Best popular movies like The Last House On The Left:

Do you need specific genre & keyword selection to find films similar to The Last House On The Left?
<< FIND THEM HERE! >>

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
sadistic horroramerican horrorcult filmindependent film
Themes:
rape and murderrape and revengemadnessvengeancecrueltyabductionevilsadismhumiliationinsanitybrutalitypsychopathseductionvoyeurisminvestigation …escapetorturerapekidnappingsuicidemurderdeathrevenge (See All)
Mood:
slashernightmarehigh schoolgore
Locations:
running through the woodslakecemeteryforestswimming pool
Characters:
slasher killerserial murdererserial killerself justiceterrorsheriffvillainkillerreference to godteenage girlfather son relationshipfamily relationshipspolice
Period:
1970s
Story:
sadistic psychopathrape victimplaying checkersbaking a cakeserial rapistsexual perversionserial teen murdererserial child murdererlive chickenhomicidal maniacsexual crueltyfemale villainserial teen killerescaped killerserial child killer …female serial killerpsychopathic killerfemale killerrock concertevil manfemale psychopathbeer drinkingremake of swedish filmgraphic rapefemale in showerpocket knifewhite pantiesforced suicidehorror movie remadereference to the grand canyonsmoking in bathtubwoman smoking a cigarstuffed in a car trunkwoman in a trunkice cream barprison escapeemedical gownengine troublefemale victimslocked in a car trunkhair curlersreference to j. edgar hooverrotten teethpsychological tormenttrip wirecandlelight dinnercaged birdmutilated corpsehands tied behind backbad girlvideo nastystabbed in the bellybloody handdrive in classicbased on supposedly true storysickocheckerssex offenderinfamyrefugebanned filmperson in a car trunksadisticrunning for your lifeescaped prisonerstabbed multiple timesbloody violencedisturbingpokiesrunning out of gassexual predatormistreatmentlong haired malegraphic violencepaybackbitingdisturbed individualstreambakingchild molesterreading a newspapershot through the mouthstation wagonsexual violencerazor bladeheld captiveatrocitycarnagefilm starts with textwetting pantsparentdouble barreled shotgunescaped convictelectronic musicserial murderdegradationhuman monsterphysicianspit in the facerunning awayforced to stripmisogynistcannabisbad guymadmanprayingdead girlpervertshot multiple timesmurder of a childbloodbathsexual assaultduckcastrationpet dogperversiondisembowelmentpedophilejunkiehippiecynicismsufferingwoman in jeopardyswitchbladepeeping tomhitchhikingrapistvictimgrindhouseice creamsexual abusemutilationnipples visible through clothingmachetechainsawmaniacbralesscult directordismembermentbased on filmdirectorial debutsevered armhandgunchickenmurdererfemale removes her clothesconvertibleringelectrocutionstabbed in the backsuburbscreamingdrug addictpublic nuditylatex glovescigar smokingnecklacecontroversybathscantily clad femalefemale pubic hairstabbed to deathtoiletthroat slittingstabbingconcertgangbound and gaggedfoot chasevoyeurmarijuanabirthdaybeershootingremakeurinationblood splattershot to deathshowerpantiesknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nuditybloodfightgunviolencedog (See All)

I Spit On Your Grave (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Spit On Your Grave (1978)

The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)

Subgenre:
sadistic horroramerican horrorcult filmindependent filmb movievideohorror b movie
Themes:
rape and revengevengeancecrueltyevilsadismhumiliationbrutalitypsychopathseductionvoyeurismtorturerapekidnappingmurderdeath …revengefearangerexploitationrevenge murder (See All)
Mood:
slashergore
Locations:
lakeforestnew york citychurchcarsmall townbathtubbicyclewatergas stationcountry
Characters:
serial murdererserial killerself justicevillainkillerfemale protagonistgirlwriterlustsex with a stranger
Period:
1970s
Story:
sadistic psychopathrape victimsexual perversionsexual crueltyfemale villainfemale serial killerpsychopathic killerfemale killerevil manfemale psychopathwhite pantiesvideo nastydrive in classicinfamybanned film …sadisticdisturbingmistreatmentgraphic violencesexual violenceheld captiveatrocitycarnageserial murderdegradationhuman monstermisogynistpervertcastrationperversionwoman in jeopardyrapistvictimgrindhousemutilationsexual abusenipples visible through clothinghandgunmurdererfemale removes her clothesscreamingpublic nuditycontroversyscantily clad femalefemale pubic hairgangvoyeurpantiesknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nuditybloodviolencegunmale nuditybare breastsmale frontal nuditybare chested malecigarette smokingnipplesmale full frontal nudityleg spreadingfondlingcryingbeatingmirrorbikinilow budget filmmale pubic hairriveralcoholtelephonecleavagenewspapernew yorkaxedrivingman with glassesdrowningjeansone against manysmokinggraveauthorunderground filmhangingglassesthreatcabinvigilantekillingrecord playereyeglassesclaim in titleinjuryragedesperationrednecklow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapebody countaxe murderbruisecharacters killed one by onekilling spreemisogynypsycho killerwoman in bathtubkillviolence against womenvigilantismcanoefemale removes her dressmental retardationloserharmonicaanal rapebubble bathwhite trashwrathmotorboatwoman wearing only a man's shirtbleeding to deathhammockextreme violencemurderesssmall breastsfemale prisonerfemale victimshared bathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicideconnecticutdebaucherysexual sadismcreepyhanged boyeye candygory violenceeast coastmisandryfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
sadistic horrorindependent filmsuspenseb movieb horrorindependent horrorpsychological horrorfrench horrorhorror b movie
Themes:
madnessevilsadisminsanitybrutalitypsychopathtorturerapekidnappingdeathmurderfriendshipsurrealismfeardeath of father …death of motherunrequited lovehome invasionexploitationdeath of wifemurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
slashernightmaregorecar chasenightdarknessblood and gore
Locations:
foresthospitalbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlfather son relationshipfamily relationshipspolicehusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriend …boybrother sister relationshipfemale protagoniststudentbest friendfrenchbest friendsmysterious villainmysterious killerdeath of boy (See All)
Story:
sadistic psychopathrape victimserial rapisthomicidal maniacfemale villainfemale serial killerpsychopathic killerfemale killerevil manfemale psychopathfemale victimsbad girlsickosadisticbloody violence …sexual predatorgraphic violencedisturbed individualrazor bladeserial murderhuman monsterbad guymadmanpervertmurder of a childsexual assaultperversionrapistgrindhousemutilationchainsawmaniacmurdererscantily clad femalethroat slittingstabbingbound and gaggedvoyeurshootingurinationblood splattershowerknifefemale frontal nudityfemale nuditydoggunbloodviolencef ratedbare breastsflashbackmasturbationcigarette smokingphotographlesbian kisschasesurprise endingtelephone calldreamcorpsecar accidentmirrorshot in the headshotgunslow motion sceneriflesunglassesbedcar crashdead bodylow budget filmbathroomneighbortelephoneshot in the backsubjective cameradecapitationsurvivalflashlightaxemassacreimpalementstabbed in the chesthousesevered headvanon the rundolldeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandsleepingeuropekillingblood spattersplatterchild murderfireplacekilling an animalmass murderlistening to musicsurvivorstabbed in the stomachpsychosevered handstrangerfollowing someonerampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherslaughterswingclassmatebody countaxe murdercharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedblood on camera lenssuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a dogfarmhouseslashinglistening to a radiocornfieldpiercinggreenhouseurinalexamevil womanextreme violencemurder of wifefilling stationmurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbutcher knifefemale victimmurder spreevineyardchainsdriving at nightbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed persongas station attendantplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violenceaxe murdererpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

The Devil's Rejects (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
sadistic horrorcult filmindependent filmblack comedypsycho thriller
Themes:
madnessvengeancecrueltyevilsadismhumiliationinsanitybrutalitypsychopathseductionescapetorturerapekidnappingsuicide …deathrevengemurderfriendshipbetrayalfeardeceptionangerdeath of fatherdeath of motherparanoiaexploitationcannibalismself sacrificepolice brutalitymurder of a police officernear death experiencemurder of family (See All)
Mood:
nightmaregoreambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
serial killerterrorsheriffvillainfather son relationshipfamily relationshipspolicehusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationship …prostitutepolice officernursehostagetough guymaidpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
serial rapisthomicidal maniacfemale villainfemale serial killerpsychopathic killerfemale killerevil manfemale psychopathfemale in showerwhite pantiessadisticrunning out of gasgraphic violencesexual violencefilm starts with text …serial murderhuman monsterspit in the faceforced to stripmisogynistbad guymadmanprayingpervertsexual assaultrapistgrindhousemaniaccult directorchickenmurdererelectrocutionstabbed in the backscreamingcigar smokingfemale pubic hairstabbed to deaththroat slittingbound and gaggedfoot chasemarijuanabeerblood splattershot to deathshowerpantiesknifefemale full frontal nudityfemale rear nudityviolenceblooddogsequelflashbackmale rear nuditybare chested malesex scenecigarette smokingphotographtitle spoken by characterexplosionchasepistolfireshootoutwoman on topbeatingdreamcorpsemachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointsecond partdead bodylow budget filminterrogationjailhandcuffsrevolvercriminalshot in the backf wordsurvivalgay slurambushstrangulationaxedeath of frienddrug dealerimpalementcocainestabbed in the chesttied to a chaircultdream sequenceanti herochild in perildouble crosspolice officer killednews reportshot in the legshot in the foreheadracial sluron the runbeaten to deathclownpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingthreatened with a knifeprofanityshot in the armobscene finger gesturewhippingcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsevered legkilling spreedeath of loved onenewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointreference to elvis presleyface maskreturning character killed offstabbed in the handnecrophiliashot in the neckhomagepistol whipstandoffvulgaritytrailer homehit by a truckdeputyman kills a womantrailer parkman punching a womansole black character dies clichemacabreshot in the throatcarjackingexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurekiller clownwriting in bloodred light districtmultiple homicidecmnfsexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Henry: Portrait Of A Serial Killer (1986) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerindependent horror
Themes:
evilinsanitybrutalitypsychopathtorturerapedeathmurderdrugsincestexploitationmurder of family
Mood:
slashergore
Locations:
chicago illinois
Characters:
slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationshipprostitutemysterious villainmurder of a prostitute
Period:
1980s
Story:
sadistic psychopathhomicidal maniacpsychopathic killerevil mangraphic rapebased on supposedly true storysickosadisticdisturbed individualsexual violenceserial murderhuman monsterbad guymadmanpervert …murder of a childperversionrapistmutilationmaniacdismembermentcontroversystabbed to deathstabbingmarijuanablood splattershot to deathfemale nudityviolencebloodguncharacter name in titlenuditybare breastssurprise endingshot in the chestlow budget filmcriminaldecapitationbisexualstrangulationvideo cameradrug dealerstabbed in the chestchild abusesevered headpantyhosestalkerattempted rapestalkingneck breakingkillingsplatterfemale stockinged legsragestabbed in the stomachpsychorampagelow budgetdark humorbutcherpsychotronicslaughterstabbed in the eyeabusive fatherbody countkilling spreepsycho killervillain played by lead actormysterious mankillslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecesoff screen murderchild rapemurder of a nude womanmurder spreebroken neckbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrordead prostitutefemale hitchhikermurderer duotwo killersmutilated bodysex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
american horrorcult filmindependent filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horror
Themes:
crueltyevilsadismhumiliationinsanitybrutalitypsychopathvoyeurismmurderrevengedeathfearcorruptiontraumamysterious death
Mood:
slashergorenightdarknessblood and gore
Locations:
lakecarmotorcycleboatwaterwoodsrural settingpolice cartruck
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpoliceteenagerfriendteenage boypolice officerpolicemanartistmother …truck drivermysterious villain (See All)
Period:
1970s1950ssummer
Story:
sadistic psychopathsexual perversionhomicidal maniacfemale villainserial teen killerfemale serial killerpsychopathic killerfemale psychopathfemale victimsmutilated corpsebad girldrive in classicsadisticbloody violencedisturbing …mistreatmentgraphic violencebitingserial murderhuman monsterperversiondisembowelmentvictimgrindhousenipples visible through clothingmachetemaniacmurdererscreamingstabbed to deaththroat slittingstabbingvoyeurmarijuanabeerblood splatterpantiesfemale rear nudityfemale nudityviolencesexnumber in titlemale nuditybare breastsmale rear nuditybare chested malekissnipplesthree word titlesurprise endingbeatingcorpsedigit in titlefistfightblondeslow motion scenebikinithongrunningdead bodylow budget filmhallucinationguitarsubjective cameradecapitationbedroombracandleold manaxemassacrewomandineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuefirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesireelectronic music scoredressjeepgothicheavy rainhatstabbed in the stomachhammervillainesspsychoswimsuitdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingsurpriseatticdead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoysexual awakeningbeheadingcar troublemysterious manshortsdead animalsummer campcanoeadolescencerepressionrestroomslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured faceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowsole survivortraumatic experiencefemale victimwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boymystery killersweateraxe in the headmultiple homicidepsycho terrorweirdoawakeningdate in titledead teenagerlost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadedark and stormy nightdeath by impalementeast coastaxe murderercamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckcanoeingtrailer narrated by don lafontainekilled with an arrowstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Kalifornia (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kalifornia (1993)

Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thriller
Themes:
rape and murderevilsadisminsanitypsychopathtorturerapekidnappingdeathmurdertheftphotographywritingmurder of a police officer
Mood:
slashergoreneo noir
Locations:
barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car
Characters:
slasher killerserial murdererterrorvillainkillerpoliceboyfriend girlfriend relationshipwriterhostagewaitresschinese foodshooting a police officer
Story:
sadistic psychopathrape victimserial rapisthomicidal maniacpsychopathic killerevil mandisturbingbloody violencegraphic violencesexual violenceserial murderhuman monsterbad guymadmanpervert …sexual assaultperversionrapistvictimmutilationmaniacmurdererstabbed in the backstabbed to deathbeerurinationblood splattershot to deathfemale nudityviolencefightgunbloodsexnuditymale nudityone word titlemale rear nuditybare chested malecigarette smokingphotographtitle spoken by characterpistolcar accidentshot in the chestshot in the headshotgunbare buttdead bodysex standing upgay slurjournalistcalifornianarrationjourneyblack pantieson the roadautomobilekillingarsontape recorderragestabbed in the stomachpsychomale underwearrampagerednecktensionstabbed in the throatgash in the facedark humorbutcherblack brabilliardsrainstormbody countkilling spreepsychoticblack bra and pantiesphysical abusekillpistol whippolice officer shot in the chestknocked unconscioushillbillyyuppietrailer parkwhite trashcactushit with a shovelintentionally misspelled titlecross countryabusive boyfriendlunaticmass murdererbreaking a bottle over someone's headbutcherycrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingpsycho terrorexposed breastparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All)

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
sadistic horroramerican horrorcult filmpsycho thrillerbody horrorindependent horror
Themes:
evilsadisminsanitybrutalitypsychopathtorturemurderdeathsupernatural power
Mood:
slashergorebreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlbrother sister relationshipteenage boymysterious villainmysterious killer
Period:
1980s
Story:
sadistic psychopathserial teen murdererhomicidal maniacserial teen killerpsychopathic killerevil mandrive in classicdisturbingbloody violencegraphic violencedisturbed individualserial murderhuman monsterbad guymadman …disembowelmentgrindhousemutilationmaniacmurdererstabbed in the backstabbed to deathblood splatterpantiesfemale frontal nudityfemale rear nudityfemale nudityviolencebloodsexnumber in titlemale nuditybare breastssequelmasturbationmale rear nuditysurprise endingcorpseunderwearmasklow budget filmsubjective cameradecapitationstrangulationimpalementsevered headchild in perillooking at the cameraskinny dippingcharacter's point of view camera shotstalkingpremarital sexcabinloss of motherobscene finger gesturekillingsexual attractionlifting someone into the airragemorguefourth partpsychotowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headslaughterdisfigurementbody landing on a carbody countcharacters killed one by onekilling spreemasked killerpsycho killercar troublemysterious manstabbed in the handkillsummer campslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencestabbed in the facemasked villainknife murderdeformitylunaticmurder of a nude womanmurder spreevillain not really dead clichebutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrorhockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymanskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the necktrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainslaughteredmurder in a shower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Last House On The Left (2009) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (2009)

While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro …ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)

Subgenre:
american horror
Themes:
vengeancecrueltysadismbrutalitypsychopathescapetorturerapekidnappingdeathrevengemurderfriendshipguiltmurder of a police officer
Mood:
slashergorehorror movie remake
Locations:
lakeforestboatwoodskitchenmotelstorm
Characters:
serial murdererserial killerterrorkillerteenage girlfather son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshiphostage
Story:
rape victimserial rapisthomicidal maniacsexual crueltyescaped killerfemale serial killerpsychopathic killerfemale killerremake of swedish filmwhite pantiesprison escapeehands tied behind backrunning for your lifeescaped prisonersexual predator …sexual violenceheld captiveescaped convicthuman monstermisogynistmadmansexual assaultperversionwoman in jeopardyrapistmaniacmurdererstabbed in the backnecklacescantily clad femalestabbed to deathbound and gaggedfoot chasemarijuanaremakeblood splattershowerpantiesfemale frontal nudityfemale rear nudityfemale nudityviolencebloodbare chested malechasepistolcell phonebeatingcorpsecar accidentshot in the chestshot in the headpunched in the facemaskheld at gunpointcar crashshot in the backswimmingcleavagewinestrangulationdeath of friendstabbed in the cheston the runliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonthreatened with a knifegirl in pantiesfalling down stairspot smokingfireplaceno pantiessociopathragestabbed in the stomachcoitusstealing a carfight to the deathpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downconvictrainstormabusive fathercopulationpsycho killermarijuana jointgirl in bra and pantiesparalysisviolence against womenshot in the neckhead woundremorsefemale friendship17 year oldshot in the eyenihilismsummer vacationunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenchild with a gunswimming in underweartortured to deathremake of american filmdelinquentrailroad crossinghit with a rockgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceshot through the eyesprayed with fire extinguisher (See All)

Wolf Creek (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)

Subgenre:
sadistic horrorcult filmindependent filmsuspenseslasher flickaustralian horror
Themes:
crueltyabductionevilsadisminsanitybrutalitypsychopathescapetorturerapekidnappingdeathmurderdrinkingfear …drunkennessexploitation (See All)
Mood:
slashernightmaregorecar chasenightdarknessblood and gore
Locations:
swimming poolbarbeachrestaurantcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All)
Characters:
slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilationmysterious villainmysterious killer
Period:
year 1999
Story:
sadistic psychopathserial rapisthomicidal maniacpsychopathic killerevil manmutilated corpsesickobloody violencegraphic violencedisturbed individualstation wagonsexual violencefilm starts with textserial murderhuman monster …bad guymadmanpervertbloodbathsexual assaultperversionsufferingrapistvictimmutilationmaniacdismembermentmurdererstabbed in the backcontroversystabbed to deathstabbingbound and gaggedvoyeururinationblood splattershot to deathknifedoggunbloodviolencetwo word titlekisscigarette smokingphotographtitle spoken by characterexplosionsingingpartychasebased on true storysongcorpsecar accidentmirrorshot in the chestshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomguitarshot in the backf wordswimminggay slurflashlightmassacrevideo cameraimpalementfalse accusationvanpainflash forwardattempted murderdangerprologueumbrellaon the roadstorytellingtentattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partobscene finger gestureufokillinggaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencepsychostrangerhome moviehomiciderampagerednecksevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtrainstormslaughtercapturecliffminetied feetbody countopening a doorcharacters killed one by onekilling spreepsycho killerdrugged drinkreflectionbarking dogcar troublemysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipslashingplaying guitarmind gamenihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechaniccar set on fireextreme violencemeteorcamcorderfilling stationoverturning carbriton abroadcaravantied up while barefootknife murderwaking upsole survivorfemale victimkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichebutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcampereclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingbackpackergory violencetrackingburpcratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
american horrorcult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horror
Themes:
evilinsanitypsychopathdeathmurderprisonmonstersupernatural powermurder of a police officer
Mood:
slashergorecar chasedarknessbreaking the fourth wall
Locations:
lakecemeteryforestsmall townboatwoodsamerica
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpoliceteenagerzombie
Period:
1980s
Story:
sadistic psychopathserial teen murdererhomicidal maniacpsychopathic killerevil mandrive in classicbloody violenceserial murderbad guymadmanbloodbathvictimmutilationmachetemaniac …dismembermentsevered armmurdererelectrocutionstabbed to deathstabbingblood splatterviolencesexcharacter name in titlenumber in titlesequelflashbacksurprise endingmasknumbered sequeldemondecapitationflashlightmassacreambulancesevered headchildlooking at the cameradrowningstalkingneck breakingunderwaterkillingundeadblood spattersplattermass murdergothiclifting someone into the airpsychoback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreemasked killerpsycho killerbeheadingkillsummer campslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesheart ripped outfemale victimoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerkilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
american horrorcult filmindependent filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickcanadian horror
Themes:
abductionevilinsanitybrutalitypsychopathtorturekidnappingsuicidedeathrevengemurderghostfeardrunkennessdeath of father …supernatural powerdeath of mothertraumafear of water (See All)
Mood:
slashernightmarehigh schoolgorerainbreaking the fourth wallblood and gore
Locations:
lakecemeteryforestsmall townpolice stationschool nurse
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenage girlfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage boyzombielittle girl …mysterious villain (See All)
Period:
2000s
Story:
sadistic psychopathserial teen murdererserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerevil mansadisticbloody violencegraphic violencesexual violenceserial murderbad guymadman …murder of a childvictimmutilationmachetemaniacdismembermentsevered armmurdererelectrocutionstabbingfoot chaseblood splattershowerviolencebloodcharacter name in titlesequelflashbackphotographexplosionpartysurprise endingpistolfirevoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashdemondecapitationimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on firecharacter's point of view camera shotcover updeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexcabinkillingundeadsplatterchild murderburned aliveheroinemass murderlifting someone into the aircomaragepsychosevered handgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensbeheadingmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalclawmasked villaindeformityfemale victimpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roommissing person posterburnt handpassed out drunkbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realitykilled by machete (See All)

Salò, Or The 120 Days Of Sodom (1975) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Salò, Or The 120 Days Of Sodom (1975)

Nazi-Fascist Northern Italy, 1943-44. Four senior members of government, aided by henchmen and Nazi soldiers, kidnap a group of young men and women. They hold them for 120 days, subjecting them to all manner of torture, perversion and degradation.

Subgenre:
cult filmtragedy
Themes:
crueltyevilsadismhumiliationinsanitybrutalitypsychopathvoyeurismtorturerapekidnappingsuicidedeathmurder …betrayaldanceweddingmental illnessexecution (See All)
Mood:
goresatireavant gardeambiguous ending
Locations:
churchbicycleitalycatholic church
Characters:
villainteenage girlteenagerprostituteteenage boyhomosexualitymaid
Period:
world war two1940s
Story:
sexual perversionsexual crueltyevil mansickoinfamybanned filmgraphic violencesexual violencedegradationhuman monsterspit in the faceforced to stripdead girlpervertperversion …sufferingrapistvictimsexual abusemutilationnipples visible through clothingscreamingpublic nuditycontroversyscantily clad femalefemale pubic hairthroat slittingstabbingvoyeururinationblood splattershot to deathpantiesknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nuditybloodgunviolencesexbased on novelnumber in titlemale nuditymale frontal nuditymasturbationmale rear nuditybondagebare chested malekissinterracial sexdancingnipplesmale full frontal nuditysinginglesbian kisserectionfondlingcryingsongdigit in titleunderwearface slapshot in the headbare buttplace name in titlebeddead bodypianomale pubic hairsubjective cameragay slurcandlemansionhousejokeradiopainbinocularsstrippingstorytellingscreamhangingcity name in titlelong takebodyguardtraploss of motherwhippingcross dressingteenage sexpowercloseted homosexualburned alivedresshateccentricbarefoot malesadomasochismsocial commentarywhipfascismeye gougingwedding dressdisfigurementstabbed in the eyeroomsodomymale objectificationhysteriadefecationgun held to headvillamasochismanal rapefascistmale rapenihilismtransvestismbishopextreme violencemacabrechapter headingsmatricidesex with a minorquotationforced marriagecity in titlesexual humiliationmurder victimasphyxiationexcrementfetishismbrandingtortured to deathforkdebaucherysexual sadismsexual torturewaltzbiblical referencefilicideplace in titleitalian cinemadehumanizationmealmidnight moviescalpingstabbed in the foreheadviolent sexperversityscatologystab woundmisanthropydeviant sexlibertinecoprophiliajumping from a windowbody mutilationcollectivismtorture deviceextreme filmurophiliabowel movementnotorietyhuman brandingfalling from a windowhyperrealismitalian fascismtongue rippingbarbarismscatforced sexual contactburning fleshfrench cinemabranding ironcoprophagiabroken ruleexcrement eatingmarquis de sadereference to danteeye removalsexual victimmental tortureadult actress playing minoranti nazismdeviant behaviorfake weddingcollectivist societyconga linereference to the marquis de sadesodomwash basinsocial masturbationfeces on faceleather obsessionsalobottom feeder (See All)

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
american horrorcult filmsuspenseb horrorpsycho thrillerindependent horror
Themes:
evilinsanitybrutalitypsychopathmurderdeathfearexploitation
Mood:
slashergoredarkness
Locations:
running through the woodslakewoodswheelchairpolice carcampfirebackwoodschase in the woods
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipmysterious villainmysterious killer
Period:
1980ssummeryear 1984
Story:
sadistic psychopathserial teen murdererhomicidal maniacpsychopathic killerevil manhorror movie remadedrive in classicsickosadisticdisturbingbloody violencesexual violencewetting pantsserial murderhuman monster …bad guymadmanvictimgrindhousemutilationnipples visible through clothingmachetechainsawmaniacmurdererconvertiblecontroversythroat slittingblood splatterpantiesfemale frontal nudityfemale nudityviolencebloodfightsexnumber in titlesequelflashbackkissnipplessurprise endingtelephone callcorpsedigit in titleblondeslow motion scenecatbikinimasksecond partdead bodynumbered sequelsubjective cameraswimmingdecapitationbrastrangulationmassacreimpalementjokesevered headskinny dippingstalkerprologuecharacter's point of view camera shotopening action scenestalkingobscene finger gesturelove interestkissing while having sexkillingsplatterchessfireplacespearmass murdergothiclifting someone into the airragevillainessphone boothmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarecharacters killed one by onekilling spreepsychoticmasked killerpsycho killernude swimmingcar troublemysterious manreturning character killed offsummer campfreakskirtslashinghillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforksole survivorlunaticpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichebutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdolifting a female into the airtrailtorturerhanged boygiallo esquesequel to cult filmboogeymaneast coastlost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Misery (1990)

Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in … the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)

Subgenre:
american horrorsuspensepsycho thrillersurvival horror
Themes:
madnessabductionevilsadisminsanitypsychopathinvestigationescapetorturekidnappingdeathmurderrevengeangerloneliness …obsessionmental illnesswritingmurder of a police officerclaustrophobia (See All)
Mood:
neo noirdarkness
Locations:
helicoptersnowsmall townwoodswheelchairsnow storm
Characters:
slasher killerserial murdererserial killerterrorvillainkillernursewriterhostageshooting a police officermysterious killerbaby killer
Story:
sadistic psychopathserial child murdererhomicidal maniacfemale villainserial child killerfemale serial killerpsychopathic killerfemale killerfemale psychopathbad girldrive in classicsadisticbloody violenceserial murderhuman monster …murder of a childvictimmutilationmaniacmurdererstabbingshot to deathknifeviolencefightgunbloodbased on novelone word titletitle spoken by charactersurprise endingbeatingcar accidentshot in the chestshotgunrescueslow motion scenecar crashsubjective camerawomansearchduelattempted murderauthorcharacter's point of view camera shotisolationpigbasementobscene finger gesturetypewriterkillingsociopathragecaptivevillainesspsychologydesperationpsychobroken legrampagetensionthunderfanfight to the deathbutchermedicationhighwaydark pastpsychoticnewspaper clippingpsycho killerphysical abuseintimidationnovelold dark houseslashingblizzardevil womanmatchidolmurderesspsychological torturereclusepsychotronic filmsledgehammervillain not really dead clichebutcherycreepmysterious strangerscrapbooktauntingdeeply disturbed personbipolar disorderborderline personality disorderobsessed fanchild killerweirdocreepychild murderervillainess played by lead actresstorturerpolice officer shot in the backdark and stormy nightbased on the works of stephen kingmarshalbludgeoned to deathmad womangruesomemeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistvictim invited to dinnerfight sceneceramicgrande dame guignolmale victimhomecare nursepicking lockstruggling authorfemale emasculating a male (See All)

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thriller
Themes:
evilsadisminsanitybrutalitypsychopathdeathrevengemurderfearexploitationpolice investigation
Mood:
slashernightmaregorerainnightdarkness
Locations:
cemeterysmall townwoodsamericabackwoods
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemother son relationshipteenagerbrother brother relationshipmysterious villainmysterious killercountry boy
Period:
1980s
Story:
sadistic psychopathserial teen murdererhomicidal maniacserial teen killerpsychopathic killerevil mandrive in classicbloody violencegraphic violencedisturbed individualserial murderhuman monsterbad guymadmanvictim …grindhousemutilationmachetechainsawmaniacmurdererthroat slittingblood splatterpantiesfemale frontal nudityfemale nudityviolencebloodsexnumber in titlebare breastssequelkissdancingchasesurprise endingdigit in titledead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacreimpalementchild in perilgravestalkercharacter's point of view camera shotdeath of brotherstalkingdeath of sonobscene finger gesturekissing while having sexlifting someone into the airbarnstabbed in the stomachpsychomasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killercar troublemysterious manlaundrydefecationsummer campcomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesfemale victimlunaticpsychotronic filmmurder of a nude womanmurder spreebutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightcandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationcopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotlifting a woman into the airspike in the head (See All)

A Nightmare On Elm Street (1984) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickteen movieteen horrorindependent horror
Themes:
evilpsychopathrevengemurdersurrealismfuneralsupernatural power
Mood:
slashernightmarehigh schoolgoreavant garde
Locations:
cemeterybathtubpolice station
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipalcoholicpolice chaseself mutilation …mysterious villainpolice lieutenant (See All)
Period:
1980s
Story:
sadistic psychopathserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerevil manhorror movie remadedrive in classicdisturbinggraphic violenceserial murderbad guymadmanswitchblade …victimgrindhousemaniaccult directorfoot chaseblood splatterviolencebloodbare chested malecigarette smokingsurprise endingdreamcorpsemirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomtelephonesubjective cameragood versus evilstrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shothangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearestrong female characterfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychostrong female leadseriessevered fingerbutcherheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendmaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerhanged boydemonicsevered facestreet in titleboiler roomremadeevil deadbroken backfurnacelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
american horrortragedypsycho thrillerslasher flick
Themes:
evilsadisminsanitybrutalitypsychopathtorturerapekidnappingsuicidedeathmurderdysfunctional familyhome invasionpolice investigationmurder of a police officer …mysterious death (See All)
Mood:
slashergoredarknessblood and gore
Locations:
small townstrip club
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenagerafrican americanboyfriend girlfriend relationshipboyhostagepsychiatrist
Period:
1970s
Story:
sadistic psychopathpsychopathic killerevil mansickosadisticdisturbingbloody violencegraphic violencesexual violencecarnageserial murderhuman monsterbad guymadmanpervert …murder of a childbloodbathperversionvictimmaniacmurdererstabbed in the backcontroversystabbed to deaththroat slittingstabbingremakeblood splatterknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nuditybloodviolencesexmale nudityphotographtitle spoken by characterchasepistolwoman on topbeatingcorpseshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordsubjective camerastrangulationmassacreimpalementstabbed in the chestjokechild in perilgraveyarddrowningauthorbeaten to deathattackuniformcharacter's point of view camera shotbaseball bathangingshot in the shoulderstalkingpremarital sexloss of motherprofanitykillingteenage sexblood spattersplatterkilling an animalelectronic music scoremass murderlifting someone into the airrageloss of friendpsychopsychologisthome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesdark pastbody countbroken armduct tapecharacters killed one by onekilling spreepumpkinpsychoticswearingmasked killerpsycho killerhit with a baseball batmexican americanporn magazinedead animaltrick or treatingabandoned housetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facemultiple murdermasked villainmatricideknife murderbutcher knifeloss of familyfemale victimmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boyboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesataniccontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

Friday The 13th Part III (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  …friends. (Read More)

Subgenre:
american horrorcult filmslasher flick
Themes:
abductionpsychopathmurderdeathrevengeexploitation
Mood:
slashergoredarkness
Locations:
lake
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlteenagerboyfriend girlfriend relationshipteenage boylow self esteemmysterious killer
Period:
1980s
Story:
sadistic psychopathhomicidal maniacserial teen killerpsychopathic killerevil mandrive in classicdisturbingdisturbed individualsexual violenceserial murderhuman monsterbad guymadmangrindhousemachete …maniacdismembermentsevered armmurderershowerbloodsexnuditynumber in titlesequeldigit in titlebikinimasknumbered sequelsubjective cameraaxeimpalementthird partcharacter's point of view camera shotcabinsplattermass murderlifting someone into the airragebarnroman numeral in titlepsychosevered handmasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killerpsycho killertorso cut in halfcar troubledefecationslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitypsychotronic filmbiker gangmurder spreemass murderergrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titlehockey maskgiallo esquesequel to cult filmyo yoskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoritebrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedysupernaturaldark comedyparanormalpsycho thrillerindependent horror
Themes:
evilsadisminsanitypsychopathescapetorturedeathmurdersurrealismdrugsghostsupernatural powerdeath of motheramnesia
Mood:
slashernightmarehigh schoolgoreraindarkness
Locations:
small townairplaneroad trip
Characters:
slasher killerserial murdererserial killerterrorvillainkillerfather son relationshipfamily relationshipsfather daughter relationshipteenagerteacherself mutilationyounger version of characterdeafnessgerman american …evil father (See All)
Period:
1970s1990s1960s1940s1950s
Story:
sadistic psychopathserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerevil mandrive in classicsadisticdisturbingbloody violenceserial murderhuman monsterbad guymadman …murder of a childrapistvictimsexual abusemutilationmaniacmurdererblood splatterknifeviolencebloodf ratedcharacter name in titlesequelflashbackbare chested maletitle spoken by characterfirepunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodykillingundeadchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditsragekicked in the stomachtherapistphone boothpsychoorphanageback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachuteslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointvillain played by lead actorstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterlunaticmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childreference to friedrich nietzschehit by a bustorturerboiler roomsequel to cult filmabusive stepfatherboogeymanburnt handhearing aidhit with a frying pangreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

American Psycho (2000) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American Psycho (2000)

Patrick Bateman is handsome, well educated and intelligent. He is twenty-seven and living his own American dream. He works by day on Wall Street, earning a fortune to complement the one he was born with. At night he descends into madness, as he experiments with fear and violence.

Subgenre:
american horrorcult filmindependent filmblack comedysuspensepsycho thrillerpsychological thriller
Themes:
madnessevilinsanitybrutalitypsychopathinvestigationescapetorturerapemurderdeathrevengefriendshipinfidelitydrugs …christmasmoneyjealousydrinkingfeardrunkennessweddingdeceptionmemoryangerdivorceparanoiablackmaildrug usemental illnessrivalryabuseexecutionbreak upgreedpaniccannibalismhomelessnessfashionwealth (See All)
Mood:
slashergoresatireneo noirambiguous ending
Locations:
new york citybarrestauranthelicopterbathtubnightclubtaxiapartmentpolice caroffice
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicehomosexualboyfriend girlfriend relationshipprostitutepolice officerdetectivepolicemanlawyerlust …security guardsecretarycousin cousin relationshipamericanpolice shootoutpolice chasehomeless manjewish americanself narrationcheating on one's girlfriendsex with prostitutesex killer (See All)
Period:
1980schristmas party
Story:
sadistic psychopathserial rapistsexual perversionhomicidal maniacpsychopathic killerevil manfemale victimssickosadisticbloody violencedisturbed individualcarnageserial murderhuman monstermisogynist …bad guymadmanpervertwoman in jeopardyrapistvictimchainsawmaniachandgunmurdererfemale removes her clothesscreamingcigar smokingcontroversyscantily clad femalestabbed to deathstabbingfoot chasevoyeururinationblood splattershot to deathshowerpantiesknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nudityviolencebloodgundogf ratedbased on novelmale nuditythreesomemale frontal nuditymale rear nuditytwo word titlebare chested malesex scenekisscigarette smokingdancingnipplesphotographexplosionpartyleg spreadingchasesurprise endingpistolfirevoice over narrationfondlingcryingcell phoneshootouttitle directed by femalebeatingcorpseunderwearfoodcar accidentmirrorshot in the chestblondeshot in the headwatching tvcatcameradrinkundressinggunfightsex in bedthongbare buttheld at gunpointsunglassesrunninglingeriebedcar crashdead bodyinterrogationrevolvermanhattan new york citytelephonemenage a troisf worddecapitationcleavagegay slurbrawinenew yorkstrangulationaxevideo cameraambulancewomanmontageimpalementcocainestabbed in the chestexploding carmodelsevered headdrawingdouble crosspolice officer killedvoice overshot in the foreheadbartenderracial slurconfessionattempted murderlimousineblack pantiesbusinessmanpay phonechampagnesex with shoes onmassagemistaken identitymissing personkicked in the facechristmas treescreamshot in the shoulderdatepigpremarital sexfirst partkillingblood spattersplatterprivate detectivesurgerymachismoeyeglassescloseted homosexualpornographywaiteranswering machinefireplacerevelationmass murderlooking at oneself in a mirrortape recordersociopathscene during opening creditslifting someone into the airragevirusexercisewatching a moviebuttockseccentricgossipimpersonationphone boothpsychocovered in bloodbrooklyn new york cityblack humorschizophreniarealitymale underwearguardrampagebarefootremote controljanitorrear entry sextensiontelescopecouchhatredfitnessimpostorcannibaldark humorbutcherheadphonesescape attemptlaughtersketchslaughterrefrigeratortuxedobody countduct tapeaxe murderbriefcasenervous breakdownalienationcharacters killed one by oneethnic slurkilling spreeworld trade center manhattan new york citysirenpsycho killerdrugged drinkwoman in bathtubvillain played by lead actorvideo tapefianceehysteriaface masklaundrynotebookkilling a dogmen's bathroomspiral staircasefemale removes her dresssnorting cocainejournalmini dressrestroomskyscrapermasseuselaundromatslashingcall girlsplit personalitycredit cardbody in a trunknarcissismreference to donald trumpdance clubwoman in bra and pantiesnihilismyuppiedruggedbathrobebusiness cardoffscreen killingcdeastersense of smellbumpearl necklaceurinal80s musicsole black character dies clichevanityfur coatsushihomeless personreference to ronald reaganoverhead camera shotrealtorhobopool of bloodfemale bartenderfemale victimlunaticcocaine snortingceohedonismvice presidentanimal killingmass murdererjerkbutcherywalkmaninnocent person killedsuspenderscrime spreehigh societyidentity crisismaterialismstairwellmartinideeply disturbed personcityscapekilled during sexbroken engagementcult figureborderline personality disordercorporate executivenail gunwall street manhattan new york cityaxe in the headsex act reflected in mirroranswering machine messageruthlessnessbritish actor playing american characterautomated teller machinebottled watercreepycompact discexercisingspiked drinkraincoatmisanthropeambiguitytwin towerscuisinemultiple personality disordervideotaped sexworld trade centerstockbrokerharvard universitynylonswashroomdissectionover the tophigh risedouble murderdragging a dead bodygory violenceeast coastlock of hairstreet walkeraxe murdererchauvinismmanicureunreliable narratorgruesomepornographic videotanning bedfirst lesbian experiencelasciviousnessmistletoemurder confessionbloodlustchainsaw murdermusic fansavagerywall streetsexual experimentationinvestment bankermurdered womanreservationsteroidlistening to music on headphonesvoice imitationyale universitydry cleaningemployee employee relationshiphacked to deathsex maniacbedsheetbrutalmergerreference to ted bundycheating on one's boyfriendoffice jobreference to mikhail gorbachevdecolletagestain27 year oldnarcissistic personality disorderparanoiacsadistic killeranti consumerismfrenzylithiumovercoatinner monologueslashed to deathstuffed toy animalxanaxreference to whitney houstoncouturefeet on deskreference to genesiswhite collarantisocial personality disorderblack nylon stockingsclothes hangerhiding evidencepet pigfalse alibikentucky derbysadistic sexsound systemreference to dorian graycorporate raiderdead body in bathroomreference to ed geinreference to phil collinswoman kicks a manchild of divorcechinese laundryhead in refrigeratorskin caresnorting coketruth taken as a jokecranberry juicepretend telephone callreference to elvis costellorope skippingcoasterharvard business schoolreference to ivana trump (See All)

Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (1981)

In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.

Subgenre:
american horrorcult filmsuspensepsycho thrillerslasher flickholiday horror
Themes:
madnessinsanitybrutalitypsychopathseductionvoyeurismtorturedeathmurderjealousyfearmemoryobsessionparanoiablindness …traumamurder investigationmurder of a police officerpsychological trauma (See All)
Mood:
slashergorenightdarkness
Locations:
hospitalcarsmall townwheelchairpolice carhospital fire
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenage girlpoliceteenagerboyfriend girlfriend relationshippolice officernursedetectivepoliceman
Period:
1970syear 1978
Story:
sadistic psychopathserial teen murdererhomicidal maniacserial teen killerpsychopathic killerdrive in classicbloody violencedisturbinggraphic violenceserial murderhuman monsterbad guymadmandead girlbloodbath …victimgrindhousemutilationmaniacmurdererstabbed in the backscreamingnecklacebathstabbed to deaththroat slittingstabbingvoyeurshootingblood splatterknifefemale rear nudityfemale nudityviolencebloodsexnuditynumber in titlemale nuditybare breastssequelmale rear nuditytwo word titlekisscigarette smokingnipplesexplosionchasetelephone callfirecryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmasksecond partneighborrevolversubjective cameragood versus evilhalloweenflashlightold manstrangulationambulanceaccidentbrunettepart of serieshit by a carsearchpantyhosenews reportold womanattempted murderstalkerstrippingbeaten to deathprologueperson on fireuniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapsplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolpsychopsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebroken glassbutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyedark pastbody countcharacters killed one by onedead woman with eyes opennude woman murderedlightneighborhoodsmokemasked killerpsycho killerflat tirefemale stockinged feetconfusioncar troublemysterious manstoreneedlemedical masksurgical maskdark secretbandagelighteralonesuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbutcher knifeman on firepool of bloodfemale victimscaremurder spreenude bathingsilhouettevillain not really dead clichebutcherygrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myerscalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeyman21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmtemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanvulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All)

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
suspensesupernaturalparanormalpsycho thriller
Themes:
rape and murderevilinsanitypsychopathescapetorturerapekidnappingsuicidemurderdeathmarriageghostprisonfear …memorysupernatural powerparanoiadrug usemental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husband (See All)
Mood:
slashernightmaregorerainneo noirdarkness
Locations:
swimming poolhospitalcarbathtubtaxipolice stationpolice car
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerreference to godfather son relationshipfamily relationshipspolicehusband wife relationshipmother son relationshipfather daughter relationshipdoctor …tattoofemale protagonistnursepolicemanlawyersecurity guardpsychiatristself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
sadistic psychopathrape victimserial rapisthomicidal maniacpsychopathic killerevil manfemale victimssadisticdisturbingbloody violencegraphic violenceserial murderbad guymadmandead girl …woman in jeopardyrapistmaniacmurdererscreamingcigar smokingthroat slittingfoot chaseshootingblood splattershowerknifefemale frontal nudityfemale nudityfightgunviolencebloodsexf ratedinterviewflashbackbare chested malekissphotographexplosionchasesurprise endingpistoltelephone callfirecryingcell phonedreamcorpsecar accidentmirrorshotgunwatching tvcomputerrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalflashlightaxevideo camerawomanbridgesuicide attemptprisonerfalse accusationunderwater sceneshot in the foreheadattempted murdermicrophoneperson on firefantasy sequencepay phonefugitiveumbrellapossessionlightningattempted rapeinjectionpursuitstalkingdeath of husbandtrustkillingtherapypizzasyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychomental institutionbarefootjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killermemory lossintimidationgothvideo tapemental patientelectricitykillmental breakdownblackoutsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcorderinmateman on firetrapdoorfemale victimpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gownbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarydefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Texas Chain Saw Massacre (1974)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horrorindependent horror
Themes:
madnessevilsadisminsanitybrutalitypsychopathescapetorturekidnappingmurderdeathfriendshipfearparanoiadysfunctional family …exploitationpaniccannibalisminheritancenear death experience (See All)
Mood:
slasheravant gardedarknessambiguous ending
Locations:
cemeterycarkitchenwheelchairfarmroad triptruckgas stationtexascountryback country
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage boyhostageself mutilation …truck driverself inflicted injury (See All)
Period:
1970syear 1973
Story:
homicidal maniacpsychopathic killerevil manpocket knifehorror movie remadedrive in classicsickobanned filmsadisticbloody violencedisturbingrunning out of gasdisturbed individualheld captivefilm starts with text …serial murderhuman monsterbad guymadmanbloodbathhippiewoman in jeopardyhitchhikingvictimgrindhousemutilationchainsawmaniaccult directordirectorial debutchickenmurdererscreamingcontroversybound and gaggedfoot chaseurinationblood splatterknifebloodviolencephotographchasesurprise endingvoice over narrationbeatingcorpseblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalflashlightambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crossvangraveyardnews reportfive word titlegravebeaten to deathdangerattackfirst of seriesproduct placementknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigtied upfirst partthreatened with a knifegrandmothercross dressingcowkillingsplatterfreeze framepickup truckropegothiclifting someone into the airgroup of friendsbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodproduced by directorskullhitchhikermasked manfull moonrampageredneckdamsel in distresstensionlow budgetgrandfathercannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onekilling spreetank toploss of brothermasked killersouthern accentclose up of eyescar troublehysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditsmeatestatetexanabandoned housefarmhouseanimal crueltyslashingcar washhit by a truckhillbillyoffscreen killingeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonelifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodywriting in bloodcut armscreaming in feardinner tablefrozen bodyskinweirdocreepydead teenagergeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadescreaming in horrorfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhypothermiascream queenyelling for helpburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

The Hills Have Eyes 2 (2007) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes 2 (2007)

A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)

Themes:
rape and revengeevilinsanitypsychopathtorturerapesuiciderevengedeathmurdercannibalism
Mood:
slashergore
Locations:
desertwaternew mexico
Characters:
slasher killerserial killerterrorvillain
Period:
year 2007
Story:
sadistic psychopathhomicidal maniacpsychopathic killerevil mangraphic rapesickosadisticbloody violencegraphic violencesexual violenceserial murderhuman monsterbad guymadmanmaniac …dismembermentsevered armstabbed in the backstabbed to deathstabbingremakeblood splattershot to deathfemale nudityfightnuditybare breastssequelexplosionsurprise endingpistolfirelickingcorpseshot in the chestshot in the headfalling from heightriflenumbered sequelf wordgood versus evilsurvivalgay slurarmyimpalementstabbed in the chesttrainingbeaten to deathkicked in the faceshot in the shouldertragic eventexploding bodysplatterropeclaim in titlemutantrageassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminebody countaxe murderkilling spreenude woman murderedpsycho killertorso cut in halffemale soldierblood on camera lensintestinesgiving birthstrandedstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencestabbed in the facedrillunwanted pregnancydeformitypsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguenational guardshootpregnant woman nudeskull crushingsequel to remakelong tongueraped by monstermutilated bodyumbilical cordtwisted ankleport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerparanormal phenomenaslasher flickteen horror
Themes:
evilpsychopathescapedeathrevengemurdermonstersupernatural powerdrug addictionmurder of a police officer
Mood:
slasherhigh schoolgorerain
Locations:
new york cityboatwoodsseacityamericasewer
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlteenage boyzombiepolice officerteacher student relationshipmysterious villain
Period:
1980s
Story:
sadistic psychopathserial teen murdererhomicidal maniacpsychopathic killerevil manwhite pantiesserial murderbad guymadmandisembowelmentmutilationmaniacelectrocutionnecklacestabbed to death …throat slittingstabbinggangblood splatterpantiesfemale nudityviolencebloodcharacter name in titlenumber in titlesequelbare chested maleexplosionmirrornumbered sequeldemonhallucinationguitarmanhattan new york citydecapitationflashlightnew yorkstrangulationaxevideo cameraimpalementsubwayexploding cardrowningon the runblack pantiescharacter's point of view camera shotattempted rapeunderwaterundeadhypodermic needlelifting someone into the airpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childslaughterstabbed in the eyebody countcharacters killed one by onesequel to cult favoritemasked killerpsycho killerbeheadingsummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseybig applegirl strangling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedydark comedypsycho thrillersurvival horror
Themes:
evilsadisminsanitypsychopathkidnappingdeathmurderdeceptionincestmental illnesshome invasiongreedcannibalismwealthstarvation …claustrophobia (See All)
Mood:
slashergoresatiredarknesssocial satire
Locations:
los angeles californiaslum
Characters:
terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog
Period:
1990s
Story:
sadistic psychopathhomicidal maniacfemale serial killerpsychopathic killerevil manfemale psychopathbad girlsickodisturbed individualserial murderhuman monsterbad guymadmanpervertmurder of a child …perversiongrindhousemutilationmaniaccult directorelectrocutionsuburbbirthdayblood splattershot to deathknifeviolencedogbloodcigarette smokingtitle spoken by characterpistolcorpseshot in the chestface slapshotgunflashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguedolldeath of childskeletonbasementcharacter says i love youterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragestabbed in the stomachspiderpsychosevered handskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticsoulbody countdead boycellarlasersightlandlordpsycho killergothhiding in a closetold dark houseschemeevictionlighterclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a manmurder spreegrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorshot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodyabused childpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

Split (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
american horrorblack comedysuspensesuperherotragedypsycho thrillersurvival horrorteen horrorpsychological thriller
Themes:
insanitybrutalitypsychopathvoyeurismescaperapekidnappingdeathmurderfriendshipsurrealismbetrayalfearfuneralmonster …deceptiondeath of fatherparanoiamental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
slashergoreneo noir
Locations:
foresttraintaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlfather daughter relationshipteenagerafrican americandoctorpolice officerhostagesecurity guardpsychiatrist …uncle niece relationshippolice dog (See All)
Period:
2010s
Story:
sadistic psychopathhomicidal maniacpsychopathic killerevil manfemale victimsbloody violencedisturbingsexual predatordisturbed individualchild molesterserial murderhuman monsterforced to stripbad guypedophile …woman in jeopardyrapistvictimmaniacmurderernecklacevoyeurbirthdayshot to deathpantiesknifedogviolencebloodone word titlesequelflashbackbare chested maledancingtitle spoken by characterpartychasesurprise endingcell phonecorpseshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partneighborriversubjective camerasurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womantransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgundamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attempte mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastbody countcharacters killed one by onekilling spreechloroformpsycho killertorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliamental breakdownscene before opening creditsspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastsole survivorwhite brafemale victimschizophreniclocked in a roommolestationchild rapefade to blacksinistercreepabusive motherboom boxvideo diaryhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagercaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangervillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

Halloween (1978) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerslasher flickteen movieteen horrorholiday horror
Themes:
evilpsychopathdeathmurderfearcorruptionparanoiamurder of family
Mood:
slasherhigh schoolnight
Locations:
carsmall towncar theftkitchen knife
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlhusband wife relationshipteenagerboyteenage boyfemale protagonistgirllittle girllittle boy …psychiatristdoctor patient relationship (See All)
Period:
1970s1960syear 1963year 1978
Story:
sadistic psychopathhomicidal maniacescaped killerpsychopathic killerevil manhorror movie remadedrive in classicserial murderhuman monsterbad guymadmanwoman in jeopardygrindhousemutilationmaniac …handgunmurderersuburbstabbed to deaththroat slittingstabbingmarijuanablood splattershot to deathknifefemale nuditydoggunviolencenudityone word titlecigarette smokingtitle spoken by charactersurprise endingshot in the chestwatching tvfalling from heightmaskrunninglow budget filmneighbortelevisiontelephonesubjective cameragood versus evilhalloweenstrangulationchildgunshotattempted murderprologuefirst of seriespay phonecharacter's point of view camera shothalloween costumelong takestalkingfirst partkillingpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airstabbed in the stomachblockbusterpsychodead womanmasked manwatching televisioncouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endbody countdead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothmental patientyellingclosethiding in a closetkillsuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimoff screen murderwetnessmurder spreevillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeyman21 year oldpumpkin carvinglifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
american horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horrorurban fantasy
Themes:
evilsadisminsanitybrutalitypsychopathinvestigationrapemurderdeathfriendshipghostpregnancyfearmonstersupernatural power …depressiontrauma (See All)
Mood:
slashernightmaregore
Locations:
swimming poolhospitalchurchcarmotorcyclewatercar on firedeath in a car accident
Characters:
slasher killerserial murdererserial killerterrorvillainkillerreference to godfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationship …doctorboyfemale protagonistgirlnursebabyartistlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
sadistic psychopathserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerevil manbeer drinkingdrive in classicsadisticbloody violencecarnageserial murderbad guymadman …murder of a childvictimmutilationmaniacdismembermentsevered armmurdererscreamingstabbingfoot chaseshootingblood splattershowerknifefemale rear nudityfemale nuditygunviolencebloodsexf ratednuditybare breastssequelflashbackbare chested malephotographpartychasesurprise endingpistoltelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightplace name in titlebedcar crashdemonhallucinationgood versus evilflashlightdisguiseambulancedeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerlocker roomfantasy sequencechampagnepossessiondollscreamskeletonstalkingautomobilepremarital sexhaunted housekillingredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousemass murdergay characterfaintingcomic booklifting someone into the airmutantloss of friendspidercrying womanskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationvillain played by lead actortaking a showergiving birthmental patientmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowjockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsequel to cult filmboogeymanhorror iconfantasy sceneoff screen rapedrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapesleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghosthole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)

Subgenre:
american horrorcult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
evilsadismbrutalitypsychopathvoyeurismescapekidnappingrevengemurderdeathfriendshipsurrealismghostfearmonster …supernatural powerparanoiapanicmysterious deathshower murder (See All)
Mood:
slashernightmarehigh schoolgoreraindarknesspoetic justice
Locations:
swimming poolbarschoolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlfather son relationshipfamily relationshipshusband wife relationshiphomosexualmother son relationshipfather daughter relationshipteenager …mother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage boyteachergirlstudentpolicemanlittle girlself mutilationdrivergay teacher (See All)
Period:
1980syear 1985
Story:
sadistic psychopathserial teen murdererserial child murdererhomicidal maniacserial child killerpsychopathic killerevil manbeer drinkingcaged birddrive in classicsadisticreading a newspaperserial murderbad guymadman …murder of a childgrindhousemutilationnipples visible through clothingmaniacmurdererconvertiblestabbed in the backscreamingpublic nuditystabbed to deathstabbingfoot chasevoyeurblood splattershowerknifefightviolenceblooddogcharacter name in titlenuditynumber in titlemale nuditysequelmale rear nuditybondagebare chested malecigarette smokingpartychasesurprise endingtelephone callfirecryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationclassroomcriminalf wordsubjective cameraname in titlemassacrebasketballimpalementfootballstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderlegendlocker roomperson on firecharacter's point of view camera shotpossessionkicked in the facelightningscreamdiarygymhigh school studentexploding bodybasementratcharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalelectronic music scorewoundmass murdergothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodsadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonepsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fighttennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipcar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Irréversible (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Irréversible (2002)

Events over the course of one traumatic night in Paris unfold in reverse-chronological order as the beautiful Alex is brutally raped and beaten by a stranger in the underpass. Her boyfriend and ex-lover take matters into their own hands by hiring two criminals to help them find the rapist so that th …ey can exact revenge. A simultaneously beautiful and terrible examination of the destructive nature of cause and effect, and how time destroys everything. (Read More)

Subgenre:
cult filmindependent film
Themes:
rape and revengemadnessvengeancecrueltyevilsadisminsanitybrutalitypsychopathseductionvoyeurismraperevengedeathmurder …drugsmoneypregnancydrinkingfearincestangercorruptionlonelinessparanoiadrug usehomophobiaaidsfather daughter incest (See All)
Mood:
gorenightdarkness
Locations:
barcarparis francewatertaxielevatorurban settingcityfrancetaxi drivertunnelgay barsex in a bathroom
Characters:
policehomosexualfather daughter relationshipchildrenprostitutegay sexpolicemandancerex boyfriend ex girlfriend relationshippimp
Story:
rape victimsexual perversionsexual crueltyevil manfemale in showerwhite pantiessexual violencehuman monstermisogynistsexual assaultperversionpedophilesufferingwoman in jeopardyrapist …sexual abusenipples visible through clothingbralessscreamingfemale pubic hairvoyeurblood splattershowerpantiesknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nudityviolencefightbloodsexmale nudityone word titlebare breastsmale frontal nuditymasturbationmale rear nuditykisscigarette smokingdancingphotographpartyleg spreadingerectionfondlingbeatingmirrorslow motion scenepunched in the facewritten by directordrinkinterrogationprostitutionjailmale pubic haircleavagegay slurbedroomwinecandleambulancewomancocainesubwaynonlinear timelinepainstrippingbeaten to deathdangerscreamactor shares first name with characterlong takeisolationsadnesstrapthreatened with a knifewhippingheroinhatetransvestitehuggingdestinystreetdresssociopathcomahappinessvandalismassaultdesperationsadomasochismnaked womanfatehomicidehatredmercilessnessdespairstairspanties pulled downdisfigurementdark pastunsimulated sexbruisesodomymisogynyfire extinguishermenstruationhead blown offsubway stationsnorting cocainebitternessselfishnesspregnancy testmasochismanal rapehead injurycrushed headhallwaysex clubextreme violencedisfigured faceoverhead camera shotsex workerwhite dresspsychotronic filmcocaine snortingphilosophercurtaindepravitywashingcelibacydebaucherysexual sadismsexual torturesnorricambreaking a car windowparisbroken windshieldlawn sprinklereye candymoral corruptionskull crushinghit on the head with a fire extinguisherviolence against a womansexual exploitationdeviant sexbattered womanaltruismpeugeotwatching a porn videounderpassflashing lightsex maniacdegenerationfacial disfigurementhit with a fire extinguisherhardcore technoreverse chronologystreet prostitutiontransvestite prostitutefrench shock cinemablue lightcredits rolling downmistaken for a prostitutederanged manpopperssex degeneratebroken car windowsadistic sexretrograde narrativebreaking an armperverse sexrape scenetapewormtorn pantiesbrutal rape (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Se7en (1995) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Se7en (1995)

A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath …ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)

Subgenre:
american horrorcult filmtragedypsycho thriller
Themes:
evilinsanitypsychopathinvestigationtorturerapemurderrevengedeathreligionjealousyangergreedmurder investigation
Mood:
slashergorerainneo noir
Locations:
hospitalbarhelicopternightclubdeserttaxiurban settingapartmentpolice stationrooftopbrothel
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicehusband wife relationshipprostituteteacherdetectivephotographerlawyerinterracial relationshiplust …security guardpolice detectivebiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All)
Story:
sadistic psychopathhomicidal maniacpsychopathic killerevil manwhite pantiesforced suicidedisturbingrazor bladeserial murderhuman monsterbad guymadmanpedophileswitchbladerapist …victimmutilationmaniacmurdererscantily clad femalefoot chaseblood splattershot to deathpantiesdogbloodviolencenumber in titleone word titleinterviewbare chested malephotographtitle spoken by characterchasesurprise endingpistolshootoutcorpsedigit in titlecar accidentshot in the headshotgunarrestheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminaldecapitationgay slurflashlightambulancedinersubwaysevered headhit by a carnews reportshot in the foreheadattempted murderlibrarysadnesstied uptypewriterkillingfreeze framegirl in pantiestv newscard gamepokergothictape recordersociopathtied to a bedfbi agentcrucifixloss of wifeblockbusterswat teampsychosevered handobesityprideautopsybulletproof vestdisfigurementknife throwingbody countboxkilling spreeage differencedead dogalleycartoon on tvkillspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathfashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturespaghettimurder spreebarbershopmass murdererinnocent person killedcrime spreestairwellpolice partnerjumping from a rooftopwriting in bloodel trainpsycho terrorswatpolice protagonistbreaking down a doorcreepysleeping pillsreference to ernest hemingwayfingerprintstorturerreference to jack the rippergluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencevictim invited to dinnercredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All)

The Hills Have Eyes (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes (2006)

While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit …h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)

Subgenre:
tragedypsycho thriller
Themes:
madnessevilsadismbrutalitypsychopathtorturerapekidnappingsuicidedeathrevengemurderdeath of fatherdeath of motherdeath of wife …cannibalismself sacrificemurder of familyghost town (See All)
Mood:
slashergorehorror movie remake
Locations:
desertcavegas stationsuv
Characters:
serial killerterrorvillainkillerteenage girlfamily relationshipsbrother sister relationshipteenage boybaby
Period:
year 2006
Story:
homicidal maniacpsychopathic killerevil mangraphic rapebloody violencegraphic violencesexual violenceserial murderhuman monsterbad guymadmanrapistvictimmutilationmaniac …dismembermentsevered armmurdererstabbed in the backcontroversyfoot chaseblood splatterdogbloodviolencesurprise endingpistolcar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolveraxeimpalementstabbed in the chestexploding carsevered headshot in the foreheadperson on firevacationbaseball batamerican flagglassesfirst partkillingsplatterclaim in titleburned alivekilling an animalmutantragewalkie talkiehomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailerminebody countaxe murdermutationsevered legkilling spreedeath of loved onemannequinhysteriacrucifixionex copkilldead animalkilling a doghead blown offgerman shepherdstrandedexploding truckbitten in the neckburnt bodyextreme violenceminersiblingstabbed in the facecut into piecesdeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectnuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
american horrorcult filmindependent filmsupernaturalpsycho thrillerstop motion animation
Themes:
evilsadisminsanitypsychopathdeathmurderghostfuneralmonstersupernatural power
Mood:
slashernightmaregore
Locations:
cemeterybarchurchschool boy
Characters:
slasher killerserial murdererserial killerterrorvillainkillerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle motherself mutilation …alcoholic fatherevil nurse (See All)
Period:
1980s
Story:
sadistic psychopathserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerevil manforced suicidedrive in classicsadisticbloody violencedisturbingrazor bladecarnageserial murder …bad guymadmanswitchbladevictimmaniacmurdererstabbed in the backscreamingstabbed to deathstabbingfoot chaseblood splatterfemale nudityviolencenumber in titlesequelbondagebare chested malecigarette smokingsurprise endingfiredreamcorpsedigit in titleslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationnewspaperdeath of friendimpalementsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguepuppetpay phonedollskeletonisolationbasementcharacter says i love youkillingundeadsplatterfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixback from the deadclockdrug overdoserampagetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countcharacters killed one by onekilling spreepajamassmokepsycho killeralleyreturning character killed offohioevil spiritabandoned housestabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingdisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setdigging a gravemattressgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomboogeymansexy nursegluereference to edgar allan poefurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween H20: 20 Years Later (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
american horrorcult filmindependent filmpsycho thrillerslasher flickteen horror
Themes:
abductionevilinsanitypsychopathdeathmurderdrugsparanoiaalcoholism
Mood:
slashernightmarehigh school
Locations:
schoolsmall townelevatorkitchentruck
Characters:
slasher killerserial killerterrorvillainteenage girlfamily relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage boygirlnursepoliceman …security guardalcoholicsecretarymysterious villain (See All)
Period:
1990syear 1998
Story:
sadistic psychopathhomicidal maniacserial teen killerpsychopathic killerevil mansadisticbloody violencegraphic violenceserial murderbad guymadmanvictimmaniacstabbed in the backstabbed to death …toiletthroat slittingstabbingbirthdayknifeviolencebloodnumber in titlesequelchasepistolcar accidentfalling from heightmaskdead bodyneighborhallucinationtelephonesubjective cameradecapitationgood versus evilhalloweenflashlightwinecandlecaliforniaaxeambulancedeath of friendstabbed in the chestweaponsevered headattempted murderstalkerprologuekeyuniformcharacter's point of view camera shotmistaken identityactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingpsychofaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingbody countaxe murdercharacters killed one by onedivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen caranniversarybeheadingcar troublemysterious manfire extinguisherreturning character killed offhiding in a closetgateslashingbody bagstabbed in the facehiding placemasked villainknife murderbutcher knifefemale victimmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposaltrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All)

The Collector (2009) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
sadistic horroramerican horrorindependent filmsuspenseindependent horrorslasher horrorhorror b movie
Themes:
crueltyevilsadisminsanitybrutalitypsychopathescapetorturedeathmurderhome invasionexploitationmurder of a police officer
Mood:
slashergorenightblood and gore
Locations:
strip clubtrying to escape
Characters:
serial killerterrorvillainkillerteenage girlhusband wife relationshipfather daughter relationshipteenagermother daughter relationshiphostagethiefself mutilationtalking to oneself in a mirrormysterious villainthe family …mysterious killerkiller dogdirector of photography (See All)
Story:
sadistic psychopathhomicidal maniacpsychopathic killerevil mantrip wiresadisticheld captivecarnageserial murderhuman monsterbad guybloodbathperversiondisembowelmentwoman in jeopardy …victimmutilationmaniacelectrocutionscreamingscantily clad femalestabbed to deathstabbingfoot chaseblood splatterknifefemale frontal nudityfemale nudityfightviolencebloodcharacter name in titlebare breastsflashbacktwo word titlecigarette smokingnippleslesbian kisssurprise endingpistolbeatingcorpsemirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalgay slurflashlightimpalementstabbed in the chesthousetied to a chairchild in perilhit by a cardangerdebtscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspiderdesperationpsychocovered in bloodteddy bearhomeanimal attackhomicidemasked maneaten aliverampageburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditstitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onepsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wiremysterious manwifestabbed in the handset upconstruction workerpistol whiplightervery little dialogueacidclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanchandelierfinger cut offretroex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathbutcherygrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outmutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

It (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It (2017)

In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.

Subgenre:
american horrorsupernatural
Themes:
madnesscrueltyabductionevilsadismbrutalitypsychopathdeathmurderfearmonstermemoryracismsupernatural powerbullying …homophobiachildhoodcannibalismmissing childunlikely friendshipschool bullyingsupernatural powers (See All)
Mood:
gore
Locations:
forestschoolsmall townbicyclesewernew boy in town
Characters:
serial killervillainpoliceteenagerchildrenzombiebullylittle boyjewchildhood friendbar mitzvahboy in underwearevil father
Period:
1980ssummeryear 1989year 1988
Story:
sadistic psychopathserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerpocket knifebloody violencedisturbinggraphic violencechild molesterparentbad guypervertmurder of a child …pedophileswitchbladesexual abusemutilationmaniacsevered armmurdererblood splatterviolencebloodbased on novelone word titleflashbackkisstitle spoken by charactercatbattlepaintingbookbathroompianodemongay slurnewspaperchild abusechildcoffinchild in perilcreaturelibraryclownmissing persondeath of brotherbasementbrotherfirst partkillinggaragesplattersistereyeglassesballoonstreetoverallspsychocovered in bloodinterracial friendshipeaten alivebraverystabbed in the throatbutcherturtleabusive fatherbroken armcellarkilling spreeloss of brotherpsycho killerheroismunderdogspittinggirl in bra and pantiesoutcastwoodabandoned housebicyclingwellpharmacybare chested boypatriciderainingjumping into watercleaningfourth of julystutteringteenage girl in underwearpool of bloodreference to michael jacksonoverbearing motherold houseghoulglowing eyesevil clowncreepsidewalkdeeply disturbed personarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearchild killercamaraderiemonsterschild murdererhypochondriachit with a rockmissing person posterscreaming in horrorsinkfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
american horrorcult filmindependent filmmartial artsblack comedysuspensesupernaturalparanormal
Themes:
evilpsychopathmurderrevengefuneralsupernatural power
Mood:
slashernightmarehigh schoolgorerain
Locations:
cemeteryhospitalbeachsmall townelevatorschool nurseblood in water
Characters:
slasher killerserial murdererserial killerterrorvillainkillerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress
Period:
1980s
Story:
sadistic psychopathserial child murdererhomicidal maniacserial teen killerserial child killerpsychopathic killerevil mandrive in classicsadisticdisturbingserial murderbad guymutilationmaniacsevered arm …murdererstabbed to deathurinationblood splatterfemale frontal nuditydogbloodnumber in titlesequelbare chested malecigarette smokingphotographsurprise endingfiredreamcorpsedigit in titleface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phonekicked in the faceskeletondeath of brothercheerleaderdeath of songlassesunderwatersleepingkillingundeadpizzasurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreepsycho killervillain played by lead actorreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimmurder spreetime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chesttorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsequel to cult filmreference to aristotlewaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

Man Bites Dog (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Man Bites Dog (1992)

A camera crew follows a serial killer/thief around as he exercises his craft. He expounds on art, music, nature, society, and life as he offs mailmen, pensioners, and random people. Slowly he begins involving the camera crew in his activities, and they begin wondering if what they're doing is such a … good idea, particularly when the killer kills a rival and the rival's brother sends a threatening letter. (Read More)

Subgenre:
cult filmblack comedymockumentarydark comedyfound footagefake documentarydocumentary filmmakingpsychological thriller
Themes:
rape and murdercrueltyevilsadisminsanitybrutalitypsychopathescaperapekidnappingdeathmurderlovemarriagechristmas …moneypregnancydrinkingfeardrunkennessfilmmakingnaturelonelinessdeath of fatherdeath of mothermurder of family (See All)
Mood:
slashergoresatireavant gardemurder of a boy
Locations:
hospitalbarbeachrestauranttrainbathtubtaxikitchenapartmentrooftoptaxi driversex in a kitchen
Characters:
serial killerterrorvillainkillerfather son relationshipfamily relationshipshusband wife relationshiphomosexualmother son relationshipboyfriend girlfriend relationshipchildrensingerboyactorlawyer …film directorgrandfather grandson relationshipgrandmother grandson relationshipbaby boydeath of a boy (See All)
Story:
sadistic psychopathrape victimserial rapisthomicidal maniacsexual violenceserial murderhuman monstermurder of a childperversiondisembowelmentmutilationsexual abusemaniacmurdererring …stabbed in the backcontroversytoiletbirthdaybeerurinationblood splattershot to deathpantiesfemale frontal nudityfemale nuditygundogviolencebloodnuditymale nudityflashbackmale frontal nuditymale rear nuditycigarette smokingmale full frontal nuditysingingchasesongshootoutbeatingdreamcorpseunderwearfoodmirrorshot in the chestshot in the headpunched in the facewatching tvdrinkvomitingbeddead bodylow budget filmcafepianojailreference to jesus christmale pubic hairrevolvershot in the backreportersubjective cameraswimminggood versus evilgay slurwineold manstrangulationeatingpoliticianboxingaccidentbirdbirthday partypantyhoseold womantalking to the camerashot in the foreheadmicrophoneunderground filmchampagnedeath of childchristmas treeskeletonactor shares first name with characterpianisttragic eventfilm within a filmneck breakingratpubeuropechild murderheart attackbirthday cakeitalianpoemtv newswaiterclaim in titlebulletbreaking and enteringmass murdercakesociopatharchitectureboxereccentricskullrailway stationart gallerydead womandentistteamkickingmercilessnessdark humorshot in the facearabgang rapeslaughterdead woman with eyes openkilling spreenude woman murderedpigeonabandoned buildingblood on camera lensvillain played by lead actordefecationevictionfilm crewflutetelevision newsgun held to headfilm projectorhideouttv reportercameramancoca colafilm cameraseagullcredit cardaccidental shootingbody in a trunkbelgiummailboxracial prejudicesense of smellcorrupt politiciannaked dead womancinema veriteextreme violencemetal detectorsex on tablecamouflagemailmanjailbreaktoy gunneck bracedeath of parentspsychotronic filmoff screen murdermurder spreetelevision reportergrindhouse filmhungarianfleeingcrime spreespotlightinfanticidedeeply disturbed persondocumentary crewno survivorsdecomposing bodybigotquarryfalse teethfloatingdead babynight watchmanmodel airplanehousing projectwoman strangled to deathmidnight moviebrussels belgiumchristmas decorationpower plantsparklerelderly womansex on a tablebowelsstreakingmovie businessrailroad stationcementfirst communionpostal workerskylightelderly manmoroccanmutilated bodyflutiststocking capdirect cinemareference to brigitte bardotaestheticsnaked dead manfrench shock cinemasardinesound manepileptic fitfrench cinemareference to jean cocteauwrapped in a bedsheetmurder of a nude manscared to deathbiting handmusic conservatorydisturbed personreference to frank lloyd wrightgin and tonichead bashingunprovoked violencehigh rise apartment buildingpigstywashroom attendantdouche bagold woman murderedlow incomereference to jacques cousteaureference to jean gabinlow income housingnightingalereference to jean maraisrolled up rugdead body rolled up in a ruginsane violencesanta claus beardshooting through the ceilingid braceletrewound film sequencesignet (See All)

Blow Out (1981) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blow Out (1981)

This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo …vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)

Subgenre:
american horrorcult filmindependent filmconspiracyb horrorpsycho thrillerpolitical thrillerpolitical conspiracy
Themes:
evilsadismpsychopathinvestigationtorturemurderdeathpoliticsfilmmakingparanoiaguiltsurveillanceexploitationtechnologyclaustrophobia
Mood:
slasherneo noirnight
Locations:
hospitaltrainsnowcityrooftoptrain stationpennsylvaniacar in water
Characters:
slasher killerserial murdererserial killervillainkillerdoctorprostitutedetectivephotographerhitmanmurder of a prostitute
Period:
1980swinter
Story:
sadistic psychopathhomicidal maniacpsychopathic killerevil manfemale victimsdrive in classicsadisticdisturbingdisturbed individualcarnageserial murderbad guymadmanwoman in jeopardyvictim …grindhousemutilationmaniaccult directormurdererscreamingstabbed to deathvoyeururinationshowerknifefemale frontal nudityfemale nuditygunnuditybare breastsflashbacktwo word titlebare chested maletitle spoken by characterchasesurprise endingwoman on topcar accidentrescuewatching tvlingeriealcoholtelephonereportercleavageassassindisguisebridgepoliticiansubwayassassinationunderwater scenegunshotpoint of viewpay phonecover upattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessfireworksgraffititrustkillingtape recorderrecordingcaught having sexcrying womanmovie theaterphone boothpsychofrogparadedead womanmale underwearwatching televisionrampagedamsel in distressveteranslaughtermustachephiladelphia pennsylvanialonerbody countbriefscharacters killed one by onedead woman with eyes openkilling spreereckless drivingpsychoticpolitical corruptionpsycho killerfilm industryinterrupted sextruthsubway stationtelevision newsblackoutmotel roomrestroomgovernortv reporterslashingwhodunitemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathtapepsychotronic filmmurder spreetelevision reporterbroken bottlegrindhouse filmwiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepyred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esqueaudio recordingwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomwearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Maniac (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Maniac (2012)

Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession  …escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)

Themes:
sadisminsanitybrutalitypsychopathtorturemurderdeathfearlonelinessobsessiondepressiondrug useunrequited lovephotographychildhood trauma …psychological trauma (See All)
Mood:
slashergoreneo noir
Locations:
restaurantlos angeles californiasex in public
Characters:
serial killerterrorvillainkillerhomosexualmother son relationshiptattooprostitutephotographermysterious villain
Period:
1980s2010s
Story:
sexual perversionpsychopathic killerevil mandisturbed individualserial murderhuman monsterbad guydisembowelmentvictimmaniacdismembermentsevered armstabbed in the backnecklacestabbed to death …bound and gaggedfoot chasevoyeurremakeurinationblood splatterknifefemale rear nudityviolencebloodone word titlethreesomeflashbackphotographcell phonecorpsecomputercameravomitingcar crashbathroomneighborhallucinationsubjective camerawinestrangulationcocainestabbed in the chestsubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameratalking to the cameracharacter repeating someone else's dialoguekicked in the facetragic eventstalkingthreatened with a knifelooking at oneself in a mirrorscene during opening creditsragemovie theaterart galleryschizophreniaapartment buildingrampagepillsrejectiondeath of protagonistwedding dressdark pasttied feetnervous breakdownsevered legdead woman with eyes openmisogynymannequinwoman in bathtubvillain played by lead actorsuffocationconfusionstabbed in the handhiding in a closetsubway stationslashingbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootknife murderfemale victimstrangled to deathschizophrenicbreaking through a doormurder of a nude womanmurder spreeonline datingbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All)

Psycho (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
american horrorcult filmindependent filmsuspensepsycho thrillerpsychological horror
Themes:
madnessinsanitypsychopathvoyeurismdeathmurdermarriagemoneyfearfuneraldeceptiondivorcetheftguiltdating …mental illnessunrequited love (See All)
Mood:
slasherraindarknessbreaking the fourth wall
Locations:
churchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerfamily relationshipsmother son relationshipfriendpolicemansister sister relationshipthiefpsychiatristsecretary
Period:
1960syear 1960
Story:
sadistic psychopathhomicidal maniacpsychopathic killerfemale in showerhorror movie remadedrive in classicbloody violencedisturbingdisturbed individualserial murderhuman monsterbad guymadmanbloodbathpeeping tom …victimgrindhousemutilationmaniacmurdererfemale removes her clothesbathstabbed to deathtoiletstabbingvoyeurshowerbloodviolencebased on novelone word titleinterviewflashbackbare chested malephotographsurprise endingtelephone callvoice over narrationcorpseunderweararrestundressingsecretbathroomjailhallucinationsubjective cameragood versus evilnewspaperbracaliforniadisguisewomanwidowstabbed in the chestbirdold womanstalkerwidowerfirst of seriescharacter's point of view camera shotmistaken identitymissing personscreamlong takecountrysidewitnessbasementtrapfirst partthreatened with a knifecross dressingkillingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airblockbusterimpersonationphone boothpsychoskulldriving a carapartment buildingcamera shot of feetimpostorgash in the facedeath threatbutcherblack braswamparizonarainstormbody countextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonepsychoticpsycho killerfemale stockinged feetimpotencevillain played by lead actormysterious mandirector cameoold dark housefemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodyslashingdomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderfemale victimreclusemurder of a nude womanmurder spreesilhouettefade to blackpeep holebutcherygrindhouse filmcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in brapsycho terrorloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordragging a dead bodydriving in the rainfalse accusation of murderslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

A Serbian Film (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Serbian Film (2010)

In Serbia, the retired porn star Milos is married with his beloved wife Marija and they have a little son, Peter, that is their pride and joy. The family is facing financial difficulties, but out of the blue, Milos is contacted by the porn actress Lejla that offers him a job opportunity in an art fi …lm. Milos is introduced to the director Vukmir that offers a millionaire contract to Milos to act in a film. However, Vukmir neither show the screenplay nor tell the story to Milos. Milos discuss the proposal with Marija and he signs the contract. But sooner he finds that Vukmir and his crew are involved in sick snuff films of pedophilia, necrophilia and torture and there is no way back to him and maybe it is too late to protect his family. (Read More)

Subgenre:
independent film
Themes:
rape and revengemadnesscrueltyabductionevilsadisminsanitybrutalitypsychopathtorturerapekidnappingsuicidemurderdeath …marriagemoneybetrayalfeardeceptioncorruptionobsessionclaustrophobiadeath in childbirth (See All)
Mood:
nightmaregoredarkness
Locations:
bar
Characters:
husband wife relationshiphomosexual rapegay rape
Story:
sexual perversionsexual crueltyevil manpsychological tormentsickomistreatmentgraphic violencesexual violenceatrocitydegradationdead girlpervertperversionsufferingvictim …sexual abusemutilationmachetecontroversyshootingblood splattershot to deathshowerfemale full frontal nudityfemale frontal nudityfemale nudityviolencefightgunbloodmale nudityflashbackmale frontal nuditymasturbationbondagebare chested maleejaculationnipplesmale full frontal nudityleg spreadingsurprise endingerectioncryingmirrorshot in the chestsecretmaskvomitingfightingdecapitationvideo cameraimpalementchild abusepainbeaten to deathcharacter's point of view camera shotfilm within a filmchildbirththreatneck breakingpornographyundergroundballoonhypodermic needledesperationsadomasochisms&mchokingmasked manstabbed in the neckporn starcon artistdead childpanties pulled downdeceitnervous breakdownsodomymasked killerdrugged drinkmale objectificationsuffocationmysterious manbrainwashingnecrophiliapedophiliametaphorfilm crewmasochismanal rapesicknessunderworldpornographerbitten in the necksnuff filmmale protagonistnewborn babymacabrecrotch grabdecadencepsychological torturesex with a minorwatching a videomurder of a nude womangrindhouse filmspanking during sexdepravityasphyxiationclothes rippingfetishismsnuffnewborntortured to deathone eyed mansexual sadismsexual torturestatutory rapeporn directormeta filmchild pornographywatching pornographycamera crewfiendfamily lifeperversitypornography directorgibberishhandcuffed to a bedincest rapesleazedeviant sexoral rapeunderground pornographyfacial bruisetransgressive filmrape of a minorchoked to deathextreme filmpainful sextooth extractionbeheadedsex with the deadmaking lovepretensiondupeforced sexual contactsuspended by armsantisocial personality disorderpornography performerporn performerdriven insaneimpaled through the headeye socketrape of a childsnuff videosqueezing breastbiting penisdrug injectionextreme sexual content (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Natural Born Killers (1994) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Natural Born Killers (1994)

Mickey Knox and Mallory Wilson aren't your typical lovers - after killing her abusive father, they go on a road trip where, every time they stop somewhere, they kill pretty well everyone around them. They do however leave one person alive at every shootout to tell the story and they soon become a me …dia sensation thanks to sensationalized reporting. Told in a highly visual style. (Read More)

Subgenre:
cult filmindependent filmblack comedypsycho thriller
Themes:
madnesscrueltyevilsadisminsanitybrutalitypsychopathseductionescaperapekidnappingdeathrevengemurderlove …surrealismprisonfeardeceptionincestcorruptiondeath of fatherdeath of motherparanoiadysfunctional familysurveillanceexploitationpolice brutalityprison escape (See All)
Mood:
slashernightmaregoresatireneo noirarchive footagebreaking the fourth wallstylization
Locations:
forestparis francedesertlondon englandwoodskitchenfarmroad tripmotelgas stationcampfireroad movienew mexicoprison bus
Characters:
serial killerfather son relationshippolicehusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipprostitutedetectivehostagetough guynative american …waitresssecurity guardjapanesepolice detectivepsychiatristaustralianpolice shootoutself mutilationwitch doctor (See All)
Period:
1990s
Story:
rape victimhomicidal maniacfemale serial killerpsychopathic killerfemale killerevil manfemale psychopathescaped prisonerescaped convicthuman monstercynicismgrindhousesexual abusemaniacmurderer …convertibleringelectrocutioncontroversystabbed to deaththroat slittingbound and gaggedbeershootingurinationblood splattershot to deathpantiesknifeviolencefightbloodsexinterviewflashbackbare chested malecigarette smokingdancingphotographexplosionsingingthree word titlesurprise endingpistolfirecell phoneshootoutbeatingdreamcorpsefistfightmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facecameraarrestundressinggunfightbrawlbookvomitingheld at gunpointsunglassesdemonjailhallucinationhandcuffstelevisioncriminalshot in the backf wordsubjective cameragay slurflashlightjournalistambushstrangulationmassacrewomanmontagebridgedinerprisonerstabbed in the chestweaponmapsnakechild abusesevered headdream sequenceanti herodisarming someonedouble crosspolice officer killedfemme fatalenews reportdrowningshot in the foreheadon the runflash forwardone against manyauthorcharacter repeating someone else's dialoguebeaten to deathprologuefantasy sequencefugitivepoisoncharacter's point of view camera shoton the roadangelkicked in the facerabbittough girlscene during end creditswitnessneck breakingpremarital sexthreatened with a knifefireworksnewspaper headlinesubtitled scenecorrupt copsplatterfreeze frameriotpickup trucktv newswolfburned alivemass murderlooking at oneself in a mirrortape recordersociopathfamescene during opening creditscowboy hatsecurity camerajail cellwalkie talkiekicked in the stomachpop culturemediavillainesscovered in bloodsheepjournalismsadomasochismpart animationblack humortorchfateanimal attackmexican standoffschizophreniasocial commentaryhaircutmechanicwatching televisionrampageredneckcrime scenehaunted by the pasttokyo japanprison guardstealing a carfandual wieldstabbed in the throatanimated sequencemercilessnessironychaosblack and white scenetime lapse photographypunched in the chestsexual harassmentassault rifleaccidental killingarizonablood on shirthighwaywedding ringknife throwinggasolinedark pastabusive fatherfemale reporterkilling spreeburned to deathpsychoticmedia coveragefast motion scenesouthern accentbullet timeclose up of eyesdesert eaglenews reportershot through a windowblood on camera lensvillain played by lead actortaserstock footagefilm crewautographjukeboxrepressionfish tankcameramancoca colatornadoanarchysawed off shotgunscorpiondeath rowshamanpatricideantwhite trashpiewoman kills a manshot in the handcorrupt policefight the systemextreme violencefilmed killingtragic pastwoman fights a manmatricidecrowbarfemale criminalnevadatabloidrattlesnakesex with a minorjailbreakpool of bloodcockney accentexposesnake biteanimal killingmass murdererprison wardensolitary confinementknocked out with a gun buttsocial decayinnocent person killedextreme close upkicked in the groincrime spreehorse chasemaceprison riotdrugstoredutch angleantidotesuper bowlgeneration xnewscastermedia manipulationsurprise during end creditswoman punches a manmass mediafemale bodybuildermob of reporterspepper spraytelling a joketear gasgas grenadeshooting starreference to charles mansonriot policeimplied incestmagic mushroombleeped dialoguemulletmedia hypehuman shieldmurderer duoindian reservationlaundry roomslide locked backnavajotrippyyin and yanglaugh tracklovers on the lamtwo killerstraumatic childhoodknife in backtv journalisttime magazinenews crewshivmanicsevered toefugitive sextrampled to deathhanging bodyhowie screammedia exploitationpsychedelic imageeeny meeny miny moetv advertdarwinian struggle for survivalrear projectionorff carmina buranatabloid journalistpsychopathic copsnakebite poisonstargazing (See All)

Halloweenviii: Resurrection (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickteen horror
Themes:
evilpsychopathrevengedeathmurderfeardeceptionsurveillancemurder of a police officer
Mood:
slashergoresatire
Locations:
forestwoodskitchenwheelchairrooftopfire truck
Characters:
slasher killerserial killervillainkillerteenage girlteenage boynursesecurity guardpsychiatristcoroner
Period:
2000s
Story:
sadistic psychopathhomicidal maniacserial teen killerpsychopathic killerevil manserial murderhuman monsterbad guychainsawmaniacsevered armmurdererelectrocutionstabbed in the backstabbed to death …throat slittingfoot chaseblood splatterknifefemale nudityfightbloodviolencesequelflashbacktwo word titlechasesurprise endingfirecell phonecorpsefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenflashlightstrangulationaxeambulancemontageimpalementstabbed in the chestinternetsevered headpolice officer killednews reportcharacter's point of view camera shotproduct placementkicked in the facecollege studentlightningskeletondisappearanceneck breakingthreatened with a knifeobscene finger gesturekillingheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetold dark houseabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)

Subgenre:
cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
sadisminsanitybrutalitypsychopathinvestigationrapemurderdeathsurrealisminfidelitychristmasghostjealousydrinkingdrunkenness …funeralangercorruptiondeath of fatherparanoiablackmailillnesshome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All)
Mood:
slashergorenightdarkness
Locations:
cemeteryhospitalbarrestaurantschoolcarbathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car …cityitalytruck (See All)
Characters:
slasher killerserial murdererserial killerterrorvillainkillerfather son relationshippolicehomosexualmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsinger …boygirlpolicemanmusicianactresspsychiatristmaidprofessorjewgermangay friendmysterious villainself pity (See All)
Period:
1970s
Story:
sadistic psychopathhomicidal maniacfemale villainfemale serial killerpsychopathic killerfemale killerfemale psychopathvideo nastybad girldrive in classicdisturbingmistreatmentgraphic violenceserial murderhuman monster …dead girlvictimgrindhousemaniaccult directormurdererstabbed in the backscreamingnecklacestabbed to deathstabbingshootingblood splatterknifeviolencegunbloodflashbacktwo word titlekisscigarette smokingphotographsingingchasesurprise endingtelephone callfiresongshootoutbeatingcorpsemirrorface slapwatching tvcameradrinksecretpaintingbookvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective cameradecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxeimpalementdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womandrowningpainattempted murderlibraryvirgindangerprologuepuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicionpsychiceuropekillingarsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationdriving a carhomeviolindead womanembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdrumsmysterious manapparitiondark secretkillgloveslong hairmen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machineboomerangblack glovesextrasensory perceptionchild's drawingexposed breastraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicwitness to murderreference to leonardo da vincicleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

I Saw The Devil (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Saw The Devil (2010)

SPOILER: Jang Kyung-chul (Choi Min-sik) is a dangerous psychopath serial killer. He has committed infernal serial murders in diabolic ways that one cannot even imagine and his victims range from young women to even children. The police have chased him for a long time, but were unable to catch him. O …ne day, Joo-yeon, daughter of a retired police chief becomes his prey and is found dead in a horrific state. Her fiance Soo-hyun (Lee Byung-hun), a top secret agent, decides to track down the murderer himself. He promises himself that he will do everything in his power to take bloody vengeance against the killer, even if it means that he must become a monster himself to get this monstrous and inhumane killer. (Read More)

Subgenre:
dark comedy
Themes:
rape and revengevengeancesadismhumiliationinsanitypsychopathvoyeurismtorturerapekidnappingmurderrevengebetrayaldrinkingfear …monstercorruptioncannibalismdevilmurder investigationdeath of daughterthe devil (See All)
Mood:
gorenight
Locations:
cemeteryforesthospitalsnowtaxi
Characters:
serial murdererserial killerkillerpolicechildrensoldierlustpolice detectivedaughter
Story:
sexual perversionstabbed multiple timesgraphic violencedouble barreled shotgunserial murderforced to stripdismembermentsevered armmurdererstabbed to deaththroat slittingstabbingbound and gaggedblood splatterknife …female frontal nudityfemale rear nuditybloodfightviolencedognudityflashbackmasturbationmale rear nuditysex scenekisscigarette smokingphotographcell phonebeatingfistfightpunched in the facesecretcar crashdead bodyfightingsubjective cameradecapitationstrangulationstabbed in the chestsevered headhit by a carsmokingbeaten to deathcharacter's point of view camera shotknocked outkicked in the faceattempted rapetragic eventcabinsecret agentpowerscene during opening creditsagentnosebleedcovered in bloodmasked manstabbed in the throathit in the crotchcannibalmercilessnessgash in the facestabbed in the neckstabbed in the headjumping through a windowdeath of sisterone daylens flaresevered legchaindeath of loved onemoral dilemmaengagement ringtorso cut in halftracking devicestolen carsuffocationstabbed in the handbag over headviolence against womenpolice chiefguitar playingstabbed in the armpharmacypolice captainhead bashed inbody in a trunkgreenhouseoffscreen killingscene of the crimesouth koreatop secretextreme violencemugshotstabbed in the facebutcher knifehit with a hammerpsychotronic filmcut handmurder of a nude womanscytheguillotinecat and mousepower strugglecamera focus on female buttstabbed with scissorstrail of bloodgenital mutilationsevered earhit with a chairtortured to deathbandaged handman punches a womantire ironmurder of a pregnant womanblood on the floorhit on the head with a fire extinguisherice pickhit on the head with a rockenvelope full of moneyhit with a wrenchburned with a cigarettejaw ripped offachilles tendon cutconfession of crimehacked to deathdead body in a freezerhit with a metal pipestabbed with a screwdriverfinger suckingwatching a porno moviebroken wristdriving a car without a doordeath of fianceedumb bellressentimentyoung women (See All)

Cannibal Holocaust (1980) is one of the best movies like The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cannibal Holocaust (1980)

With the intention to venture into the unexplored areas in the deep jungle of the Amazon rainforest at the border between Brazil and Peru, in 1979, a film crew composed of four young Americans attempted to make a documentary about the never seen before indigenous cannibalistic tribes. However, it's  …already been two months since anyone last heard from the crew, so without further delay, the noted anthropologist Professor Harold Monroe and his rescue team of the seasoned guide Chaco Losojos and his assistant, embarked on a mission to locate them in the depths of the Green Inferno. Following the Yakumos, a tribe that no white has ever seen before, soon enough, the Professor's rescue party will encounter the elusive Yanomamos or Tree People and the fearsome Shamataris or the Swamp People. Eventually, as more evidence is found concerning the fate of the film crew, the Professor will try to recover the raw footage that was paid in blood, and return it to New York to the executives of the Pan American Broadcasting System who crave to get the riveting unedited footage. What has really happened to the overambitious documentarists, and above all, what was in the final two reels? (Read More)

Subgenre:
sadistic horrorcult filmtragedyfound footageitalian horrorextreme horror
Themes:
crueltyevilsadismhumiliationinsanitybrutalitytorturerapedeathmurderfilmmakingdeceptionabuseexecutionexploitation …cannibalismabortion (See All)
Mood:
gorerain
Locations:
new york cityairplaneboatjungleusa
Characters:
boyfriend girlfriend relationshipsoldierwarriorprofessorfilmmaker
Story:
rape victimsexual perversionsexual crueltygraphic rapemutilated corpsevideo nastybanned filmsexual violenceheld captiveatrocitycarnagedegradationdead girlsexual assaultcastration …perversiondisembowelmentsufferingswitchbladevictimsexual abusemutilationmachetedismembermenthandgunscreamingpublic nuditycontroversyshootingurinationshot to deathknifefemale full frontal nudityfemale frontal nudityfemale rear nudityfemale nudityviolencebloodsexnuditymale nuditymale frontal nuditymale rear nuditybare chested malecigarette smokingmale full frontal nudityfirecameravomitingriflemale pubic hairrevolverrivertelevisionscientistsubjective cameradecapitationjournalistnew yorkmassacrebridgeimpalementsnakebirdanimalnews reportshot in the leglooking at the cameratalking to the cameraskinny dippingdangercharacter's point of view camera shotskeletonhairy chestfilm within a filmtraptied upkillingmonkeyarsonuzishavingdestructionburned alivekilling an animalrevelationspearelectronic music scoremass murdersexual attractionspidercovered in bloodpart of trilogyskulltorchdead womansocial commentaryhomicideblood on facecannibalmercilessnessgunshot woundgang rapehandheld cameradead manslaughterturtletigertribemustachelieutenantparrottank topburned to deathphysical abusemudnude swimmingexpeditionbandagecanoefilm crewflutelightertelevision newsanimal crueltyshoutingamazonraftanimal abusecrewunconsciousnessmissingsnuff filmactual animal killedalligatorsouth americaextreme violencecamouflagegropingfilmingfemale victimsnake bitetelevision reporterviolent deathdovesexual humiliationexploitation filminfanticidecaptivityloinclothburningfemale journalistgenital mutilationundershirthutmass mediascreaming in fearsexual tortureleechscreaming in horrorwild boaranthropophagushuman fleshpregnant woman nudecold blooded murderentrailswoman in a towelmurder of a pregnant womaneating human fleshshaving creamamazon riveremasculationcovered in mudamazon tribesavagerytransgressive filmtorture deviceamazon jungleextreme filmnorth americatv journalistamazon rainforestphysical torturecannibal tribewooden stakeanacondabarbarismhemorrhagerunning nakedburning villageamazon forestamazoniaman in a towelnaked bathingextreme crueltyinsidemacawtelevision executivenude in natureblow darttribal warfarevileanimal violenceamazonian indian (See All)

Halloween II (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (2009)

Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off  …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)

Themes:
evilinsanitybrutalitypsychopathsuicidedeathghostdrunkennessexploitationhomelessnessmurder of a police officerdeath of daughter
Mood:
slashernightmaregoreraindarkness
Locations:
hospitalhelicopterstrip club
Characters:
serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner
Story:
sadistic psychopathhomicidal maniacserial teen killerpsychopathic killerevil mansadisticbloody violencegraphic violencesexual violencefilm starts with textserial murderhuman monsterbad guyhippievictim …maniacmurdererstabbed in the backlatex glovesstabbed to deaththroat slittingstabbingurinationblood splatterfemale frontal nudityfemale rear nudityfemale nuditybloodviolencenumber in titlesequelinterviewflashbacksingingpartychasepistolbeatingdreamcorpsecar accidentshot in the chestshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperf worddecapitationhalloweenflashlightbandstrangulationdeath of friendimpalementstabbed in the chestexploding carhit by a carflash forwardstalkermicrophoneportraitclownattackhalloween costumescarstalkingglassesneck breakingprofanitypizzasurgerykilling an animalwoman with glasseshidingcovered in bloodsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facegash in the facetaking a picturestabbed in the headtime lapse photographybody countbroken armaxe murdercharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexbeheadinggroupg stringreturning character killed offmedical masksurgical maskslashingdental maskhead bashed inassistantstrong languagebody baghanged manhead cut offcountry houseextreme violenceoverturning carstabbed in the facefemale victimpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to The Last House On The Left?
<< FIND THEM HERE! >>