigarette smokingdancing β¦knifelesbian kisssurprise endingpantiesbased on playsongdigit in titleface slapshot in the headdrinksecretshootingbookliecleavagewomanwhite pantiesscantily clad femaleconfessionvirginstabbed in the backscreamingkeyreadingpianistinjectionsuspicionsleepingeuropecheating wifehateholidayteamedicinecatfightred dresscookdysfunctional marriagetrappedinnocenceunfaithful wifefather figurecard playingsibling rivalryevidencesexy womandeersuspectplayroomdaggerfemale female kissadulterous wifeteenage pregnancyunhappy marriagepromiscuous womanlocal blockbusterexotic dancerestateunconsciousnessblizzardupper classunplanned pregnancyhypocritefamily homefingerprintunwed pregnancygirlfriend girlfriend relationshipindustrialistsnowstormfamily gatheringheart diseasechambermaidfrench countrysidehit over the head with a bottledomestic servantbook clubhuis closfamily matriarchstep sisterfamily patriarchfur stolereference to romy schneidercameliapretty woman (See All) |
Benjamin Franklin Gates descends from a family of treasure-seekers who've all hunted for the same thing: a war chest hidden by the Founding Fathers after the Revolutionary War. Ben's close to discovering its whereabouts, as is his competition, but the FBI is also hip to the hunt.
Subgenre: | heist |
Themes: | friendshipkidnappingbetrayalamerican revolution |
Mood: | car chase |
Locations: | cemeterynew york citychurchhelicoptershipmuseumtunnelpennsylvania |
Characters: | family relationshipsfather son relationshipfriendhostage |
Period: | 1970s2000s19th century20th century18th century21st century1830s |
Story: | lanternskeletongraveyardflashbackchasepistolshootoutcorpsearrestfalling from heightletterriversubjective cameralibraryprologue β¦fbifirst partunderwaterwashington d.c.eyeglassestreasureblockbusterknightnew jerseygrandfatherboston massachusettsatticphiladelphia pennsylvaniatombvideo surveillanceexpeditionburied alivetasershipwreckarcticsecret societyjerusalemflaretreasure huntchandelierswimming underwaterpipecluecodemetal detectorforgeryfather son estrangementexploding shipaircraft carrierriddlearchivesnowmobilesecret passagecryptbricktreasure mapchanging roomreceptionilluminatigunpowdertreasure hunterfreemasonbell towerice pickcrusadesreference to thomas edisonhudson riverabyss1770sbulletproof glassdeclaration of independencecurator11th centurygift shopnational archiveslincoln memorial washington d.c.invisible inklibrary of congresshistorical documentliberty bell (See All) |
Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl β¦osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)
Subgenre: | independent filmcult filmparanormal phenomenasupernatural horror |
Themes: | fearghostmurderlovemarriageweddingtheftsupernatural powerparanoiasurveillanceevilpanicpolice investigationmurder of family |
Mood: | nightmare |
Locations: | barchurchmotorcyclecatholic church |
Characters: | husband wife relationshippriestterrorcatholic priest |
Period: | 1970s |
Story: | haunted houseevil spirithousesexfemale nuditybloodflashbackdogthree word titlepantiesbased on bookdreamshotgunvomitingbeer β¦place name in titledemonriverbedroomaxeambulancetoiletwhite pantiesnunvanparktreelibrarycurseattacklightningscreamcrosshauntingfirst partchild murderoccultfireplacegothicbabysitterlifting someone into the airagingcrucifixbeardblockbustergrindhousemale underwearreincarnationstairsthunderstormdemonic possessionbriefswedding receptionblindsuffocationreal estate agentclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwhite briefswoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgirl stripped down to pantiesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storycamel toeremadetrailer narrated by percy rodriguezbare midriffevil forcehorror movie remademicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All) |
Robert and Katherine Thorn seem to have it all. They are happily married and he is the US Ambassador to Great Britain, but they want nothing more than to have children. When Katharine has a stillborn child, Robert is approached by a priest at the hospital who suggests that they take a healthy newbor β¦n whose mother has just died in childbirth. Without telling his wife he agrees. After relocating to London, strange events - and the ominous warnings of a priest - lead him to believe that the child he took from that Italian hospital is evil incarnate. (Read More)
Subgenre: | paranormal phenomenasupernatural horrorchristian horror |
Themes: | fearmurderdeathsuicidereligionfuneralinvestigationsupernatural powergriefadoptiondeath of wifedevildeath in childbirththe devil |
Mood: | gore |
Locations: | cemeteryhospitalchurchlondon englandkitchencavegas stationstormcatholic churchairplane trip |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipchildrenboypolicemanphotographerbabypriestchristianitylittle boybibleamerican abroad β¦catholic priestsuicide by hanging (See All) |
Period: | 1970s |
Story: | skeletongravegraveyardgood versus evilbloodviolencedogtwo word titlegunphotographknifesurprise endingslow motion scenefalling from heightdemon β¦reference to jesus christdecapitationorphanimpalementsevered headnuncoffinchild in perilbirthday partystalkerfirst of seriespossessionlightningu.s. presidenthangingamerican flagfirst partnewspaper headlinechild murderoccultfireplacebulletgothicrome italylifting someone into the airloss of wifevillainessblockbustermonkanimal attackreincarnationstabbed in the throatmillionairezoobroken glassreference to satanbible quotedeath of protagonistbody landing on a cardemonic possessiondead woman with eyes opendaggerexorcismnewspaper clippingmiscarriagenannygothbeheadingmysticismmonasteryjerusalemambassadorunsubtitled foreign languagemoving infamous scoredarkroomdisfigured facedead wifealtardog attackdiplomatburn victimantichristcasketevil childexorcistbirthmarkdeath by hangingarmageddonluciferbible prophecygovernesstricyclerottweilerchild murdererlifting male in airdevil worship666english accentomentrailer narrated by percy rodriguezdeath by impalementhorror movie remadearcheological digbaboonbook of revelationpushed down stairscharacter appears on front page of a newspaperfacial disfigurementswitched at birth5 year oldends with funeralstillborn childphotograph in newspaperevil dogbaby switchjackalflatbed trucklightning rodends with a quotepaternosterreligious sacrificeamerican ambassadorphotography darkroompublic suicide (See All) |
Laura, a former orphan, raises her adopted son Simon together with her husband Carlos in an old house and former orphanage where she was raised. While at the orphanage Simon tells Laura that he has five invisible friends which she believes are a product of his active imagination. Laura decides to re β¦open the orphanage to cater for disabled children and throws a party. During the party Simon tries to persuade Laura to go and take a look at his friends cabin but she's too busy. Later on she sees a mysterious masked boy and realizes that Simon has also disappeared. Laura feels the presence of other people in the house and months later Laura invites a team of parapsychologists to try to unravel the mystery. (Read More)
Subgenre: | gothic horror |
Themes: | ghostdeathsuicidesupernatural powermissing child |
Locations: | beachcaveoceanshed |
Characters: | husband wife relationshipmother son relationshipchildrenboyfemale protagonist |
Story: | haunted househousemansionsurprise endingcorpseface slapmaskbathroomhallucinationorphandrawingdrowningdolldeath of childdisappearance β¦basementpsychicgamegothicaccidental deathorphanagespanishdisfigurementsocial workercellarlighthouseapparitioncremationold dark housedead childrenbroken windowhuman immunodeficiency virusmedalimaginary friendpoisoningadopted sonloss of childmediumdeformityhuman immunodeficiency virus positivehidden roomhit by a busfurnaceknee injurysack mask (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy |
Themes: | fearghostmurderdeathfriendshiprapepregnancymonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanitysadism β¦eviltrauma (See All) |
Mood: | gorenightmareslasher |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | father son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killernursebaby β¦artistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | haunted houseevil spiritspiderskeletongood versus evilsexfemale nudityf ratednuditybloodviolencebare breastssequelflashbackbare chested male β¦gunfemale rear nudityphotographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamstalkingautomobilepremarital sexmurderersevered armdismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendcrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerhomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
Pongo and Perdita have a litter of 15 puppies. Cruella De Vil takes a fancy to the pups, and wants to get hold of them, as well as more pups, to make herself a lovely dalmatian skin coat... Cruella hires some thugs to kidnap the pups and hold them at her mansion. Will Pongo and Perdita find them in β¦time ? (Read More)
Subgenre: | 2d animationdisney |
Themes: | fearrevengesurrealismmarriagechristmaspregnancyweddingangerabductionfashionfalling in love |
Mood: | car chase |
Locations: | carsnowlondon englandkitchenfarmenglandlaketruckstorm |
Characters: | family relationshipshusband wife relationshipmothermaidfatherpregnantpregnant wife |
Period: | 1960s |
Story: | mansiongood versus evilpianobased on novelnumber in titledogfightcigarette smokingexplosionchasetelephone callcryingsonghorserescue β¦watching tvcatbattlebrawlnewspaperdisguisewomancigar smokingparksmokinglightningdisappearancechildbirthcowhenchmanfireplacetalking animalquestbarnstealingcrying womanvillainessblockbustercomposerbirthburglarpet dogthunderstormchristmas evelaughtersongwriterpuppylaughingpipe smokingnannygiving birthpetcar troublegerman shepherdcartoon dogbottletelling someone to shut upblizzardpipefemale villainponddesignerevil womanslappingfur coattelevision setpentalking dogdog movieslapensembleexpectant mothercheckgoosefurreference to ludwig van beethovensnowstormcoatcar wreckexpectant fathermatchmakingbig ben londoncigarette holderfrozen lakeinkleashstovetalking catmockerycastle thundergreat danerich womananimal protagonistmoving vandalmatianred eyesbad temperbarkingbloodhoundtalking horseimpatiencecheck booklabradordognappinganimal matingsheepdogpomeranian doglittercollie doganimal trackautomobile chasepregnant animalhenchmenbarkspiraling eyesspotsoottalking pet (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk β¦s at a terrible cost. (Read More)
Subgenre: | tragedychrist allegory |
Themes: | fearmurderdeathloverevengesurrealismsuicidekidnappingbetrayaldeceptionbrutalitysupernatural powerdeath of motherhopedeath of wife β¦self sacrificemythologynear death experience (See All) |
Locations: | churchforestlondon englandwoodscastlecave |
Characters: | husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampirewarrioraction heroself mutilationex soldierself healingblood lust |
Period: | 15th century |
Story: | suit of armorspiderskeletongood versus evilcharacter name in titlebloodviolenceflashbackbare chested maleexplosionknifechasesurprise endingfirevoice over narration β¦beatingcorpseblood splatterhorserescueslow motion scenepunched in the facebattleswordfalling from heightshowdownhand to hand combatrunningdemonrivercombatsubjective cameracandlesword fightambushaxemassacremountainthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in periltransformationon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingperson on firecharacter's point of view camera shottentevil manlightningshot in the shoulderscarcrossthreatened with a knifedirectorial debutsevered armgeneralbare chested male bondagerefugeesubtitled scenebattlefieldfreeze frameprincestylized violencemaniacdestinywolfbow and arrowburned alivehead buttspeargothicheavy rainhelmetcrucifixloss of wifeskulltorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantuladecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
In October 2012 a video footage is found at the home of Malcolm Johnson and the recordings are still unexplained. Past this prologue a story in flashback form unfolds. During the summer of 2012, Malcolm and Kisha move in together and start a happy life. One night Kisha notices a few unexplained phen β¦omena that convince her their house is haunted by ghosts. To allay her fears Malcom hires a camera crew to film inside the house day and night. A few nights later Malcom and Keisha have sex on camera, despite Keisha's protests at being filmed. Upon reviewing the sex tape the next day, Malcom and Keisha notice a few paranormal phenomena caught on tape. Malcom wants to sell the house but the housing market is slow. Therefore, Malcom decides to hire a psychic to come to the house and investigate. After Kisha confesses to making a deal with the devil for a pair of shoes things start to make sense but it doesn't solve the problems caused by the paranormal phenomena. (Read More)
Subgenre: | supernaturalfound footage |
Themes: | ghost |
Mood: | spoofparody |
Locations: | swimming poollos angeles california |
Characters: | boyfriend girlfriend relationshippriestyounger version of charactersex with a ghost |
Period: | year 2012year 1988 |
Story: | haunted househousefemale nudityflashbackmasturbationmale rear nuditybare chested maleinterracial sexpistolbeatingshot to deathshot in the chesturinationface slap β¦punched in the facebikinisubjective cameravideo cameracocainehit by a carbirthday partycharacter repeating someone else's dialoguecharacter says i love youpsychicfalling down stairskilling an animalkicked in the stomachflatulencerear entry sexswitchbladetitle at the endhousekeeperdemonic possessionwritten by stardead dogmarijuana jointstuffed animalwebcamnight visionanal rapemale rapehamburgerman punching a womanouija boardwoman in a bikiniwoman slaps a manfemale sitting on a toiletbegins with textwriting in bloodsex on a tabletime stamp (See All) |