Please wait - finding best movies...
Mia Thermopolis is the average teenager - sweet, a little geeky and pretty much invisible to everyone with the exception of her mother, best friend Lilly and Lilly's older brother Michael. Making it through high school without throwing up is a challenge in itself for Mia, so it doesn't come as welco …me news when her estranged grandmother shows up out of the blue and calmly informs her that she is in fact the heir to the throne of a European country called Genovia. Suddenly Mia's life is thrown into complete overload. She's being taught about scarves, waves and pears in order to become a perfect princess, she gets a makeover and a tough looking yet sweet bodyguard/limo driver called Joe. Things get out of hand when the media gets a hold of the story and suddenly Mia is thrust into the spotlight in both the newspapers and in school. On top of all that Mia has a choice to make. She must decide by Genovia's Independence Day Ball whether she longs to relinquish her claim on the throne or to become the princess and heir to the throne her father and grandmother want her to be. (Read More)
| Subgenre: | teen romanceteen moviefish out of water |
| Themes: | first loveunrequited lovedatingdeath of fatherdancedrunkennessfriendship |
| Mood: | high schoolrain |
| Locations: | school teacherbeach partycable carsan francisco californiapolice carhelicopterschoolbeach |
| Characters: | grandmother granddaughter relationshipmayorsingle motherbullybest friendwritermusicianpolice officerteacherfemale protagonistteenage boyteenage girlsingermother daughter relationshipteenager |
| Story: | school choirgym teacherschool principalchoir practiceteenage crushpizza deliveryhigh school teacherlimousine driverlocker roomtelevision writerrock musiciancamera shot of feetsecurity cameradance lessonfemale teacher …preparatory schoolprivate schoolschool uniformwalking with a book on one's headpublic access televisionfoot popping kisstransamerica pyramidawkward girlcharm braceletbook bagroyal ballbehavior modificationpearl earringodd neighbordancing lessonrose gardenneedlepointpole the structurekiss on cheekprincipal's officesashugly ducklingeyebrowscorndogfirehousepopular girlgarage bandconsulatepearmannersauto repaircinderella storypublic speakingfictional talk showtalking to an animaletiquettebeauticiandartsphoto boothclassic carsoftballcar mechanicmarionettefictional countrybrandyice cream coneturbanballroom dancingtrolleytennis courtpacific oceanenveloperock climbinggolden gate bridgekeyboardlocketarm wrestlingpuerto ricanfriendship between girlsbechdel test passedconductorford mustangauto mechanicscarfchewing gumawkwardnessgiving a toastpresskiss on the lipspaparazzipopularitygreenhouseprincipalharmonicascootersailingwhistlearcadesailboatmakeoverteenage lovelockerdinner partyfountaincandyhairdresserchauffeurviolinistgeekschoolgirl uniformtuxedosailorchoirfirst kissbutlersculpturegirl with glassescameoyogadebatetv showcrushmediaroyaltyhatballoonteen angstteapizzareference to william shakespearequeenclassloss of fatherdatecheerleaderbodyguardgymspeechdiaryumbrellafantasy sequencemicrophonelimousinecoffeeprincesspantyhosepainternunrock bandwomanbasketballjournalistsoccerreporteralcoholguitarclassroomrock musicsunglassespaintinglettercameracatcar accidentcell phonevoice over narrationbased on novelflashback (See All) |
Although cheerful, friendly, intelligent, well-dressed, authentic and wealthy, Charlie Bartlett has problems. With his father gone and his mother loopy and clueless, he's been expelled from every private school for his victimless crimes. Now he's in a public school getting punched out daily by the s …chool thug. He ever longs to be popular - the go-to guy - and the true crux of his troubles is that he invariably finds the means to this end, whatever that might be. At Western Summit High, he makes peace with his tormentor by going into business with him - listening to kids' problems and selling them prescription drugs. Charlie's a hit, but attraction to Susan (daughter of the school's laissez-faire principal), new security cameras on campus, a student's overdose, and Charlie's open world view all converge to get him in serious trouble. Can this self-made physician possibly heal himself and just be a kid? (Read More)
| Subgenre: | teen moviecoming of age |
| Themes: | datingdrunkennessfriendshipinfidelitydrugsmoneyadulteryprisondrinkingextramarital affairdivorcedepressiondrug usedysfunctional familyunfaithfulness …humiliationbullyingabductionalcoholismwealth (See All) |
| Mood: | high school |
| Locations: | police carschoolbarrestaurantswimming poolsmall townschool bussex in a carschool bus driver |
| Characters: | single motherbullywriterteacherteenage boyteenage girlsingermother daughter relationshipfather son relationshippolicemother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipstudent …policemandanceralcoholicpsychiatristtalking to oneself in a mirrorstudent protest (See All) |
| Story: | private schoolschool uniformpopularityprincipalteenage lovechauffeurfirst kissteen angstclassloss of fatherdatecheerleaderbodyguardfantasy sequencemicrophone …limousinerock bandbasketballguitarclassroomsunglassescell phonesexfemale nuditycharacter name in titlebloodbare chested malegunkisscigarette smokingdancingtitle spoken by charactersingingpartypistoltelephone callcryingsongbeatingunderwearmirrorpunched in the facecomputerdrinkarrestundressingbooktearscafemarijuanapianojailrevolvertelephonewinebandconcertmansiondrug dealermontagesuicide attempttoiletinternetman with glassesanti herounderwater scenevirgincoming outprotestfired from the jobauditionsplit screenhandgunclass differencesteenage sexgarageriotloss of virginityice creamjail cellvandalismdemonstrationamerican footballassaulttherapistfraudtennisskateboardcompassiondrug overdoserampageremote controlpillssurveillance cameraresearchbackstagepool tablefootball playermedicationdaydreamblack eyelonerclassmatebriefcasebrushing teethpajamaspiano playervideo tapeoverdoseconfessionalplaywrightpeer pressurebare chested boymegaphonelollipoppsychiatryfootball teamsexual repressionwatching a videorescue from drowningteen suicideloudspeakersuicidal thoughtsvillain turns gooddriver's licensefrench accentbritish accenthigh school principalsocial outcastpetitionfake idsedativepenitentiarytoilet stallfalling into a swimming poolanti depressantdestruction of propertystreakingtoilet bowlgiving the fingerschool expulsionmentally challenged personprescription drugsfake doctortax evasionboys' bathroomsexual confusionprozacchauffeured limousineattention deficit disorderhead in toiletkid outsmarts adultrailroad tracksritalintoy boatgarage doorxanaxdrive in movie theatrepsychiatric institutionbackseatmodel boatzoloftschool blazerdestructivenessfight in men's roomnicotine gumpassing notehigh school playrave the partysocial acceptanceschool superintendentchuck taylor gym shoesfake psychiatristmisdiagnosis (See All) |
Cher, a high school student in Beverly Hills, must survive the ups and downs of adolescent life. Her external demeanor at first seems superficial, but rather it hides her wit, charm, and intelligence which help her to deal with relationships, friends, family, school, and the all-important teenage so …cial life. (Read More)
| Subgenre: | teen romanceteen moviecoming of ageteen comedycomedy of mannerscoming of age film |
| Themes: | dysfunctional familyfashion |
| Mood: | high schoolsatireaffection |
| Locations: | school teacherschoollos angeles california |
| Characters: | teacherfemale protagonistteenage boyteenage girlteenagerlawyerteacher student relationshipdaughtergay teenagersingle fatherstepbrother stepsister relationshipnew student |
| Period: | 1990s |
| Story: | gym teachercamera shot of feetpopular girlfriendship between girlspopularitymakeoverlockerdebateteen angstreference to william shakespeareclassroomcell phonebased on novelf ratedone word title …title spoken by characterpartysurprise endingtitle directed by femaleblondeno opening creditsdrawingvirginmini skirthigh school studentschoolgirlloss of motherfalling down stairsjeeptennisshopping mallskateboardingshaved headhappy endingtriple f ratedbongfemale friendshipteenage daughtermugginghigh school girlreference to shakespeare's hamletopposites attractfootsienarrativeplaying footsieskateboarderbeverly hills californiageneration xcliquematchmakershakespearean quotationwardrobebracesmodern day adaptationrich girlhigh school boyblonde stereotypereference to oscar wildereference to barbra streisandreference to mel gibsoncellular phonereference to jane austendriving testgirl wearing a miniskirtwoman wearing a miniskirtnietzschevalley girlreference to claude monetreference to billie holidayends with weddingsocial consciousnesscartoon on televisionreport cardlove poemknee high socksreference to the rat packdumb blondereference to tony curtisreference to pippi longstockingolder person playing teen (See All) |
Down and out rock star Dewey Finn gets fired from his band, and he faces a mountain of debts and depression. He takes a job as a 4th grade substitute teacher at an uptight private school where his attitude and hijinx have a powerful effect on his students. He also meets Zack, a 10-year-old guitar pr …odigy, who could help Dewey win a "battle of the bands" competition, which would solve his financial problems and put him back in the spotlight. (Read More)
| Subgenre: | cult film |
| Themes: | drunkennessfriendshipdrinkingdeceptionangerillnesseducationdyingfashion |
| Mood: | high school |
| Locations: | school teacherschoolbarsnowsmall townlos angeles californianightclubschool bus |
| Characters: | best friendmusicianteachersingerfamily relationshipspolicefriendboygirlstudentalcoholicteacher student relationship |
| Period: | 2000s |
| Story: | school principalrock musicianpreparatory schoolprivate schoolschool uniformkeyboardclasscheerleaderrock bandguitarclassroomrock musictitle spoken by charactersingingtelephone call …songfoodurinationcomputerdrinksecretliepianobandnew yorkmontagedinertoiletapologychildroommatevanfired from the jobliarscene during end creditspianistcontestrock 'n' rolldarkschoolgirlterminal illnesseyeglassesrockfarcewoman with glassesscene during opening creditsguitaristrehearsalimpersonationrebellionembarrassmentrock concertbootsimpostordrummerdeceitslackerraised middle fingermusic bandsurprise after end creditsposterdrumsjoyvideo surveillancehangovertween girlidealismboy with glassesdrumschoolboysororitymtvelectric guitarblackboardcellomale protagonistdeskgroupiecommitmentmusic historydiarrhearock singermusical instrumentrock groupreference to led zeppelinlazinessclarinetweightfield tripsubstitute teacherroadiebass guitarknee socksband managerbattle of the bandsanti authoritysong lyricsrock clubmusic competitioncrowd surfingmusic clubbreaking the rulesbroken rulecymbalmosh pitreference to liza minnellirock guitarfaculty loungereference to stevie nicksreference to aretha franklinreference to puff daddyschool recesscode of conductfreeloading (See All) |
Teenager Andie is one of the not-so-popular girls in high school. She usually hangs out with her friends Iona or Duckie. Duckie has always had a crush on her, but now she has met a new guy at school, Blane. He's one of the rich and popular guys but can the two worlds meet?
| Subgenre: | teen romanceteen movieindependent filmcult filmcoming of ageteen comedy |
| Themes: | first loveunrequited lovedatingdancedrunkennessfriendshipdrinkingangerpovertydysfunctional familyfashionwealth |
| Mood: | high school |
| Locations: | school teacherschooltrainnightclubschool dance |
| Characters: | musicianteenage boyteenage girlsingerteenagerfather daughter relationshipboyfriend girlfriend relationshipstudentlustteacher student relationshipchinesesingle father |
| Period: | 1980s |
| Story: | teenage lovelockercrushteen angstgymmicrophonerock bandkissdancingphotographsingingthree word titlepantiescryingunderwear …fistfightblondewatching tvcomputertearsmarijuanacolor in titlecleavagebrawhite pantieslibraryargumentconvertiblehigh school studentclass differencesredheadrecord playergirl in pantieseyeglassesnerdtraditionanswering machinedresstitle based on songforbidden lovepet dogshoppingposterplaying cardscartoon on tvalarmbicyclingmaking outvolleyballlistening to radiogeneration gapteenage daughterpromaudio cassettehouse partysewing machinedesignerhigh school girlopposites attracthomeworkreference to madonnasuitorrecord storemusic storedance contestsnobphonograph recorddevotionreference to karl marxhigh school danceslumber partyyearbookhigh school boynylonsrich snobwashroomteenage romancehalljuvenilehigh school promteen lovereference to franklin d. rooseveltunderageparty dressbrat packwrong side of the tracksrich man poor womanshy girlschool yearbookrailroad tracksreference to david lettermanmusic albumhigh school sweetheartsprom dressbreasts growingsocial consciousnessreference to tina turnertwo suitorspreppiesingle dadreference to lionel richieshermer illinois (See All) |
Rose Hathaway is a dhampir, half-vampire and half-human, who is training to be a guardian at St Vladimir's Academy along with many others like her. There are good and bad vampires in their world: Moroi, who co-exist peacefully among the humans and only take blood from donors, and also possess the ab …ility to control one of the four elements - water, earth, fire or air; and Strigoi, blood-sucking, evil vampires who drink to kill. Rose and other dhampir guardians are trained to protect Moroi and kill Strigoi throughout their education. Along with her best friend, Princess Vasilisa Dragomir, a Moroi and the last of her line, with whom she has a nigh unbreakable bond, Rose must run away from St Vladimir's, in order to protect Lissa from those who wish to harm the princess and use her for their own means. (Read More)
| Subgenre: | teen romancemartial artscoming of ageblack comedyvampire comedy |
| Themes: | dancefriendshipmurderdeathloverevengesurrealismkidnappingbetrayalfeartorturedeceptionmagicsupernatural powerparanoia …redemptionsurveillancerivalry (See All) |
| Mood: | high schoolnightmarehalf vampire |
| Locations: | school teacherhelicopterschoolhospitalchurchmotorcyclecemeterybuswoodscavesuv |
| Characters: | bullybest friendteacherfemale protagonistteenage boyteenage girlteenagerfather daughter relationshipfriendboyfriend girlfriend relationshippriesttough guylove trianglevampirewarrior …villainteacher student relationshipolder man younger woman relationshipvampire girl (See All) |
| Period: | 2010s |
| Story: | school principalsecurity camerafemale teacherschool uniformgeekgirl with glassesqueenbodyguardgymprincesspantyhoseclassroomcatcar accidentvoice over narration …based on novelflashbackbloodviolencetwo word titlekissfightphotographtitle spoken by characterpartyknifesurprise endingpistoldreamshot to deathfistfightshot in the chestrescueslow motion scenearrestkissingbrawlhand to hand combatcar crashinterrogationhandcuffsgood versus evilstrangulationmountainmansionmontagestabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequencedouble crosscreatureroommatefemme fatalenecklacetransformationon the runtraininglibrarycharacter repeating someone else's dialoguedangerstabbed in the backperson on firecover uptough girldeath of brotherbasementlaptopneck breakingpowerstylized violencerunawaysisterundergroundsabotagesyringewolfloyaltyhypodermic needlejail cellmind controlaction heroinefemale warriorbackpackstabbed in the throatshopping mallescape attemptmentorlaughterwisecrack humoryoung loveprison cellcrowpractical jokespelldead animaltwist endingblack pantyhosefemale friendship17 year oldstabbed in the armfemale vampirebitten in the neckmonitorguardianoregonpsychic poweropen endedcurecelldead cattwistlesbian subtextvampirismblack dressmind readingpet catanti heroineglowing eyesmontanastrengthmagical girlmagical powerblood drinkingwriting in bloodacademyjudo throwhigh fivestakeblood transfusionrepressed memoryhidden doornunchucksexploding motorcycledeath of petstained glass windowbased on young adult novelsedativeheadmistressvampire bitecomputer discadrenalinetightspyrokinesishealing powerreference to jimmy carterrunaway teenfemale narratorhalf humanvampire versus vampirechild vampirepsychic linkwrist bandageblack tightspsychic visionroyalwriting on walltattoo on neckvampire teethlicking bloodstake through the heartvampire stakedcamera footagedrinking fountainanimal on fireteenage vampiredhampirneck bitepsychic girl (See All) |
Chicago Sun Times copy editor Josie Gellar (25), who was desperate to graduate from perfectionist copy editor to reporter, gets her chance when the goody owner orders the editor to cover the high-school scene by undercover. Josie, who was a frustrated, ridiculed nerd, gets a popular make-over from h …er drop-out, naturally funny brother Rob Geller. Both siblings find love and joys of youth again. But in Josie's case, it's sensitive bachelor teacher Sam Coulson, who enjoys sophisticated conversation. As the publication deadline approaches, the price of blowing their cover seems ever more daunting, yet inevitable unless she sacrifices her career. (Read More)
| Subgenre: | teen romanceteen movieteen comedy |
| Themes: | first lovefriendshiphumiliationcruelty |
| Mood: | high schoolaffection |
| Locations: | schoolcarchicago illinoisold car |
| Characters: | teacherfemale protagonistteenage boyteenage girlboyfriend girlfriend relationshipboybrother sister relationshipgirlstudentteacher student relationship |
| Period: | 1980s1990s |
| Story: | high school teacherpopular girlpopularitycrushteen angstjournalistreporterclassroomflashbackbare chested malekisspartythree word titleswordnewspaper …undercoverprankhigh school studentcoachnerdathleteeggjournalismembarrassmentsurveillance camerapublic humiliationbriefsteachingcafeteriadouble lifeeditorbaseball playersex educationnewspaper articlebaseball gamepromchick flickhigh school girlbaseball fieldschool lifebaseball stadiumcliqueentrapmentgymnastbraceshigh school boysombrerohigh school promshakespeare in modern dressnewspaper storypygmalionundercover missionsurveillance deviceundercover reporterundercover journalistnorthwestern universitypopular teacherassistant coachsenior prom (See All) |
A musical about teens in love in the 50's! It's California 1959 and greaser Danny Zuko and Australian Sandy Olsson are in love. They spend time at the beach, and when they go back to school, what neither of them knows is that they both now attend Rydell High. Danny's the leader of the T-Birds, a gro …up of black leather jacket-wearing greasers while Sandy hangs with the Pink Ladies, a group of pink-wearing girls led by Rizzo. When they clash at Rydell's first pep rally, Danny isn't the same Danny from the beach. They try to be like each other so they can be together. (Read More)
| Subgenre: | teen romanceteen moviecult filmcoming of age |
| Themes: | first lovedancefriendshipjealousywrestling |
| Mood: | high school |
| Locations: | schoolbeachlos angeles californiabaseballschool dance |
| Characters: | female protagonistteenage boyteenage girlteenagerboyfriend girlfriend relationshipaustralian |
| Period: | 1950ssummer |
| Story: | school principalauto repairmakeoverlockerteen angstcheerleaderfantasy sequencebasketballrock musiccar accidentone word titlecigarette smokingblondecondomrunning …dinerringconvertiblewigpremarital sexcoachloss of virginitylifting someone into the airamerican footballblockbustergossipcarnivalunderage drinkingnostalgiarivalyoung lovereference to elvis presleygraduationstreet gangcigaretteferris wheelmooningunderage smokingopposites attractanimated creditsdance contestcigarette holderflying cartv show in filmautomobile racingslumber partyexchange studentdrag racingbased on stage musicalnostalgicstudent athletefamous songlive televisionyearbookblack leather jacketpie in the facedrive in theatersmoking a cigaretteyear 1959wrong side of the trackshickeywolf whistlelast day of schoolbleacherspregnancy scareear piercinggreaserfunhouselos angeles storm drainsummer romancepep rallyhair colorspandex disco jeansscanimatereference to rosemary clooney (See All) |
After a little white lie about losing her virginity gets out, a clean cut high school girl sees her life paralleling Hester Prynne's in "The Scarlet Letter," which she is currently studying in school - until she decides to use the rumor mill to advance her social and financial standing.
| Subgenre: | teen movieteen comedyteen sex comedy |
| Themes: | datingfriendshipmarriageinfidelityreligionadulterydrinkingextramarital affairdivorceguiltunfaithfulnesshomophobiaadoptiondevilreligious intolerance |
| Mood: | high schoolsatire |
| Locations: | schoolrestaurantchurchswimming poolkitchensinging in the shower |
| Characters: | best friendteacherfemale protagonistteenage boyteenage girlsingermother daughter relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipfather daughter relationshipfriend …boyfriend girlfriend relationshipboybrother sister relationshipprostitutegirlstudentpriestchristianreference to godchristianityteacher student relationshipbiblecatholicolder man younger woman relationshipgay teenagerolder woman younger man relationshipgay friendreligious fanaticreligious teen (See All) |
| Period: | 2010s |
| Story: | school principallocker roomprincipal's officeice cream conefriendship between girlspopularityprincipalclasscheerleadergymmicrophonebasketballguitarclassroomsunglasses …cell phonefemale nuditydogtwo word titlebare chested malesex scenekissphotographsingingpartypantiesshowertelephone callcryingsongmirrorface slapslow motion scenewatching tvdrinkcondomliebeertearsvibratorbirthdaycafemarijuanareference to jesus christprayerstrippercleavagegay slurbedroomcaliforniadinnerfalse accusationscantily clad femalespankingtalking to the cameraconfessionvirginprotestliarmini skirtmoaningamerican flaghigh school studentcrossgardengraffitifreeze framemachismoscandalcloseted homosexualwaiterhuggingpot smokingloss of virginityfaintinghappinessdemonstrationgossipfloridaone night standvirginitypreacherembarrassmentmovie theatrebloody noserap musiccynicismhypocrisyministerpunched in the stomachaquariumtime lapse photographyhit on the headpanties pulled downbookstorebelief in godcliffred pantiesclassmatelooking at self in mirrorpastorbigotrypromiscuityfast motion scenesouthern accentoutcastreference to facebooksneakerswoman cryingcafeterianame callingconfessionallegsrumorpeer pressurefascistacceptanceadopted soncdman in swimsuitguitar playertolerancevolkswagenchick flickreference to googleweekendallergytextingsewingborn again christiandetentionunwanted kissinterracial adoptioncloseted gayinner title cardgay pridemotor scootercheerleader uniformvolkswagen beetleimplied nuditypreachingreputationhappy birthdayenglish teachermascotcliquejumping on a beddevil costumegeneration yreference to marlon brandoteen drinkingpetitiongazebospin the bottleabstinencereference to tom cruiseinfamyguidance counselorwebcastbelief in the afterlifespellingwater slidewatching a movie on tvinnuendoreference to mark twaingay man straight woman relationshipbelief in hellpunched in the gut22 year oldsleazecommunity collegevespastdreference to disneylandadoptive father adopted son relationshippicture framemopping a floorpuritangreeting cardcomedic sex sceneenglish classnotorietyschool suspensionanagramgirls' bathroompledgereference to huckleberry finnpietyschool bandcouponorange the fruitschool boardchocolate milkmascot costumepep rallybelief in the deviladoptive mother adopted son relationshipcontact lensessatan worshipbumping into someonestudent councilbad reputationprayer groupreference to alfred kinseycarpoolstate flagthrowing a cell phonebirth control pillreference to home depothand signaljesus freakporno theatrereference to ashton kutcherreference to costcoreference to demi mooreearth dayreference to disney worldhigh school gymnasiumreference to john hughesschool mascotchlamydiafake sexkissing gamepeasrumor mongerschool detentionsharpening a penciltowel snappingcleaning a bathroomcommunity gardenreference to google earthreference to sylvia plathreference to the scarlet letterspreading rumorbreaking a picture framegift cardreference to nathaniel hawthorne (See All) |
Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr …overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)
| Subgenre: | teen moviecoming of ageperiod film |
| Themes: | first loveunrequited lovedatingdancefriendshipsuicidedrugschristmasjealousydrinkingfearincestmemoryseductionloneliness …depressiondrug usecancerguiltmental illnesspoetryabusebullyinghomophobiabreak updyingwritingcheatingdying from cancerdeath of best friendsuicide of friend (See All) |
| Mood: | high school |
| Locations: | hospitalrestaurantchurchsnowtrucktunnelcatholic churchpennsylvaniaschool dancekitchen knife |
| Characters: | bullybest friendwriterteacherteenage boyteenage girlsingerteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfriend …boyfriend girlfriend relationshipdoctorbrother brother relationshipboybrother sister relationshipgirlpolicemandancerphotographerpriestreference to godgay kisslittle boyteacher student relationshippsychiatristcatholicgay teenagergay relationshipaunt nephew relationshipcatholic priestboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All) |
| Period: | 1990syear 1991 |
| Story: | school principalteenage crushprincipal's officegiving a toastkiss on the lipsharmonicateenage lovefirst kisscrushreference to william shakespeareclasscheerleaderclassroomlettercamera …car accidentvoice over narrationbased on novelflashbackkissfightdancingphotographsingingpartyknifetelephone callcryingbeatingfoodmirrorface slapslow motion scenepunched in the facewatching tvwritten by directordrinkcondomsecretshootingbooktearsrunningbirthdaycafemarijuanabathroomcollegehallucinationreference to jesus christprayertelephonef wordsubjective cameragay slurbedroomwinecandledeath of friendeatingfootballsuicide attemptdinnerchild abusedrivingapologyracial slurpainflash forwardlibraryvirginreadingchristmas treecollege studentprankhigh school studentglassesrock 'n' rollsadnesssix word titletypewritertrustteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualhuggingfireplacelooking at oneself in a mirrorlistening to musicsexual abuseice creamred dresshappinessamerican footballmovie theaterimpersonationnew year's evevirginityclockpromisebuddhistmovie theatrenicknameinnocencepillssufferingmobile phonebackstagepunched in the stomachsexismkaraoketaking a picturemental hospitalfootball playertheatre audiencechristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingothgraduation12 year oldshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingfirst dateadolescencechild molestationblackoutlooking out a windowponytaillsd16 year old15 year oldstonedunhappinessveganhazingtutoreasterpromaudio cassettehouse partylip synchingcar radiodance scene11 year oldwriting a letterabusive boyfriendwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausaspiring writerenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actreference to frank sinatracrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school dancehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glasseslast day of schoolenglish classfacial injuryacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailmix tapewriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All) |
At John Hughes High School, the students are the same as just about every other teenager in a teen movie. The popular jock, Jake, takes a bet from Austin, the cocky blonde guy, that he can transform Janey, the pretty ugly girl, into the prom queen before the prom. But two people are trying to stop J …ake from succeeding: his evil sister, Catherine, the cruelest girl in school, and Priscilla, the bitchy cheerleader. And all of their friends are the same as any other teen movie: Areola, the naked foreign exchange student, Les, the beautiful weirdo, Malik, the token black guy, the desperate virgins, Amanda Becker, the perfect girl, Ricky, Janey's obsessed best friend, and Sadie, the VERY old undercover reporter. (Read More)
| Subgenre: | teen movieslapstick comedyteen sex comedy |
| Themes: | unrequited loveincestrivalry |
| Mood: | high schoolspoofparodybreaking the fourth wall |
| Locations: | schoolswimming poolairportsex in public |
| Characters: | teenage boyteenage girlteenagerfamily relationshipsfather daughter relationshipbrother sister relationshippriestlustteacher student relationshipsingle fatherart student |
| Story: | locker roomawkward girlpopular girlcinderella storypopularitymakeoverschoolgirl uniformgirl with glassesteen angstqueencheerleaderjournalistreporterclassroomflashback …sexfemale nuditynuditymale nuditybare breastsfemale frontal nuditymasturbationfemale rear nuditynipplespartylesbian kisspantiestopless female nudityslow motion scenebare buttfalling from heightbookvibratorrunningbirthdayvoyeurcleavagetoplessscantily clad femaletransformationtalking to the cameraracial slurpublic nuditymoaningfemale full rear nudityglassesschoolgirlfreeze framedestinydesiresexual attractionamerican footballbisexual girlbuttocksflatulencepart animationblack humorembarrassmentwatching televisionstupidityhit in the crotchsex talknipplefootball playerscene after end creditshit on the headmusical numbersexual humorbetred pantiescrude humorlingerie slipexhibitionismsurprise after end creditsirreverencetorso cut in halfpervertvietnam veteranstereotypepink pantiesblue pantiessexual perversionlegsrear nuditycameo appearancemisfitexhibitionistnude girlflight attendanttopless girlprombreastscatological humorred bradetentionclumsinessincestuous desiresexual obsessiondiarrheaschool lifecheerleader uniformpillow fightidiottoilet humorexcrementgross out humorwoman moaning from pleasurewoman moaningmoaning womanstun gunsex with foodbutt nakednaked buttwoman's bare buttwoman in uniformexchange studentgirl toplesshit by a busbad smellsiamese twinsincestuous kissscatologywoman wearing glassesblue brapurple branaked outdoorsdolly zoomconjoined twinsgross outforeign exchange studentgreen pantiesprom nighthuman excrementcovered in fecesgirl wearing glasseswalking around nudeslow clapundercover journalistwallflowergreen brayellow braeeny meeny miny moeexcrement on facefeces on faceflight attendant uniformstereotypesthrowing pantiesexplosive diarrhea (See All) |
High school student Ferris Bueller wants a day off from school and he's developed an incredibly sophisticated plan to pull it off. He talks his friend Cameron into taking his father's prized Ferrari and with his girlfriend Sloane head into Chicago for the day. While they are taking in what the city …has to offer school principal Ed Rooney is convinced that Ferris is, not for the first time, playing hooky for the day and is hell bent to catch him out. Ferris has anticipated that, much to Rooney's chagrin. (Read More)
| Subgenre: | teen moviecult filmcoming of ageteen comedy |
| Themes: | friendshiphome invasion |
| Mood: | high schoolbreaking the fourth wallaffection |
| Locations: | schoolrestaurantswimming poolcarpolice stationofficechicago illinoismuseumschool bussinging in shower |
| Characters: | best friendpolice officerteenage boyteenage girlteenagerpolicefriendboyfriend girlfriend relationshipbrother sister relationshipstudentteacher student relationshipsecretary |
| Period: | 1980s |
| Story: | school principalhigh school teacherfoot popping kissprincipal's officepopularityprincipalcameoteen angstclassroompaintingcharacter name in titledogkissdancingshower …telephone callslow motion scenecomputerbedapostrophe in titlebathroomtelephonebedroomdrug dealerhouseanti herolooking at the cameratalking to the camerakicked in the facescene during end creditsconvertiblehigh school studentgarageanswering machinestreetimpersonationrebelrebellionparking garageart galleryblack humorparadehomescene after end creditssibling rivalryone dayclassmatelaughingsports carneighborhoodsurprise after end creditsirreverencemudjoycar drivingschemewalletadvicecameo appearancecoughinggeneration gapmarching bandhallwaybackyardhigh school girldeskferraridog attackspringsmilingswimming in underwearhigh school seniorreference to john lennonhigh school principalhypochondriacteenage angstthe beatles songdowntownclarinetsynthesizerhigh school boyskipping schoolteenage rebelliondiving boardcomputer screentalking to the audiencecatatoniafake illnessanti authoritycar damagetruancyfaking illnesschicago cubsjersey the garmentjoyridemusical sequence in non musical workreference to dirty harryon screen narrationnarrated by title charactertruantpretending to be sickstudent principal relationshipwrigley fieldday offfake nursegummi bearshermer illinoiscalling someone a heroexpensive carthriller dancevoice sampling (See All) |
Princess Mia has just turned 21 and is supposed to succeed her grandmother as the Queen of Genovia. But Viscount Mabrey who wishes that his nephew who is also in line to the throne to be the new ruler, reminds everyone of a law that states that an unmarried woman can't be made queen, and with the ba …cking of parliament, he opposes Mia's coronation. But Queen Clarice asks that Mia be allowed time to find a husband, and she is given 30 days. But Mabrey tries to do what he can to stop that. But his nephew, Nicholas has met Mia and they are both attracted to each other but Mia upon learning who he is, dislikes and doesn't trust him but Clarice has invited him to stay with them for the 30 day period to keep an eye on him. (Read More)
| Subgenre: | fish out of water |
| Themes: | friendshiploveweddinglooking for love |
| Mood: |
| Characters: | grandmother granddaughter relationshipfemale protagonistteenage girlfamily relationshipsuncle nephew relationshipamerican abroadfiance fiancee relationship |
| Story: | royal ballcinderella storyetiquetteclassic carfictional countryballroom dancingford mustangkiss on the lipsroyaltyreference to william shakespearequeenprincesswomancatbased on novel …sequeldancinghorsesecond partnumbered sequelorphanconvertiblefeminismsix word titlechickenbow and arrowlaworphanageparadetarget practicearranged marriagecharitykaraokeballkingdomhorseback ridinghappy endingtelling someone to shut uparcheryfalling into waterenglishmanreference to shakespeare's hamletclumsinesspet catcanceled weddingparliamentflaming arrowdukecoronationslumber partycharacter appears on tvinterrupted weddingnational anthemroyal wedding21 year oldwedding dayindependence dayslow dancingslidewooden legheir to the thronereference to the three stoogesbridal showerroyal palacetwo suitorsthrone roomroyal engagementhead of security21st birthdayhanbokviscountwoman proposes marriagereference to prince williamrubber snakewoman's birthdayhand fanophidiophobiapenny farthing bicycleplaying badmintonside saddle (See All) |
The sisters come back to Deloris's show to get her back as Sister Mary Clarence to teach music to a group of students in their parochial school which is doomed for closure. One of the girls, who is the most talented of the bunch, is forbidden to sing by her mother, although the choir has made it to …the state championship. A group of stereotypical incompetent monks tries to stop them. (Read More)
| Themes: | religionpovertyhollywood |
| Mood: | high schoolhip hop |
| Locations: | san francisco californiaschoolchurchschool buscatholic school |
| Characters: | female protagonistteenage boyteenage girlsingermother daughter relationshipteenagerafrican americanpriestteacher student relationship |
| Period: | 1990s |
| Story: | school choirchoir practicefemale teacherhairdresserchoirnunwomanclassroomletternumber in titlesequelsingingdigit in titlesecond partnumbered sequel …pianocolon in titlescene during end creditsprankstageclass differencessingle parentapplauseeavesdroppingrapfemale singermonkambitionseven word titlerejectionthrown through a windowghettogrowing uptrophyunderdogteachingtelling someone to shut upconventhugurban decaymisfitteenage daughterreading a booksausagemusic teacherfinancial crisismother superiornumber 2 in titlegentrificationreference to oprah winfreybouquet of flowersmother daughter conflictteenage angstrappingsinging conteststanding ovationlounge singerold people's homenun's habitfund raisinglistening to music on headphonesmother daughter hugbaseball cap worn backwardssinging competitionreference to las vegas nevadateen bedroombouquet of rosesmusic classreference to diana rossduologypewcontest winnerstrict motherfemale female hugnote read aloudunruly childrenswivel chairsinging nunsony walkmandancing nundisobeyfingernails on chalkboardcharitable donationreference to sally fieldchoir rehearsalproud motherproud parentreference to chaka khanstrict parent (See All) |
When her wealthy fiance breaks it off, gold digger Elizabeth Halsey returns to middle school: she's an awful teacher but wants to save for breast-implant surgery. She brightens when Scott, a new teacher, turns out to be rich, and she stops showing films and sleeping in class when told there's a bonu …s for the teacher whose class scores highest on the state exam. Her competition for Scott and the bonus is cheery and tightly wound Amy. Amy digs for dirt on Elizabeth who cheats her way toward Scott's bed and the money. Honesty with students seems to be her only skill. She ignores Russell, a droll gym teacher, who looks on. Will she succeed with Scott and get those new breasts? (Read More)
| Subgenre: | black comedyabsurdism |
| Themes: | unrequited lovedrunkennessrevengeinfidelitydrugschristmasmoneyjealousydrinkingdeceptionvoyeurismseductioncorruptiontheftblackmail …poetryrivalrybreak upcheating (See All) |
| Locations: | school teacherpolice carschoolbarrestaurantcarsnowmotorcyclebusapartmentchicago illinoismuseumsinging in a carschool bussinging on a bus …singing on busrussian in usa (See All) |
| Characters: | teacherfemale protagonistteenage boyteenage girlteenagerpolicefriendboyfriend girlfriend relationshipdoctorpolicemanlove trianglealcoholicprofessorfiance fiancee relationshipcolleague colleague relationship …crying girllow self esteempolice dogrussian abroadnew teacher (See All) |
| Period: | christmas partysinging christmas carol |
| Story: | gym teacherschool principalfemale teacherbechdel test passedclassgymspeechcoffeewomanbasketballguitarclassroomsunglassescar accidentcell phone …female nudityf ratednuditymale nuditybare breastsfemale frontal nuditymale rear nuditydogtwo word titlesex scenecigarette smokingejaculationphotographpartyknifesurprise endingerectiontopless female nuditycryingblondeslow motion scenewatching tvdrinkarrestbirthdaycar crashmarijuanapianohandcuffsvoyeurf wordcleavagebrabandconcertdisguisemontagefalse accusationman with glassesscantily clad femaleroommatefemme fataleracial slurflash forwarddrug addictcostumeliarmini skirtchampagnechristmas treemanipulationwigsuspicionprofanitypoetkissing while having sextopless womanbirthday cakepoempot smokingsabotagefarcewoman with glassesscene during opening creditsmagazinefraudeccentricbarefoot maleambitionapplejanitorintrigueironyballbribeblack braframe upchristmas eveabsent fatherrivalturtlesexual humorbarefoot femaleethnic slursurgeonlyingarrogancereference to barack obamadrugged drinkmarijuana jointbriberynew jobporn magazineteachingbongshortscar drivingdefecationcafeteriaglovesnudesarcasmdrunken manfriendship between womenhangovercamera shot of bare feetvulgarityguitar playingstonerelementary schooldomineering motherrumormasturbation referenceplaying guitarcar washenvydolphinnude girlnarcissismblackboardcookieexamhallwaycactuscrying femaleillinoissitting on a toiletawkward situationcheating boyfriendmanipulative behaviorreference to abraham lincolnfully clothed sexseductive behaviorinformerwet clotheslack of moneytalking while drivingheadmasterfeet on tablefast food restaurantwrongful arrestswindlesmoking potseductive womangold diggerfemale antagonistdrinking from a bottleswindlerdrinking from bottleselfish womanfired from a joblearning the truthpretending to be someone elsemanipulative personmercedespsychological manipulationfalse nameplastic surgeonmanipulative womanbasketball courtlazinessantiherochristmas dinneregoismmisanthropebustunfaithful boyfriendclassmate classmate relationshiptortoisetaking off shoescounting moneysubstitute teacherworkplace romanceflatmateplanting evidenceauditoriumlittle black dressreference to snow whiteroommate roommate relationshipspeeding vehicleegocentrismemotional blackmailmoney countingfake namebonuscar washingcheaterdodgeballdrunk manschool janitorschool tripcompulsive liardriving in reverseemployee dismissalprofessional rivalryemployee employee relationshipeating an applebreast enlargementcheating on a testdry humpingband membersinging alongtaking off bratrickeryerection visible through clothingreference to the three stoogeswomanchildacneegocentric womannarcissistic personality disordercompromising photographwashing carcoors lightobscene hand gesturereference to morgan freemanreference to tom sawyerconfidantfitness centerpoison applewearing a wigcompromising picturepoison ivyreference to michelle pfeifferdumped by boyfriendegocentricopening champagnesexy teacherboob jobbreast surgeryflatmate flatmate relationshipsuperintendentvulgar womanarrogant womandaisy dukeshit with a ballreference to pamela andersonspringfield illinoisfoul mouthsperm stainbreast examoxycontinreference to lionel richiesemen stainmanipulatorschool inspectorspreading a rumorteacher as protagonistbad teacherhistrionic personality disorderenvious womanface ticklazy woman (See All) |
Daphne, a seventeen-year-old girl from New York goes to England in search of her father, who does not know he had a child with an American girlfriend he met while working in Morocco, and whose aristocratic family did not approve of the woman.
| Subgenre: | teen romanceteen moviefish out of watercomedy of manners |
| Themes: | weddingfashion |
| Mood: | affection |
| Locations: | motorcycledesertlondon englandenglandtwo on a motorcycle |
| Characters: | musicianfemale protagonistteenage boyteenage girlsingermother daughter relationshipteenagerfather daughter relationshipboyfriend girlfriend relationshipdaughterfatheramericanamerican abroadamerican in the uk |
| Period: | 2000s |
| Story: | cinderella storypaparazziroyaltyteen angstclassrock bandwomanguitarpaintingcell phonef rateddancingtitle directed by femalemirrorremake …birthdaybritishnew yorkmansionfour word titlepoliticianscandaltitle based on songfemale singerculture clashteenage protagonisttarget practicereconciliationmisunderstandingshoppingrowboatengagementswingcamelhit in the facemarkettelling someone to shut upelection campaignbillboardfalling into watermoroccochandelierfashion showtour guideestrangementtwin sisterchinatownclumsinesstrespassinghigh societyreference to madonnaparliamentcereallordbig ben londonstepsisteropening narrationdouble decker bustv broadcastgalatiaraleather pantsgarden partymember of parliamentreference to cinderellaice sculptureclass systemmedia circusskeet shootingair guitarfalling chandelierregattatripping overwedding bandvolkswagen vanfalling off a stage (See All) |
In North Carolina especially in Beaufort a prank on a guy goes wrong and puts the student in the clinic. Carter, a famous student with no plans for the future, is held responsible and forced to join in after-school community service activities as consequence, which include starring as the lead in th …e play. And participating in these activities is Jamie Sullivan, the reverend's daughter who has great ambitions and nothing in common with Landon. When Landon decides he wants to take his activities seriously, he asks Jamie for help and begins to spend most of his time with her. But he starts to like her, that he did not expect to do. They relationship, much to the chagrin of Landon's old popular friends and Jamie's strict reverend father. But when a heart-breaking secret becomes known that puts their relationship to the test, it is then that Landon and Jamie realize the true meaning of love and fate. (Read More)
| Subgenre: | teen romanceteen moviecult filmcoming of agetragedymelodramahigh school dramateen drama |
| Themes: | first lovedatingfriendshiprevengemarriagejealousyescapeweddingdeceptioncancerredemptionfaithnear death experience |
| Mood: | high schoolcar chasetearjerkerbittersweet |
| Locations: | police carschoolhospitalrestaurantchurchcemeterysmall townwheelchairschool bus |
| Characters: | single motherbullybest friendpolice officerteenage boyteenage girlteenagerfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctortattoonursestudent …priestchristianchristianitysecurity guarddirectorbibleex husband ex wife relationshipex boyfriend ex girlfriend relationshippolice chasesingle fatherself confidence (See All) |
| Period: | 2000s |
| Story: | high school teacherdance lessonteenage lovechoirfirst kissteen angstdatebasketballcar accidentvoice over narrationbased on novelkissdancingsingingurination …rescueslow motion scenepunched in the facebookcar crashpianoflashlightambulancemontagefour word titledrivingmarriage proposallibrarycharacter repeating someone else's dialoguewidowerprankhigh school studentcharacter says i love yousingle parentterminal illnessrevelationwhat happened to epiloguefaintingscene during opening creditsmale bondingrebeljumping from heightforbidden loveinterracial friendshippreacherambitiontelescopeministerunderage drinkingmiraclelove at first sightbutterflybalconyswinglonerpassionate kissjuvenile delinquentdead mothersports carpractical jokewedding ceremonyoutcastparalysiscafeteriacrutchesbully comeuppanceoutsiderpeer pressurestage playteenage daughterleukemiatutorreverendjocknorth carolinastar crossed loverswet t shirtchick flickchapelhigh school girlfather son estrangementcar radioopposites attractfather son reunionscriptschool playcometchurch servicegospelsweatercliquedockscrutchhigh school principalreference to aristotlestar gazingyearbookhigh school boyacting musicianteenage rebellioncommunity serviceevangelical christianityinitiation riteaccident victimprank gone wronglife changingintimateteen rebelgospel choirmobbinghigh school sweetheartsbad boyends with weddingsweetheartwet pantsdrama clubamerican muscle (See All) |
William Miller is a 15-year-old kid hired by Rolling Stone magazine to tour with and write about Stillwater, an up and coming rock band. This wonderfully witty coming-of-age film follows William as he falls face first to confront life, love, and lingo.
| Subgenre: | teen moviecoming of agesemi autobiographicalcoming of age film |
| Themes: | death of fatherdancedrunkennessfriendshipinfidelitydrugsmoneybetrayaladulterydrinkingtravelangerdrug useguiltunfaithfulness …humiliationpoetrycheating (See All) |
| Mood: | high school |
| Locations: | san francisco californianew york citybarswimming poolhotelcarairplanelos angeles californiabuselevatorroad trip |
| Characters: | musicianteacherteenage boyteenage girlsingermother daughter relationshipteenagerfamily relationshipshomosexualmother son relationshipfriendboyfriend girlfriend relationshipboybrother sister relationshiplove triangle …older man younger woman relationshipolder man younger man relationshipalcoholic drinkboy in underwear (See All) |
| Period: | 1970s |
| Story: | teenage crushrock musiciankiss on the lipsloss of fathermicrophonerock bandjournalistalcoholguitarrock musiccamerasexfemale nudityfemale frontal nudityinterview …bare chested malekisscigarette smokingdancingphotographsingingpartylesbian kisspantiesbased on true storytelephone callcryingsongunderwearfistfightfoodurinationblondewatching tvdrinkundressingsecretbookvomitingbeerrunningbirthdaymarijuanabathroomvoyeurtelephonef wordswimmingcleavagebandconcertcaliforniaeatingsuicide attemptwhite pantiesscantily clad femaleconfessionlegendhotel roomvirginprologuecoming outelectrocutionpay phoneon the roadreadinglightningfemale removes her clothesrock 'n' rollpremarital sexstagecharacter says i love youpoetobscene finger gesturecheating wifesingle parentrecord playerbirthday cakepot smokingloss of virginitylistening to musicfamesexual attractionrecordingguitaristoverallsmagazineeccentricjournalismcheating husbandvirginityrock starembarrassmentambitiondrug overdosebarefootrock concertpillsreconciliationboston massachusettstitle appears in writingdrummerthunderstormraised middle fingerred pantiesgrowing uptourbriefspromiscuityparking lotmale virgint shirtdrumsgraduationstage performancebongbandageadolescencepiano playingacidreference to the beatlesguitar playingstewardessdomineering mothertape recordinglsdmusic industrywhistlingteenage sexualityguitar playerunderage sexromantic rivalrysan diego californiadrug humorironingteenage girl in underwearroadtripgroupietour buswet clothessmoking marijuanaegocleveland ohiorock singersexual pleasureleaving homefalling off a rooffemale sitting on a toiletmusic businessaspiring writermusic concertmusic grouprock groupmusereference to led zeppelinreference to the rolling stonesphoenix arizonafalse nameillegal drugsreference to bob dylanfictional bandprogressive rockreference to david bowieinnocence lostbus tripegotismsurrogate familypill poppingvolkswagen bushallucinogenfollowing a dreamreference to elton johnteen sexualityjumping into a swimming pooltitle appears in textreference to pink floydclassic rock musicreference to jim morrisonteen drug useband memberreference to george orwellstudent mentor relationshipsunset stripcharacter appears on magazine coverreference to goetherecording artistclothes irondrumsticksjumping into a pool with clothes onreference to george orwell's 1984rolling stone magazinereference to the doorsbell bottomsdo not disturb signreference to iggy popreference to neil youngmanic pixie dream girlquaaludereference to lou reedpill bottlemusic journalismpill boxbackstage passdancing in one's underwearreference to alice cooperreference to the whoreference to black sabbathmending friendshipflying through a stormpill abusetopeka kansascharacter lies about agereference to deep purpletempe arizonareference to the allman brothers (See All) |
Samantha or "Sam", has a rough childhood with her father dying in an earthquake and a new stepmother with two awful stepdaughters. But on the bright side, Sam has an awesome best friend named Carter and an email relationship with a guy named Nomad. One day, Sam gets an email from her Nomad saying th …at he wants to meet her in the middle of the dance floor at their high school Halloween dance. She accepts the invitation and glides into the room wearing the best outfit ever! Her Nomad takes her outside where they share a romantic dance together and Sam realizes that her email friend is the most popular guy in school, Austin Ames. She runs back to her stepmother's diner before she knows she went to the dance and drops her phone on the way. Austin finds it and starts a search for his Cinderella. (Read More)
| Subgenre: | teen romanceteen moviefairy tale |
| Themes: | unrequited lovedeath of fatherdanceweddinghumiliation |
| Mood: | high school |
| Locations: | schoollos angeles california |
| Characters: | teacherfemale protagonistteenage girlfather daughter relationship |
| Story: | awkward girlpopular girlcinderella storypopularitymakeoverloss of fathercheerleadermaskcollegehalloweendinerinternetmistaken identityuniversityhalloween costume …high school studentpublic humiliationlyinglegsbully comeuppancequitting a jobjack o'lanterncomeuppancesnowglobestepsisterhigh school athletetwin sisterscat costumecorrespondencechat roomangel costumenun's habitstepsister stepsister relationshipwolf whistlefitting inkissing in the rainprinceton universitycostume shopevil step motherhomecoming dancezorro costumehalloween dance (See All) |
To Greg Heffley, middle school is the dumbest idea ever invented. It's a place rigged with hundreds of social landmines, not the least of which are morons, wedgies, swirlies, bullies, lunchtime banishment to the cafeteria floor - and a festering piece of cheese with nuclear cooties. To survive the n …ever-ending ordeal and attain the recognition and status he feels he so richly deserves, Greg devises an endless series of can't-miss schemes, all of which, of course, go awry. And he's getting it all down on paper, via a diary - "it's NOT a diary, it's a journal!" Greg insists, preferring the less-sissyfied designation - filled with his opinions, thoughts, tales of family trials and tribulations, and (would-be) schoolyard triumphs. "One day when I'm famous," writes Greg, "I'll have better things to do than answer people's stupid questions all day." So was born the Wimpy Kid's diary. (Read More)
| Subgenre: | ghost story |
| Themes: | friendshiprevengechristmasbetrayalfearwrestlinghumiliationbullying |
| Mood: | rainbreaking the fourth wall |
| Locations: | schoolnew york cityforestsnowbusbicyclewoodsschool busschool bullyschool danceschool friend |
| Characters: | bullybest friendmusicianteacherteenage boysingerfamily relationshipsfather son relationshipmother son relationshipfriendchildrenbrother brother relationshipboygirldancer …photographerlittle boyasian americangrandfather grandson relationshipchildhood friend (See All) |
| Story: | gym teachergarage bandpopularitycandyclassdiaryumbrellafantasy sequencerock bandclassroomcameracell phonevoice over narrationbased on novelflashback …bare chested malefightdancingphotographsingingtelephone callsongunderwearmirrorurinationwatching tvcomputerrunningpianocompetitionmanhattan new york cityhalloweenflashlighttoiletno opening creditsvantalking to the camerafive word titlelibraryauditionhalloween costumeprankpianistfilm within a filmfirst partgarageprivate detectivepickup truckcoachnerdwoman with glassesfaintingwalkie talkieamerican footballwatching a moviejanitorreconciliationchild's point of viewspanishanimated sequencechild protagonistatticfriendship between boystitle at the endclassmatebroken armalarm clockwilhelm screamowlwrestlert shirtnarrated by characterporn magazinefire extinguishercafeteriascene before opening creditstrick or treatingjournaltween girlboy with glassespeer pressureschoolboylistening to a radioplaying a video gamecheesealtered version of studio logooverweighttimes square manhattan new york citybadgesitting on a toiletsnowmanmolespray painttoilet paperjunior high schoolschool playjack o'lanternmiddle schoolpirate costumeboy girl relationshipdental bracescanteenanimated opening creditsstudio logo segues into filmguatemalakindergartenbroken handrottweilerbreakdancinggym classbratbreaking the fourth wall by talking to the audienceschool lockerfirst day of schoolprecociousnessstuffed animal toyfat boygingerhand bandagereference to the wizard of ozboys' bathroomolder brotherschool cafeteriatwister the gamegroup of teenagersfriends falling outwedgiebleachersschool yearbookarm in a castsleeping in a bathtubhaunted forestarm in a slingbobble head dollhole in the groundphysical educationcymbalsnotgirl on boys teamleaf blowerptaschool clubwimpthrowing water on someoneweed whackervenetian blindsvoice over diarymouth guardphotograph comes to lifeschool gymschool newspapersinging auditionteenage bandbroken friendshippotty trainingcleaning a bathroomestranged friendwrestling coachmiddle childschool electioncootiespink eyepottysecret languageunicorn costumewriting on an arm cast (See All) |
Seventh-grade is no fun. Especially for Dawn Weiner when everyone at school calls you 'Dog-Face' or 'Wiener-Dog.' Not to mention if your older brother is 'King of the Nerds' and your younger sister is a cutesy ballerina who gets you in trouble but is your parents' favorite. And that's just the begin …ning--her life seems to be falling apart when she faces rejection from the older guy in her brother's band that she has a crush on, her parents want to tear down her 'Special People's Club' clubhouse, and her sister is abducted.... (Read More)
| Subgenre: | teen movieindependent filmcult filmcoming of ageblack comedydark comedy |
| Themes: | friendshipkidnappingdysfunctional familyhumiliationabusebullyingcruelty |
| Mood: | satiresocial satire |
| Locations: | schoolbussinging on bus |
| Characters: | bullyteacherfemale protagonistteenage boyfamily relationshipsbrother sister relationshipgirlsister sister relationshipjewishlittle girlparent child relationshipwriter directorjewish girl |
| Story: | garage bandprincipallockerfirst kissgirl with glassescrushteen angstcheerleaderspeechclassroomsingingtelephone callwatching tvwritten by directorkissing …pianogay slurtoiletsuburbattempted rapeglassesballetnerdclubchild's point of viewcynicismsibling rivalrysexual harassmentlonerpublic humiliationphysical abuseirreverencesexual awakeningharassmentoutcastcafeteriamental retardationboy with glassesballerinadown syndrometormentlunchjunior high schoolverbal abusemiddle schooldignitytauntingjewish familysocial outcastsibling relationshipfirst crushdeliberate crueltypsychological tormentlesbian slursardonicschool assemblypariahnerdy girlsuspected lesbianfood trayseventh gradespitball (See All) |
Sutter Keely lives in the now. It's a good place for him. A high school senior, charming and self-possessed, he's the life of the party, loves his job at a men's clothing store, and has no plans for the future. A budding alcoholic, he's never far from his supersized, whiskey-fortified thirst-master …cup. But after being dumped by his girlfriend, Sutter gets drunk and wakes up on a lawn with Aimee Finecky hovering over him. She's different: the "nice girl" who reads science fiction and doesn't have a boyfriend. While Aimee has dreams of a future, Sutter lives in the impressive delusion of a spectacular now, yet somehow, they're drawn together. (Read More)
| Subgenre: | coming of age |
| Themes: | datingdeath of fatherdancedrunkennessfriendshipmarriagemoneyjealousydrinkingmemorydivorcebreak upalcoholismfalling in lovesuicide of father |
| Mood: | high school |
| Locations: | schoolhospitalbarswimming poolbaseballbus driverwater gun |
| Characters: | single motherbest friendteacherteenage boyteenage girlmother daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipafrican americanfriendboyfriend girlfriend relationshipbrother sister relationship …dancerreference to godteacher student relationshipex boyfriend ex girlfriend relationship (See All) |
| Story: | giving a toastfirst kissclassalcoholclassroomsunglassescar accidentcell phonevoice over narrationbased on novelflashbacksexfemale nuditybare chested malekiss …cigarette smokingdancingpartyshowertelephone callcryingslow motion scenecomputerdrinksecretliebeertearsreference to jesus christtelephonef wordbramontageapologyhit by a carbartenderflash forwardprologuefired from the jobstorytellingreadingwaterfallsleepingtrustteenage sexblack americanpickup truckhuggingloss of virginitycomic bookhappinesscheating husbandcrying manpromisewhiskeyunderage drinkingbackpackconvenience storeabsent fatherpridebookstorephiladelphia pennsylvaniareckless drivingwoman in underweartext messaginghandshakeloss of jobdead fatherjukeboxhangover17 year oldflask18 year oldknocking on a doorwoman in bra and pantiesunhappinesspromsecond chancecollege campusbouncerfather son reunionwhite brabeggingmiserystudyinghomeworkhigh school graduationtelephone numberpassing outhigh school seniorstore clerkgeneration ykiss on the foreheadfootball fieldporchabandoned by fatherdumped by girlfriendhigh school prompart time jobpain killeri.d.big sisterfirst sexreference to nasateenage drinkingjumping into a swimming poolbreakfast cerealgeometryschool cafeteriayellow dresstutoringbaseball pitcherarm in a slingcollege applicationreference to californiareference to texasfear of failuredrinking on the jobhip flaskmen's clothing storedelivering newspaperreference to mexicoprom datewaiting for someonerefusing a handshakedrunken drivinglooking into a window (See All) |
A young girl finds that all the books she chooses in the library have been previously checked out by the same boy. Later she meets a very infuriating fellow... could it be her "friend" from the library? The boy's grandfather has a violin sales and service shop. The boy wants to be a violin maker lik …e his grandfather. (Read More)
| Subgenre: | teen romance |
| Themes: | first loveunrequited lovelovesurrealismeducationfalling in lovewriting |
| Mood: | high schoolrainanime |
| Locations: | schooltrainbicycleapartmentjapanitalyrooftopcavetwo on a bicycle |
| Characters: | best friendwriterfemale protagonistteenage boyteenage girlmother daughter relationshipfather daughter relationshipboyfriend girlfriend relationshipsister sister relationshiplove trianglegrandfather grandson relationship |
| Story: | teenage loveviolinistcrushfantasy sequenceclassroomcatflashbackdogsingingsongdreambookbased on comicbedroombased on comic book …old mandream sequencemarriage proposalflash forwardlibrarysuburbbased on mangadollreadingscene during end creditshigh school studentreunioncharacter says i love youdirectorial debutrockfireplacescene during opening creditsviolinfollowing someoneclockambitionimaginationone daybarking doginspirationlibrariantrue loveteasingbunk bedimmaturitysunriseexamintergenerational friendshipfamily homefemale writerrocking chairaspiring writerantique shoptranslationgemboy meets girlgrandfather clockwood carvingstudyfamous songsleep deprivationlyricselderly manhandwritinglibrary bookbookwormclimbing over a wallcarpe diemlibrary cardluthierviolin makergradesimple lifegeodeinstrument makerbad grades (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget …her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
| Subgenre: | coming of agesupernatural |
| Themes: | friendshipdeathartmagicangerdysfunctional familygriefchildhoodboy girl friendshipdeath of best friend |
| Locations: | school teacherpolice carschoolchurchforestwoodsrural settingfarmmuseumschool busart museumschool bullynew girl in townschool friend |
| Characters: | bullybest friendpolice officerteacherteenage boyteenage girlmother daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendbrother sister relationship …studentartistlittle girllittle boyteacher student relationshipchildhood friendlove letterbest friendsblonde girlnew friend (See All) |
| Story: | female teachergreenhousecrushqueenfantasy sequenceclassroompaintingbased on noveldogdancingphotographsingingthree word titlebased on bookpunched in the face …watching tvtearsplace name in titlerunningbirthdaydeath of friendbridgedrawingkingkeyproduct placementstorytellingdollpianisttragic eventbirthday cakeroperacelifting someone into the airloss of friendguitaristcgirealityimaginationchild's point of viewpet dogbelief in goddeerswingkingdomatheistdead girlbirthday presentoutsidertween girlcrownsquirrelfantasy worldblackboardtrollanguishrunnerchurch servicegrievingcreeknext door neighbororganistsocial outcastlifting a female into the airgirl next doornonconformityschoolyardfalling from a treelittle sisteranimal trapreference to leonardo da vincineglected childsketchbookbelief in hellpoor familyfemale bullyclubhousereality vs fantasysinging happy birthdaymake believeschoolboy crushtwo friendsfoot racetree houseanimate treeteacher crushreference to theodore rooseveltoff screen deathswinging on a ropemusic classtree swingsobbing femaleimaginary worldfear of hellrope swingrunning racedog as a giftcatching someone who fallsreference to teddy rooseveltknocked to the groundlost keysmuseum tripreference to pieter bruegelwooden bridgelog bridge (See All) |
Poppy Cross is happy-go-lucky. At 30, she lives in Camden: cheeky, playful, frank while funny, and talkative to strangers. She's a conscientious and exuberant primary-school teacher, flatmates with Zoe, her long-time friend; she's close to one sister, and not so close to another. In this slice of li …fe story, we watch her take driving lessons from Scott, a dour and tightly-wound instructor, take classes in flamenco dance from a fiery Spaniard, encounter a tramp in the night, and sort out a student's aggressive behavior with a social worker's help. Along the way, we wonder if her open attitude puts her at risk of misunderstanding or worse. What is the root of happiness? (Read More)
| Themes: | dancefriendshipjealousypregnancydrinkingparanoiamental illnessbullyinghomelessness |
| Locations: | school teacherschoolbeachbarcarbuslondon englandbicyclekitchenurban settinglakegas station |
| Characters: | bullyteacherfemale protagonistsingerfamily relationshipshusband wife relationshipmother son relationshipfriendboyfriend girlfriend relationshipchildrenboydancersister sister relationshiplittle girllittle boy …teacher student relationshiphomeless man (See All) |
| Story: | dance lessonschool uniformclassdatepantyhosewomanclassroomcell phonebare chested malekissfightcigarette smokingdancingnipplessinging …chasepantiestelephone callsongunderwearfoodslow motion scenedrinkundressingmaskbooklierunningmarijuanabracookingeatinginternetchild abusedrivingbirddrawingparkargumentsuburbuniformflowerslong takesplit screenchickenpubhappinesseccentricclubimprovisationstreet lifebootsplaygroundspanishironymiami floridarowboatscissorsbookstorenintendothirty somethingbarbecuepiersocial workerowlabandoned buildingyellingteachingbag over headdockfirst dateplaystationfriendship between womenstreet marketshoutingclinicdenialbumravebackyardtrampolinelearningoptimismsex on first dateglobedance classflamencofake breastsspaniarddriving lessoncar keyslessonpink braprimary schoolchildren's bookflatmatelearning to drivetouching breastsclappingpiggy back ridepalm readingthree sistersseat beltafrican anglo30 year oldchiropractordriving instructorpaper bagart projectoptimiststolen bicyclereference to pinocchioarts and craftspicture booktoucanback painshadow boxingcheerfulnessrowing boatcamden town londonosteopathreference to kate winsletnorth londontraffic signanglo african (See All) |
A tale told over four seasons, starting in autumn when Juno, a 16-year-old high-school junior in Minnesota, discovers she's pregnant after one event in a chair with her best friend, Bleeker. In the waiting room of an abortion clinic, the quirky and whip-sharp Juno decides to give birth and to place …the child with an adoptive couple. She finds one in the PennySaver personals, contacts them, tells her dad and step-mother, and carries on with school. The chosen parents, upscale yuppies (one of whom is cool and laid back, the other meticulous and uptight), meet Juno, sign papers, and the year unfolds. Will Juno's plan work, can she improvise, and what about Bleeker? (Read More)
| Subgenre: | teen movieindependent filmcult filmdark comedyteen comedy |
| Themes: | friendshipmarriagejealousypregnancydivorcedrug usebullyingadoptionabortionmythology |
| Mood: | high school |
| Locations: | schoolhospitalsnowbicyclewheelchair |
| Characters: | single motherbullybest friendmusicianteacherfemale protagonistteenage boyteenage girlsingerteenagerhusband wife relationshipmother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationship …doctorstudentdancerbabylawyersister sister relationshipstepmother stepdaughter relationshippregnant teenager (See All) |
| Period: | wintersummer |
| Story: | needlepointkeyboardbechdel test passedteen angstclassguitarclassroomvoice over narrationflashbacksexf ratedcharacter name in titleone word titledogkiss …dancingtitle spoken by charactersingingpantiestelephone callcryingsongunderwearurinationslow motion scenecomputercondomvomitingtearsrunningbathroomtelephonenewspaperbandmontagetoiletscantily clad femaleprologueprotestsuburbpay phonehigh school studentchildbirthbasementflowerobscene finger gestureteenage sexstrong female characterloss of virginitylistening to musiccomic bookguitaristdemonstrationcomposerstrong female leadvirginitycommercialattorneyconvenience storeshopping malltitle appears in writingbanananotebenchmarital problemwilhelm screampostervideo tapeteenage pregnancyforename as titlebicyclingpregnancy testponytailclinic16 year oldreceptionistautumncdmailboxpipeguitar playerpromcactusnewborn babysewing machineallergyfilm starts with sexunwanted pregnancywatching a videoanimated creditsminnesotaclerkfurnituredressingrunnerpanties hit the floorcheerleader uniformduetunwed pregnancypaperdrugstoretrack and fieldultrasoundtruth or daremicrowaveorange juicehigh school athletewoman in laborunwed mothereffeminacyreference to woody allensuicide contemplationschool lockerteenage motherabortion clinicfolk songhigh school promconvenience store clerkreference to kurt cobainschool cafeteriafingernailsconsidering abortionpositive pregnancy testspring the seasonreference to diana rossdeodorantfour seasonswoman holding a babydiscovering one is pregnantreference to iggy poptrack meetmoving furniturelounge chairnail salonpregnant schoolgirlfolk singingtic tacsinfant in cast creditsanti abortion demonstrationreference to the carpenters (See All) |
Lance Clayton is a man who has learned to settle. He dreamed of being a rich and famous writer, but has only managed to make it as a high school poetry teacher. His only son Kyle is an insufferable jackass who won't give his father the time of day. Lance is dating Claire, the school's adorable art t …eacher, but she doesn't want to get serious -- or even acknowledge publicly that they are dating. Then, in the wake of a freak accident, Lance suffers the worst tragedy and greatest opportunity of his life. He is suddenly faced with the possibility of all the fame, fortune and popularity he ever dreamed of, if he can only live with the knowledge of how he got there. (Read More)
| Subgenre: | independent filmblack comedydark comedytragedy |
| Themes: | datingdeathjealousydeceptiongriefsexualitypoetry |
| Mood: | high schoolsatire |
| Locations: | schoolapartment |
| Characters: | best friendwriterteacherteenage boyfather son relationshipfriendstudenthomosexualitysingle fathergay studentghost writer |
| Story: | high school teacherfictional talk showpopularityprincipalteen angstsexnuditymale nuditymasturbationthree word titlepantiespunctuation in titleslow motion scenesex in bedlie …apostrophe in titlecleavageaccidentwhite pantiesanti heroscantily clad femaleconfessiondeath of childhigh school studentdeath of sonpot smokingfameaccidental deathcoituspeeping tomsonrejectiontitle appears in writingdeceitvegetariansexual humoralienationcopulationadolescencejournalvulgarityhorninessmemorialgoth girlfather son conflicthigh school friendhigh school principalfreak accidentcoworker relationshipfake suicidehigh school boydeath by strangulationautoerotic asphyxiationhigh school newspaperview under tableschool psychologistforged letterpoetry class (See All) |
Marisa Ventura is a single mother born and bred in the boroughs of New York City, who works as a maid in a first-class Manhattan hotel. By a twist of fate and mistaken identity, Marisa meets Christopher Marshall, a handsome heir to a political dynasty, who believes that she is a guest at the hotel. …Fate steps in and throws the unlikely pair together for one night. When Marisa's true identity is revealed, the two find that they are worlds apart, even though the distance separating them is just a subway ride between Manhattan and the Bronx. (Read More)
| Subgenre: | fairy talevideo |
| Themes: | friendshiplovechristmaspoliticsdeceptionsurveillancebreak upprejudiceforgiveness |
| Locations: | new york cityhoteltaxielevatorschool busstation |
| Characters: | single mothersingermother daughter relationshipmother son relationshipfriendphotographerlittle boymaidhispanicfrenchgrandmother grandson relationshipself confidence |
| Story: | locker roomcamera shot of feetsecurity camerakiss on cheekcinderella storypresspaparazzibutlerclassspeechmicrophonelimousinewomanjournalistreporter …sunglassescameranuditybloodmale nuditydogdancingsingingpartycryingwatching tvlietearsplace name in titlemanhattan new york citytelephonevideo cameradisguisepoliticiansubwaynews reporttrainingsmokingfired from the jobliaruniformmistaken identitychristmas treelightningmanagerpremarital sexelectionstagegrandmotherclass differencesnewspaper headlinesingle parentapplausesanta clausworking classbuttockspress conferencespanishconfrontationitalian americanpet dogzooheadphonesco workermedicationsenatorabsent fatherengagementboyfriendswingmeetingmusic bandhappy endingfianceevideo surveillanceworkoutjewelrylatinalaundrycentral park manhattan new york citysubtitlespromotionautographpenguintelevision newsvacuum cleanersecuritypolitical campaignunited states of americadepartment storenewspaper articlerepublicanbathrobegoddessrallymonitorcleaning ladyrags to richeschick flickreference to googlepark benchhair salonbeauty salontabloidironinggodinvitationfundraiserchance meetingstatue of libertyreference to richard nixonvoteclothing storewalkmanstudyingprecocious childrevolving doorjewelry storecity parkfrisbeepersonal assistantsupermodelcolleaguestarting overcamaraderieexercisingseamstressmother daughter conflict70s musicstage frightluxury hotelmagazine coverbenefitspeakerwatergateconciergemanagementfemale bare feethandswalkliteracybrooklynpersonal trainerinvasion of privacyhotel suitequitting jobdog walkerkleptomaniajob applicationindecent exposurecentral parkcampaign managerdesigner clothestrying on clothesreference to henry kissingerdeadbeat dadfabricfavormaking a bedpaper clipborough name in titlemultilingualnixonsee through blousecouturefiringhousekeepingnervousunpackinghotel employeelegislatorave mariareference to simon and garfunkellightning rodluncheonnitroglycerinsetting a tablesotheby'sthe projectshandlerblack tiedog leashnew york postpeople magazinepunch clockanginagoing for a walkoldies musicservingassistant managermacaroni and cheesenew york magazineon the job training (See All) |
Follows a group of high school students growing up in southern California, based on the real-life adventures chronicled by Cameron Crowe. Stacy Hamilton and Mark Ratner are looking for a love interest, and are helped along by their older classmates, Linda Barrett and Mike Damone, respectively. The c …enter of the film is held by Jeff Spicoli, a perpetually stoned surfer dude who faces off with the resolute Mr. Hand, who is convinced that everyone is on dope. (Read More)
| Subgenre: | teen moviecult filmcoming of agemelodramateen sex comedy |
| Themes: | first lovefriendshipdrugschristmaspregnancyrobberydrug usebreak upabortion |
| Mood: | high school |
| Locations: | schoolhospitalrestaurantswimming poollos angeles californiaschool dance |
| Characters: | teacherteenage girlteenagerbrother sister relationshiplustteacher student relationshipdream girl |
| Period: | 1980s |
| Story: | pizza deliveryhigh school teacherlocker roomteen angstdatefantasy sequencerock musiccar accidentfemale nudityf ratedfemale frontal nuditymasturbationsex scenefemale rear nudity …leg spreadingpantiesbased on booktitle directed by femalesex on couchmirrorbikinivomitingmarijuanabathroomvoyeurcleavagegay slurcaliforniadrivingapologydream sequencescantily clad femalejeansvirginfired from the jobscene during end creditsprankfemale removes her clothesrock 'n' rollpremarital sexwhat happened to epilogueloss of virginityfarcesexual attractionvandalismamerican footballsurfingsexual desireconvenience storeshopping mallfootball playerfrustrationirreverencesexual awakeningteenage pregnancybongcannabiscafeteriaadvicerestroomsurferstonersexual promiscuityshoeunderage sexsex with a minorunwanted pregnancydrug humorcarrottelevision reporterfast food restaurantheart in handschool lifecheerleader uniformpirate costumeunwed pregnancyblond boytrophy wifeensemble filmgeneration xpayphonereference to led zeppelinemploymentcadaverhawaiian shirtpizzeriafield tripinnocence lostunderage girlrebelliousnessfemales talking about sexcar washingmaternity wardgreek restaurantticket scalpingredheaded boysurfer dude (See All) |
Tracy Flick is running unopposed for this year's high school student election. But school civics teacher Jim McAllister has a different plan. Partly to establish a more democratic election, and partly to satisfy some deep personal anger toward Tracy, Jim talks popular varsity football player Paul Me …tzler to run for president as well. Chaos ensues. (Read More)
| Subgenre: | teen romanceteen moviegay interestcoming of ageblack comedypolitical satireteen comedy |
| Themes: | marriageinfidelityreligionbetrayaljealousypoliticsadulterylesbianismextramarital affairdivorcecorruptionunfaithfulnesscruelty |
| Mood: | high schoolsatire |
| Locations: | schoolnew york citybicyclecatholic school |
| Characters: | teacherfemale protagonistteenage boyteenage girlmother daughter relationshipteenagerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipbrother sister relationshipstudentlove triangleteacher student relationship …gay teenagerself destructivenessteacher student sexlesbian daughterself absorption (See All) |
| Story: | teenage crushteenage loveteen angstlimousinevoice over narrationbased on novelflashbackf ratedone word titlesex scenekisstitle spoken by characterparty …lesbian kissshowercryingurinationblondeprayermanhattan new york cityconfessionfired from the jobelectionkissing while having sexclass differencesteenage sexwashington d.c.freeze framedestinyathletejoggingoverallsbroken legapplemoralityjanitorcynicismhot tubswingposterfemale female kissgraduationteachingethicsblonde womanmotel roombeeelection campaignpolitical campaignenvyteenage daughterteenage sexualitystatue of liberty new york cityjointjockpolitical candidatespitsex with a minormarital infidelitygirls' schoolnebraska16mmhigh school athletepepsibracesbannerpower plantcampaigningclicheridiculedumped by girlfriendphotocopiermultiple narratorsbee stinglesbian teensprinkler systemteen lovehistory teacherlawn mowingasparaguspinpower lineapple treepower stationlesbian sisternarcissistic personality disorderchemistry classgirl girl relationshipomaha nebraskaoverachieverskiing accidentwipemathematics teacherfaculty loungehigh school electionlincoln memorial washington d.c.student council presidentmuseum guideteenage issuesparochial schoolschool administratorhigh school vice principalwide angle lensstudent governmentvote tampering (See All) |
Made of Honor revolves around Tom and Hannah, who have been platonic friends for 10 years. He's a serial dater, while she wants marriage but hasn't found Mr. Right. Just as Tom is starting to think that he is relationship material after all, Hannah gets engaged. When she asks Tom to be her "maid" of … honor, he reluctantly agrees just so he can attempt to stop the wedding and woo her. (Read More)
| Subgenre: | fish out of waterslapstick comedy |
| Themes: | drunkennessfriendshipmarriagejealousydrinkingweddingdivorceloneliness |
| Mood: | rain |
| Locations: | new york citybarrestaurantchurchairplanetaxicastlemuseumchinese restaurant |
| Characters: | grandmother granddaughter relationshipbest friendsingerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipstudentdancermaidstepmother stepson relationship |
| Period: | year 1998 |
| Story: | locker roomsashgiving a toastgeekroyaltymicrophonelimousinewomanbasketballpaintingcell phonesexmasturbationdog …bare chested malekissdancingtitle spoken by charactersingingpartypantiesshowertelephone callsongunderwearfoodhorseface slappunched in the facedrinkundressingvomitingliecafecompetitionmanhattan new york cityhalloweenbrabridgeroommatespankingflash forwardprologuecollege studenthalloween costumehairy chesthorse ridingobscene finger gesturepubtwenty somethingcakehuntersheepwomanizerrap musiccorsetscotlandlove at first sightrowboatdeerbalconypassionate kissferrypajamaswedding receptionhalloween partyphoto albumengagement ringcoffee shopvideo tapecentral park manhattan new york citymisogynistentrepreneurreverendmarriage engagementchick flickgarbage truckbride and groomblogwater fountainwedding cakepillow fightscottishscotsmanbridesmaiddukekiltcollisionmarchingbloggereditingd.j.wealthy familyscotch whiskeytug of warchopsticks the eating utensilhair spraygarbagemankissing someone's handprenuptial agreementstarbucksman on the verge of tearsmaid of honorbridal showermace spraymounted animal headathletic competitionhaggiscornell universityfan girlscotch terriersex aidhighland gameswedding date (See All) |
Here's the thing! Viola's soccer team at Cornwall gets cut. She wants to join the boys team, but they do not allow girls. So she thinks "If you can't join them, beat them". So she does! She disguises herself as her twin brother Sebastian, and goes out for the rival school, Illyria, boys' soccer team … and makes it. Unfortunately, she didn't plan falling in love with her roommate Duke. But Duke has his eyes on Olivia. What makes matters worse is that Olivia starts to fall for Sebastian because he/she has a sensitive side. If things couldn't get more problematic, the real Sebastian (who was in London working on his music) comes home early. He arrives on campus and has no clue that he was replaced by his twin sister. (Read More)
| Subgenre: | teen romanceteen movieteen comedy |
| Themes: | datingfriendshipdeceptionobsessionbreak upfalling in love |
| Mood: | high school |
| Locations: | schoollondon england |
| Characters: | female protagonistteenage boyteenage girlmother daughter relationshipteenagerfamily relationshipsfather daughter relationshipbrother sister relationshiplove triangleex boyfriend ex girlfriend relationship |
| Story: | locker roombehavior modificationgeekgirl with glassescrushreference to william shakespearesoccercell phonekissfightshowerbased on playface slappunched in the facesecret …disguiseman with glassesdream sequenceroommatemini skirtwigtwincross dressingstrong female characterflirtingcoachclaim in titleshavingathletecatfightspiderimpersonationstrong female leadforbidden lovecarnivalbald manbreakupsexismboarding schoolinsultdressing roomlooking at self in mirrorwilhelm screamgenderinsecurityshortssports teamschemeassumed identitylong hairmini dressponytailtomboymaking outdisappointmentshort skirtcampusdivorced parentsbutt slapinvitationfemale athleteheadmastergender disguiseandrogynydental bracespassing outtamponbritish accentgender benderminiskirtwoman dressed as manbreast flashingcrossdresservoice mailaspiring musicianmodern day adaptationhair stylisteye candylifting weightsdebutanteflashing breastsskipping schoolpizza parlorsoccer gamesecret revealedlyricsbad datesideburnsdental headgeargirl dressed as boyexposing one's breastsfitting inchanging clothesgirl disguised as boyshakespeare in modern dressbinding breastsgirls' soccerwoman dressed as a manwoman flashingringtonefemale flashing breastsshakespeare's twelfth nightwoman flashing breastsshakespeare adaptationgirl on boys teamtransfer studenttryoutsvindicationwoman in man's clothesdebutante ballmotion sicknesskissing boothfrog dissectionwater poured over someone's headandrogynous femalehigh school shakespeare adaptationvarsity (See All) |
When her father enlists to fight for the British in WWI, young Sara Crewe goes to New York to attend the same boarding school her late mother attended. She soon clashes with the severe headmistress, Miss Minchin, who attempts to stifle Sara's creativity and sense of self-worth. Sara's belief that "e …very girl's a princess" is tested to the limit, however, when word comes that her father was killed in action and his estate has been seized by the British government. (Read More)
| Themes: | friendshipfearmagicracismlonelinesspovertyabusebullyingcrueltychildhoodamnesia |
| Mood: | rain |
| Locations: | schoolnew york citywheelchairshipindiaschool bully |
| Characters: | best friendteacherfemale protagonistfather daughter relationshipafrican americangirlsoldiersister sister relationshiplittle girlteacher student relationshipfrenchsingle fatherfather daughter dance |
| Period: | 1910s20th century |
| Story: | private schoolschool uniformturbanlocketfriendship between girlsgirl with glassesballoonprincessclassroomvoice over narrationbased on noveldancingthree word titlecryingunderwear …rescuebirthdaybritishgood versus evilorphanbedroomcandlenew yorkold manchild abusechild in perilbirthday partypainuniformstorytellingdollstatuereunionschoolgirlworld war oneflowerclass differencesmonkeybattlefieldhatesingle parentbirthday cakedressslow motionrace relationslifting someone into the airelephantmouseservantinterracial friendshiprealityindianpresumed deadimaginationchild's point of viewhatredchild protagonistrejectiondespairthunderstormroseatticboarding schoolrainstormhorse and carriagedead motherseparationloss of jobbirthday presentnarratorimaginary friendkindnessfriends who live togethercruise shiprainingbomberbowwindowclimbing out a windowtrenchletter writinglifting female in airnightgownresignationchild laborgirls' schoolmissing fatherfather daughter reunionbilingualbombardmentlonginginkasian indianchimneyheadmistressbratorphan girldeitystarving childbad temperriches to ragsballadeerfantasy lifemilkmanrich poorstory within a storyarmy captainsinger offscreenhot temperjourney shown on mapblowing out a candlegirls' boarding schoolmotherless childshawlchild exploitationdenunciationlosing temperharpistrejectrejectedchimney sweephelping otherspair of shoesaggressiveservant girlcrueldenouncementwood plankman versus beastramayanablind man's bluff gamemilk manserioussocial rejectbad temperedliving in an attic (See All) |
Samantha's life is going downhill fast. The sixteen-year-old has a crush on the most popular boy in school, and the geekiest boy in school has a crush on her. Her sister's getting married, and with all the excitement the rest of her family forgets her birthday! Add all this to a pair of horrendously … embarrassing grandparents, a foreign exchange student named Long Duk Dong, and we have the makings of a hilarious journey into young womanhood. (Read More)
| Subgenre: | teen romanceteen moviecult filmcoming of ageteen comedy |
| Themes: | first loveunrequited lovedrunkennessmarriageweddingdysfunctional family |
| Mood: | high schoolbreaking the fourth wall |
| Locations: | schoolrestaurantchurchschool bus |
| Characters: | teenage boyteenage girlmother daughter relationshipteenagerfamily relationshipsfather daughter relationshipbrother sister relationshipsister sister relationshipjapaneseself discoverydream girl |
| Period: | 1980s |
| Story: | geekcrushteen angstpizzacar accidentfemale nuditynumber in titlefemale frontal nuditytwo word titlephotographpartypantiesshowerunderwear …beerbirthdaylingeriegay slurwhite pantieslooking at the camerasuburbconvertiblefemale removes her clotheshigh school studentdirectorial debutgrandmotherclass differencesrecord playerbirthday cakenerdloss of virginityfarcelifting someone into the airtitle based on songunderage drinkinggrandfatherwedding dressethnic slurfirst daterestroom16 year oldjockunderage sexporscheillinoisnight vision gogglesveilshower roomdental bracesperson in a car trunkhigh school danceexchange studenthouseguestcoors beerasian stereotypeyellow pantiesdorkbrat packdental headgearwild partyshy girlwedding veildrive in restaurant16th birthdayfuture in lawswedding ceremony gone awrybridal veilforgotten birthday16 year old girl (See All) |
When Dennis Cooverman gives the commencement speech at his graduation, his friend tells him to let it all out. So he proclaims his love for Beth Cooper the head cheerleader, and says things about everyone in the graduating class as well as some other people. Later Beth confronts him and he invites h …er to a graduation party at his house. And to his surprise she and two of her friends show up. But also some of the people he offended with his speech, who want to tear him apart. And one of them is Beth's boyfriend whom she just broke up with. So they all get in Beth's car and drive away. And what follows is a wild adventure. (Read More)
| Subgenre: | teen movie |
| Themes: | escapemilitary |
| Mood: | high school |
| Characters: | bullyteenagerboyfriend girlfriend relationship |
| Period: | summer |
| Story: | gym teacherpopular girlpopularitygeekclasscheerleaderspeechcar accidentbased on novelflashbackcharacter name in titlethreesomekissfighttitle spoken by character …partyerectionpantiesshowerpunctuation in titleunderwearpunched in the facecondomwhite pantiesscantily clad femalehit by a carfive word titlecoming outchampagnekicked in the facecownerdclaim in titlenosebleedembarrassmentunderage drinkingconvenience storecomma in titleinsultreckless drivinghit in the faceadviceteenage sexualitysunrisehouse partyraccoonhigh school graduationimplied nudityfalling off a rooftamponhot pantsdead brotherfake idblonde stereotypefilm buffhigh school friendsteen lovesocial lifeponchosuspected homosexualawkward silenceconfession of lovegirls locker roomhigh school crushmaking out in a carvaledictoriancellular phone tracedrivers edbad driverhit in the eyepossessive boyfriend (See All) |
Cal (Steve Carell) and Emily (Julianne Moore) have the perfect life together living the American dream... until Emily asks for a divorce. Now Cal, Mr Husband, has to navigate the single scene with a little help from his professional bachelor friend Jacob Palmer (Ryan Gosling). Make that a lot of hel …p... (Read More)
| Themes: | drunkennessfriendshipmarriageinfidelitymoneyadulterydrinkingextramarital affairangerdivorcedepressionunfaithfulnessfight for love |
| Mood: | rainnightmare |
| Locations: | barlos angeles californiabicyclebaseball |
| Characters: | teacherteenage boymother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipgirlpolicemandancerlawyer …sister sister relationshipreference to godemployer employee relationship (See All) |
| Story: | teenage crushlocker roomteenage loveclassdategymumbrellacoffeewomanclassroomsunglassescameracell phonemasturbationbare chested male …sex scenekissfightdancingphotographchasetelephone callcryingdreamface slapslow motion scenepunched in the facewatching tvcomputerdrinkliebedreference to jesus christf wordmontagemarriage proposalbartenderscreamingflowerspursuitbasementsadnesscharacter says i love yougardenblindfoldballetsleepingobscene finger gesturekissing while having sexrecord playerapplauseanswering machinelistening to musicbabysitterrecordingice creamone night standwomanizershoesbuddyensemble castmakeuplipstickwedding ringmarital separationraised middle fingermarital problemmidlife crisisreckless drivingtext messagingmale objectificationtitle ends with periodaccountantgardeningsneakerswalletescalatortrue love17 year old13 year oldcredit cardballerinahonestysushinervousnesstextingbouquetmiddle schoolforty somethinghardware storeplaying footsieimplied nuditysoul matetalking to oneselfpassing outapple computerlaw studentrecovering alcoholiccologneschool lockerlaw schoolmoving vanbaseball gloveminiature golfvaliumsextingplaying catchnude photoschool cafeteriaenglish classstanford universityreference to the titanicstanding in the raindisapproving fatherpickup linereference to steve jobsparent teacher conferencereference to mcdonald'swatching through a windowrunning a red lightreference to hugh hefnerbachelor padcopying machineunhappily married womanjumping out of a moving carlotharioreference to ashton kutcherreference to demi mooregraduation speechschool auditorium44 year oldbar examreference to patrick swayzedomestic strifemen's clothingmale makeovermixing a drinkphotographing oneselfcaramel applemassage chairreference to the scarlet letterreference to wilt chamberlainslapping someone's handteen parentlifting a girl into the airreference to conan o'brienwater heater (See All) |
Adapted from William Shakespeare's play "The Taming of the Shrew," 10 Things I Hate About You starts off with Cameron, new student at Padua High, sitting in the office of the quirky guidance counselor Ms. Perky. He is then shown around the school by Michael, who will become his best friend. During h …is tour is when Cameron first sees Bianca Stratford, a beautiful sophomore with one problem: she isn't allowed to date. And neither is her "shrew" sister, Katarina, a senior who loves indie rock and feminist prose and hates conformity. But Kat and Bianca's father alters his house rule: now, Bianca can date... as long as Kat has a date, too. Now, in order for Cameron to date Bianca, he has to find someone to date Kat. So Michael helps him enlist the help of pretty-boy/jerk/model Joey Donner, tricking him into thinking that *he* will get to take Bianca out if he pays someone to take out Kat. His choice: Patrick Verona, a bad-boy with a mysterious reputation--some say he ate a live duck once, others that he lit a state trooper on fire, and even more claim that he had a brief porn career. Will Patrick win Kat's heart? Will Cameron win Bianca's? Or will everything hit the fan...? (Read More)
| Subgenre: | teen romanceteen movieblack comedyteen comedy |
| Themes: | unrequited lovedatingdrunkennessfriendshipbetrayaldeceptionpoetry |
| Mood: | high school |
| Locations: | schoolbarcarmotorcyclelaboratory |
| Characters: | teacherfemale protagonistteenage boyteenage girlteenagerfather daughter relationshipboyfriend girlfriend relationshipdoctorsister sister relationshiplove trianglesecurity guarddaughterfathergirlfriendsingle father …dream girlmean girl (See All) |
| Period: | 1990s |
| Story: | high school teachergeekgirl with glassesteen angstreference to william shakespearedatesoccerguitarclassroomf ratednumber in titlecigarette smokingdancingpartybased on play …digit in titlevomitingmarijuanamansionmontagemodellibraryproduct placementhigh school studentfeminismsix word titlesubtitled scenesingle parentwoman with glassesrebelinterracial friendshipbikerpool tablefeministbookstoreboyfriendsexual humorattractionjuvenile delinquentseattle washingtonenglishman abroadgothbriberybloopers during creditscar drivingcafeteriaintolerancebully comeuppanceshot with an arrowarcherymisfitteenage daughtertutormarching bandpromjockchick flickhigh school girlbattle of the sexesopposites attractdetentionpaintballschool lifemusic storewoman punching a manprotective maleconcussioncliqueresentmentadolescent boybalisongshakespearean quotationreference to ernest hemingwayhigh school principalmisanthropefootball stadiumadolescent girlmodern day adaptationhigh school boyflasherguidance counselorserenadewhite male pretending to be blackshot in the buttyounger sisteroverprotective parentrastafarianshakespeare in modern dressenglish literatureolder sistershakespeare adaptationfrench lessonprotective fatherseattle space needleanti smokingbad poetrydancing on a tableshakespeare's the taming of the shrewshrewteen datingfeminine mystiquehigh school shakespeare adaptationreference to fabio (See All) |
Dawn grows up in the shadow of a nuclear power plant. In high school, while her biology class studies evolution, she realizes she may have a hidden curse, an "adaptation." She lives with her mom, step-father, and hard-edged step-brother. She likes Tobey, a guy at school, and he likes her. She takes …a pledge to remain chaste until marriage, so they date in groups, watch G-rated films, and don't kiss, but the power of teen hormones is great, so temptation beckons. Dawn has an admirer in Ryan, and when when things have an unexpected twist with Tobey, she turns to Ryan for help. Will he be her mythical hero and rescue her? Or can she find her way as her own hero, turning the curse into an asset? (Read More)
| Subgenre: | independent filmcoming of ageblack comedypunk |
| Themes: | murderdeathloverevengerapereligiondeceptionseductionlonelinessdysfunctional familyguiltsexualityillnessevilvengeance …police investigationmythologyevolutionfear of sex (See All) |
| Mood: | high schoolraingorenightmaremythblood and goreancient myth |
| Locations: | police carschoolhospitalbathtubbicyclecavegas station |
| Characters: | teacherteenage boyteenage girlmother daughter relationshiphusband wife relationshipfather son relationshippolicefriendboyfriend girlfriend relationshipdoctortattooboygirlnursestudent …dancerstepfather stepdaughter relationshipstepbrother stepsister relationshipstepmother stepson relationship (See All) |
| Story: | high school teacherlocker roomgiving a toastfirst kissclassdategymspeechmicrophoneguitarclassroomcell phoneflashbacknudityblood …violencefemale frontal nuditymale frontal nuditymasturbationmale rear nuditydogsex scenefightcigarette smokingfingeringdancingtitle spoken by charactershowerdreamcorpseblood splattermirrorpunched in the facewatching tvcomputercondombookbeervibratorbedmale pubic hairswimmingbedroomflashlightcandledrawingbathsearchvirginchampagnelightningringattempted rapescarhigh school studentgiftpremarital sexwaterfallprofanitydismembermentteenage sexsexual fantasysurgerypot smokingjeeplistening to musicpropagandamutantmutilationmorguewatching a movieswimsuitvirginityhitchhikingmoralitypromisemovie theatrepillssevered fingerresearchdark humorlove at first sightperversiondeceitturtlesexual humorcliffbetcastrationclassmatelooking at self in mirrormutationsexual assaultstolen carsexual awakeningbongmetaphortemptationsexual perversionvulgarityself defensemaking outsex educationknocking on a doorbubble bathpiercingbitten in the neckbody bagteethhorninesspondbleeding to deathfilling stationgropinghigh school girlsexual repressionrattlesnakedeath by drowningtoy gunhymntalking about sexgynecologistdog attackgrudgebitecandlelightsurgical operationbitingsexual arousalsexual intercoursefingerstrobe lightfemale studentnuclear power plantstepsisterfemale sexualityoverheard conversationgynecological examadolescent boyfemale empowermentserpentsevered penisadolescent girldog bitefinger cutconservatismhigh school boyindoctrinationchastity beltscuba diverfinger bitten offteenage rapestepbrotherblood spurtingintelligent designbb gunchastitypurityschool assemblyheavy metal musicill motherpledgeclimbing a ropevoice over readingrebellious sondysfunctionalitygynecologyspilling a drinkself disciplinevagina dentatafemale classmatemale sexualitysexual abstinenceneck woundtoy rabbitself repressionsex education bookwatching a cartoonfinger bite (See All) |
Max Fischer is a precocious 15-year-old whose reason for living is his attendance at Rushmore, a private school where he's not doing well in any of his classes, but where he's the king of extracurricular activities - from being in the beekeeping society to writing and producing plays, there's very l …ittle after school he doesn't do. His life begins to change, however, when he finds out he's on academic probation, and when he stumbles into love with Miss Cross, a pretty teacher of the elementary school at Rushmore. Added to the mix is his friendship with Herman Blume, wealthy industrialist and father to boys who attend the school, and who also finds himself attracted to Miss Cross. Max's fate becomes inextricably tied to this odd love triangle, and how he sets about resolving it is the story in the film. (Read More)
| Subgenre: | teen moviecult filmcoming of agecoming of age film |
| Themes: | unrequited lovefriendshipinfidelitychristmasjealousydivorceobsessiondepressionwrestlingtheatrevengeance |
| Mood: | high schoolaffection |
| Locations: | helicopterschoolhospitalrestaurantswimming poolhotelcemeterybicycleelevator |
| Characters: | teacherteenage boyteenage girlstudentlove triangle |
| Story: | preparatory schoolprivate schoolcrushteen angstspeechbasketballalcoholone word titledancingtitle spoken by characterblondeslow motion scenearrestjailkung fu …cleavagewidowno opening creditsdream sequencebirthday partysmokinglibrarywidowergiftunderwaterclass differencesflirtingsabotagevandalismhaircutdivinginterracial romanceexplosivebreakupbackstagemillionaireaquariumflamethroweradolescentgeniusirreverencehappy endingunhappy marriagevietnam veteranbarberfish tankplaywrightmisfitfencingstrokekiteidentical twinsscholarshipchapelman wearing glassesunwanted kissschool playbarbershopschool lifeindustrialistteenage angstpetitionyearbooksteelexpulsionbackgammonbeekeepingscience fairtv dinnermale cheerleadergirl wearing glassesboy wearing glassesair riflespringboardremote control airplaneacademic fraudpea shooterred haired twins (See All) |
Takao, who is training to become a shoemaker, skipped school and is sketching shoes in a Japanese-style garden. He meets a mysterious woman, Yukino, who is older than him. Then, without arranging the times, the two start to see each other again and again, but only on rainy days.
| Subgenre: | teen romancecoming of age |
| Themes: | unrequited lovelovelonelinesshopechildhoodfalling in love |
| Mood: | high schoolrainanime |
| Locations: | schooltrainsnowapartmentjapancity |
| Characters: | teacherteenage boyteenagerfamily relationshipsbrother brother relationshipjapaneseteacher student relationshipolder woman younger man relationshipcrying boy |
| Story: | teenage crushfemale teachercrushteen angstwomanclassroomvoice over narrationflashbackfightcryinghigh heelsfistfightwritten by directorbeerbedroom …cookingfour word titlefalse accusationnarrationtrainingparkpassionlightninghigh school studentgardenpoembeer drinkingheavy raincrying womangossipteenage protagonistapartment buildingbarefootshoesthunderchild protagonistdespairscene after end creditssketchsexy womanrainstormbarefoot femalebenchchildhood memorysurprise after end creditsage differencechocolatenarrated by characterscene before opening creditssubway stationschoolboy15 year oldbare feetcrying femaledesignerpark benchmysterious womanfirst person narrationintergenerational friendshipaccusationwet clotheschance meetingsong during end creditsstairwellstarts with narrationcity parkcrying malesubway trainbarefoot womanbloody mouthgazebosketchinglunchboxband aidinternal monologuechildhood flashbacksketchbookfemale bare footquitting jobbeer canchocolate barchild's bedroomphilosophical conversationteacher student romancetruancyshoemakersoul searchingsitting on a bench27 year oldeveryone mattersliterature teachertruantpair of shoesmeeting placesketch padcutting classcobbler the shoemakerrainy seasonshoe designer (See All) |
Toula Portokalos is 30, Greek, and works in her family's restaurant, Dancing Zorba's, in Chicago. All her father Gus wants is for her to get married to a nice Greek boy. But Toula is looking for more in life. Her mother convinces Gus to let her take some computer classes at college (making him think … it's his idea). With those classes under her belt, she then takes over her aunt's travel agency (again making her father think it's his idea). She meets Ian Miller, a high school English teacher, WASP, and dreamboat she had made a fool of herself over at the restaurant; they date secretly for a while before her family finds out. Her father is livid over her dating a non-Greek. He has to learn to accept Ian; Ian has to learn to accept Toula's huge family, and Toula has to learn to accept herself. (Read More)
| Subgenre: | independent film |
| Themes: | datingweddingracismprejudice |
| Mood: | high school |
| Locations: | school teacherschoolrestaurantchurchchicago illinois |
| Characters: | grandmother granddaughter relationshipteachermother daughter relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipbrother sister relationshipstudentpriestlittle girlwaitresscousin cousin relationshipaunt niece relationship |
| Story: | high school teachermakeoverdatelimousineclassroomcameravoice over narrationflashbackf rateddancingphotographcomputertearscollegemarriage proposal …suburbcollege studentsubtitled scenetraditionblockbusterculture clashmakeupvegetarianmisogynywedding receptionmusic bandgreekbaptismschoolteachercultural differenceritebride and groomwedding gowncustomprotective malelambcross cultural relationshipethnicintoxicationcountry clubinter culturalcontact lensextended familytravel agencycultural conflictgreek americanparthenongreek orthodoxgreek restaurantethnic pridezitbaklavagreek dancingintentional mistranslationouzoetymologywindexgreek family (See All) |
Her parents being zoologists, homeschooled Cady Heron lived in Africa for 15 years. Attending a Chicago public high school for the first time, she starts out by befriending the "best people you will meet", Janis, a supposedly lesbian girl; and Damian, a boy "too gay to function". Cady is warned to a …void the "worst people you will ever meet", the Plastics--a clique comprised of three girls: Gretchen Wieners, a girl who's rich because her father invented toaster strudel; Karen Smith, the "dumbest girl you will ever meet"; and Regina George, the unofficial leader and the meanest one. She becomes a hit with the Plastics and eventually assimilates into the clique, only for Janis to ask her sabotage them. After conflicts involving Regina's ex-boyfriend, Aaron Samuels, Cady later becomes tied between being part of them or sabotaging them. Whilst eventually becoming one, she sabotages them. She tricks Regina into eating fattening candy bars that she claims will make her skinny, tries to break her and Samuel up, and tries to turn her fellow Plastics, Karen and Gretchen against her. Will she be caught? Will she become too Plastic and become the fourth Plastic? (Read More)
| Subgenre: | teen moviefish out of watercult filmblack comedyteen comedy |
| Themes: | christmasbetrayaljealousydrinkinghumiliationbullyingcheating |
| Mood: | high schoolsatire |
| Locations: | schoolafricaschool busnew girl in town |
| Characters: | bullyfemale protagonistteenage boyteenage girlstudentlove triangleteacher student relationshipcousin cousin relationshipgay teenagerex boyfriend ex girlfriend relationshipdream girlteacher student sexmean girl |
| Period: | 2000s |
| Story: | high school teacherfemale teacherawkward girlpopular girlprincipallockercandygirl with glassesteen angstclassroomcell phonef ratedtwo word titlekissfight …partybased on bookunderweardrinksecretlielingeriehalloweengay slurbraeatingman with glassesargumentmini skirthalloween costumemanipulationhigh school studentschoolgirlteenage sexflirtingdesirenipples visible through clothingwoman with glassesgossipembarrassmentdiscussionmusical numberattractionclassmatehalloween partyirreverenceintimidationvomitname callingmathematicsbully comeuppanceboy with glassesrumor16 year oldenvyconversationshort skirtchick flickhigh school girlfart joketeenage girl in underweargoth girlincestuous desirebreast implantfemale antagonistsocial climberfemale studentcliquehigh school danceminiskirtcat costumegeneration yredhead girlhit by a busbook burningeye candyhigh school boyschool lockerbunny costumebad girlblue brahome schoolinglesbian slurpurple brafriends who hate each othergood deedpvcfitting intrendsexy costumesex edsplit screen telephone callweight gaintroubled teenage girlreference to the spice girlsunintended consequencessuspected lesbianbad attitudeface creamstereotypesfiery redheadfootball player costumemouse costumehistrionic personality disorderolder person playing teenreference to danny devito (See All) |
Kate (Brittany Snow) is the new girl in school. She catches John Tucker (Jesse Metcalfe) dating three different girls at once: Carrie - the smart girl, Heather - the cheerleader, and Beth - the activist slut; none of them are aware that they are not the only girl in John's heart. Kate, having been r …aised by a single mother, has seen the pain caused by playboys like John Tucker, and she won't stand idly by. Together with the three jilted ex-girlfriends, they hatch a plan to teach John a lesson. Things rarely go as planned, especially when Kate starts to think that she might be falling for John herself. (Read More)
| Subgenre: | teen movieteen comedy |
| Themes: | datingfriendshiprevengevoyeurismguiltbreak upcheating |
| Mood: | high school |
| Locations: | beach partyschoolhotelboatyacht |
| Characters: | single motherteenage girlmother daughter relationshipteenagerboyfriend girlfriend relationshipbrother brother relationshipstudentwaitressex boyfriend ex girlfriend relationshipcheating on girlfriendnew student |
| Story: | locker roompopularitycheerleaderbasketballcameracharacter name in titlebare chested malephotographlesbian kisspantiestitle directed by femaleblondecomputerbikinithong …liebirthdayvoyeurcleavagevideo camerascantily clad femalebirthday partyhotel roommini skirtscene during end creditsmanipulationfemale removes her clotheslaptoppremarital sexgirl in pantiesclaim in titlefalling down stairsathletewristwatchflatulencewomanizersexual humorred pantiesfemale directorfemale female kisswoman cryingfemale bondingfirst datefemale friendshipwebcamthong pantiesvolleyballelectric shockdruggedromantic rivalryinternet chatbasketball playerfood fightwoman wearing black lingeriehigh school frienddigital camerachemistrycupcakewomen kissinggeneration yplayerbasketball teamlawn sprinklerphilandererback stabbingbare midriffhiding in a carnew homekissing in publichigh school basketballman wearing a towelsprayed with waterwhite rosespelling beevideo conferencingpromiscuous motherwinkingchocolate cakesecret filmingwearing a wireshort circuitwoman wearing red lingeriegirl kissing girlbrownieteam captaintrick shotbeakersloopstreet hockeyestrogenexposed thong underwearhit with a ballmale wearing a thonggoodnight kissdingymale wearing thongcurtsyflower deliveryman wearing womans pantiesvisible thong strapsboys' locker roombumping headssexy mothertongue tied (See All) |
Across The Universe is a fictional love story set in the 1960s amid the turbulent years of anti-war protest, the struggle for free speech and civil rights, mind exploration and rock and roll. At once gritty, whimsical and highly theatrical, the story moves from high schools and universities in Massa …chusetts, Princeton and Ohio to the Lower East Side of Manhattan, the Detroit riots, Vietnam and the dockyards of Liverpool. A combination of live action and animation, the film is paired with many songs by 'The Beatles' (qv) that defined the time. (Read More)
| Subgenre: | documentary footagerock musical |
| Themes: | unrequited lovedancedrunkennessfriendshipmurderdeathsurrealismmarriagedrugsjealousypoliticspregnancyescapefuneralart …militarydepressiondrug useabusetheatrepanicfreedomfalling in loverevolutionpolice brutalitynear death experiencecheating death (See All) |
| Mood: | high schoolrainbreaking the fourth wall |
| Locations: | helicopterbeachhospitalnew york citybarchurchsnowcemeterybusnightclubtaxiwheelchairshiptruckrooftop …taxi driverschool busbus stationfire escapecorpse in water (See All) |
| Characters: | single motherpolice officerteachersingermother daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipafrican americanfriendboyfriend girlfriend relationshipbrother sister relationshipprostitute …soldiernursealienstudentpolicemandancerpriestlawyersister sister relationshipartistwaitressinterracial relationshipprofessoruncle nephew relationshippimppolice arrestdeath of boy (See All) |
| Period: | 1960swinter |
| Story: | lockerchoirclasscheerleadergymspeechfantasy sequencemicrophonepantyhoserock bandbasketballalcoholguitarclassroomletter …female nudityf ratedbloodmale nudityfemale frontal nuditymale rear nuditybare chested malegunkissfemale rear nudityfightcigarette smokingdancingphotographtitle spoken by characterexplosionsingingpartychasethree word titletelephone callfirecryingsongtitle directed by femalebeatingcorpsemachine gunurinationblondeslow motion scenepunched in the facewatching tvbattlearrestundressingshootingriflebombrunningmarijuanajailbritishmanhattan new york citytelevisionswimmingnewspaperbandconcertcaliforniamontagearmyimmigrantsubwayno opening creditsassassinationdrawingunderwater sceneroommatejourneynews reportlooking at the cameraimmigrationprotesttentcollege studentuniversitydomestic violenceamerican flaginjectioncrossdeath of sonrock 'n' rollsadnesspremarital sexgraffitipubnewspaper headlineheroinrunawayriotcircusfemale stockinged legssyringeflyinghypodermic needleperformancetitle based on songjail cellguitaristdemonstrationbeardamerican footballhammerbuttocksvietnam warphone boothcomposertorchburialhitchhikerstreet lifehitchhikingapplehookerjanitorimaginationbloody noseveteranbreakupu.s. armyfanmourninghippieanimated sequencepool tableshot in the facebroken glassnewsreel footagefootball playertheatre audiencemedical examinationabsent fatherdead childbilliardsdrunksketchblack eyesongwritersnowingdressing roombowlingwar veteranbruisemeetingdeath of loved oneillegal immigrantpatriotismmusic bandposterthanksgivinglighthouseanti warclosetdockplaying pooldetroit michigangolf clubblack pantyhoseescalatortelevision newsdeportationstrikehangoverbroken windowclimbing through a windowlaundromatmaking outlsdcornfieldelectric guitarlandladymegaphonetoastdance clubbowling alleybreaking a windowamericanabumhearsepromvolunteerjockdomestic abusedeath of boyfriendmoustacheinterracial coupleacoustic guitarcollege campuswashing machinecultural differencepatriotironingtelevision setinfantrythe beatlestour buscounter culturestatue of libertygururadicalloudspeakersmoking potmarchrock singerestranged fatherguard dogdrug triplootingstrawberryletter writingimperialismprotestormuralpassing outcerealrecord producersearch for fatherdog tagreference to martin luther king jr.barricadefloatingliverpoolgiggreenwich village manhattan new york citybiological fatherhigh school danceprotest marchwelderfootball fieldkeyholesexy nurseshipyardsketchingpolitical unrestpsychedeliarepairmanplatoonriot policeafrobus triplocked in a closetmilitary draftwar woundhare krishnathanksgiving dinnerpatrolslow dancingtrippybasic trainingdropoutnude drawingfootball practicepeace signreference to lyndon johnsonchest hairflying machinethanksgiving daydrafttitle sung by characterblack white relationsgreyhound busbleachersbomb makingdelicatessenphysical examreference to brigitte bardoturine samplegraffiti artgospel choirjukebox musicalrecord contractwall paintingprinceton universitysinging to the cameraoutdoor concertphysical examinationprotest songsocial unrestrecord dealwashington square manhattan new york citycollege boundcollege kidmarch on washingtonpicket signrecord executivetranscendental meditationprotest riotdockworkerhomemade bombstreet theaterfloating bodypsychedelic drugreference to jack kerouacanti war movementbus depotdraft noticeex lovers back togetherlesbian attractionlooking at the audiencestudent movementburning paperdayton ohiopacketriotingsliding down a banisterocean wavesolarisationuncle samarmy inductioncranberry saucedouble negative (See All) |
Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the … Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)
| Subgenre: | cult film |
| Themes: | dancedrunkennessfriendshipmoneypregnancydrinkingweddingmemory |
| Mood: | breaking the fourth wall |
| Locations: | beachnew york citybarchurchhotelmotorcycleairplanenightclubtaxirooftopoceanyacht |
| Characters: | single motherwritermusicianfemale protagonistsingermother daughter relationshiphomosexualfather daughter relationshipfrienddancerpriestolder woman younger man relationship |
| Story: | sailboatdiaryfantasy sequencelimousinewomanguitarletterflashbackf ratednuditymale nuditymale rear nuditydogsex scenekiss …dancingejaculationphotographsingingpartypunctuation in titlecryingsongtitle directed by femalemirrorslow motion scenedrinkthongbare buttfalling from heightbooktearspianoislandswimmingbandbridgetoiletinternetfishno opening creditsdrawingbartenderbinocularssuitcaseflowersscene during end creditsexclamation point in titlepianistsplit screencloseted homosexualtouristfaintinglifting someone into the airtitle based on songbarnoverallsarchitectbuttocksblockbusterbrideladdergoatearthquakepassportbarefootdivinginterracial romancehippiegreecewedding ringferryreckless drivingwedding receptiondonkeypeasantharbortriple f ratedlaundrydockold flameraftmailmailboxillegitimate childmusic boxjumping into waterbagpipesbride and groomcanceled weddingpaternitylifting female in airbridesmaidcrossing selfgirl bandbiological fathermediterraneanlifting an adult into the airbased on stage musicaltoilet stallplaying against typebachelorette partygreek islandmiddle age romancescubapushed into waterair guitarpromiscuous pasttitle sung by characterengaged couplenubile womanjukebox musicalfeather boapaddle boatresort hotelswinging on a ropesummer romancewindchimeabbafalling through the ceilingflower powerreference to aphroditeswim flippers (See All) |
| Subgenre: | music video |
| Themes: | danceloveguiltcelebrity |
| Locations: | beachsmall townfarmcountry |
| Characters: | grandmother granddaughter relationshipbest friendmusicianfemale protagonistteenage girlsingerteenagerfamily relationshipsfather daughter relationshipbrother sister relationshipsecurity guardsingle fatherself realization |
| Story: | paparazziteen angstdatebodyguardlimousinenuncameracell phonef ratedcharacter name in titledancingsingingfirecryinghorse …secretliebandconcertdinnerbirthday partyargumentbased on tv seriespop musicwidoweractor shares first name with characterscene during end creditsprankwigwaterfallsingle parentpickup truckfamecatfightoverallshollywood californiacountry musicpop starshoescharityshoppingskateboardingdressing roomsecret identitysouthern accenthorseback ridingstage performanceautographdouble lifeselfishnessvolleyballrhyme in titleactress shares first name with charactermovie in titlesurfboardacoustic guitaralter egobased on tv showtabloidnashville tennesseeprivate jetfundraisertour busexposeamerican southeggsidentity swapgolf cartsong and dancebritish accentsecret lifegym classsongwritingstardommultiple cameosmalibu californiapublicistcaught in a lieaccentyoung romancemud bathfamous singerreal life father and daughter playing father and daughtersolo performancedance routineswitching clothesfranklin tennesseeticket boothhenhousehannah montana (See All) |
Seventeen-year-old Greg has managed to become part of every social group at his Pittsburgh high school without having any friends, but his life changes when his mother forces him to befriend Rachel, a girl he once knew in Hebrew school who has leukemia.
| Subgenre: | teen movieindependent filmcoming of ageblack comedyfilm parody |
| Themes: | datingdeath of fatherfriendshipdeathsurrealismdrinkingtorturememoryangerdrug usecancergriefhumiliationillnessdying …regret (See All) |
| Mood: | high school |
| Locations: | schoolhospitalbuselevatorschool bus |
| Characters: | single motherteenage boyteenage girlmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattooboyjewish …reference to godself referentialself hatetheatre student (See All) |
| Story: | limousine driverawkwardnessgeektuxedoclasslimousineclassroomlettercatvoice over narrationbased on novelflashbackinterviewmasturbationdog …fightphotographsingingtelephone callcryingsongfoodmirrorslow motion scenewatching tvcomputerdrinkbare buttsecretvomitingliemarijuanacollegehallucinationreference to jesus christprayertelephonesurvivalbedroomambulancedrug dealermontageeatingapologytalking to the cameraflash forwardprologuestorytellingflowerswighigh school studenttrustblack americanterminal illnessnerdpot smokinglooking at oneself in a mirrorcomaice creammousetoyspiderclassical musicinterracial friendshippromisenicknamerap musicanimated sequenceheadphonesdespairco workerscissorssurprisee mailhologramcellphonenarrated by charactercremationcafeteriastairwaysarcasmname callinglooking out a window17 year oldpopcornstonerclimbing through a windowsquirrelhearing voices15 year oldstonedunhappinesscookiesoupleukemiatestepiloguereference to googlehonestywakepillowpolar bearhoodiekiss on the cheekreference to richard nixonhip hop musicgogglespittsburgh pennsylvaniapanic attackhebrewoverhead shotchemotherapydoombaldnessbirthmarkhigh school seniortarantulathreat to killapple computerpretending to be deaddoorbellkindergartenharpjoke tellinglooking in a windowreference to gandhirappingpenis slurinner titlespityreference to andy warholgerman accentfilm fanchased by a dogschool expulsionunreliable narratorhistory teacherboys' bathroomhit in the stomachteenage drinkingreference to orson wellesstocking caphumilityschool cafeteriaaspiring filmmakertulipgroup hugreference to salvador dalicollege applicationfist bumpmotherly lovereference to francois truffautreference to akira kurosawatattoo on neckhigh school cliquecrawling on the floorreference to texashornetreference to indiareference to luis bunuelsociology professorcorsagecrying teenage girlreference to lebron jamesreference to wolverinebreasts slurcrying teenage boycuttlefishget well cardpig costumereference to julian assangereference to klaus kinskicartoon chipmunkpassive resistancereference to cat stevenscremated ashesreference to princeton universityreference to werner herzogwalking down the middle of a streetdestroying a bookreference to afghanistanreference to hugh jackmansenior prom (See All) |
Beyond being in the same class at Shermer High School in Shermer, Illinois, Claire Standish, Andrew Clark, John Bender, 'Brian Johnson (XIV)' (qv) and Allison Reynolds have little in common, and with the exception of Claire and Andrew, do not associate with each other in school. In the simplest and …in their own terms, Claire is a princess, Andrew an athlete, John a criminal, Brian a brain, and Allison a basket case. But one other thing they do have in common is a nine hour detention in the school library together on Saturday, March 24, 1984, under the direction of Mr. Vernon, supervising from his office across the hall. Each is required to write a minimum one thousand word essay during that time about who they think they are. At the beginning of those nine hours, each, if they were indeed planning on writing that essay, would probably write something close to what the world sees of them, and what they have been brainwashed into believing of themselves. But based on their adventures during that nine hours, they may come to a different opinion of themselves and the other four. (Read More)
| Subgenre: | teen movieindependent filmcult filmcoming of ageblack comedyteen comedycoming of age film |
| Themes: | dancejealousyescapeangerdysfunctional family |
| Mood: | high school |
| Locations: | schoolcarofficechicago illinois |
| Characters: | bullyteacherteenage boyteenage girlteenagerstudentteacher student relationshipself discoveryself esteemself acceptance |
| Period: | 1980s |
| Story: | high school teacherpopular girlpopularityprincipalmakeoverlockergeekteen angstclassprincessbasketballkissdancingtitle spoken by characterthree word title …pantiessongfalling from heightbookrunningmarijuanaf wordgay slurjokewhite pantiesbrunettescantily clad femaleconfessionlibraryargumentvirginsuburbprankhigh school studentthreatobscene finger gestureredheadpot smokingrevelationelectronic music scoreragevirginityjanitorimaginationconfrontationdiscussionrejectionlaughterfrustrationlipstickone daylonerinsultabusive fatherjuvenile delinquentwrestlerpractical jokedirector cameoboredomsandwichpink pantiesearringpeer pressuremisfitadult actress playing teenage girlsuicidalhallwayjockhigh school girlsushiopposites attractriskdrug humordetentiontroubled teenconformityreference to john lennonantiherosingle set productionteenage angststudent athletehigh school boyschool lockerteenageteenage rebellionhiddenair ductdefiancekleptomaniabrat packcompulsive liarhiding under a tablehuis clossaturdaymusical sequence in non musical workexposed underwearreference to barry manilowview under tableadult actor playing teenage boydandruffshermer illinoiscult following (See All) |
She's All That is your typical high school prom king and queen story and the run in defending the star status in the upcoming election. High school hottie, Zack Siler is dumped by his prom-queen girlfriend, the equally attractive and extremely popular, Taylor Vaughan who fell for a second-hand world … reject TV soap star who she met over the spring break. Having been publicly dumped, Zack defends his discomposure by stating that Taylor is all make-up and wonder-bra and he can make any ordinary girl a prom queen with a similar package. His high-school buddy, Dean Sampson, engages him in a bet following this statement and picks the geeky looking Laney Boggs out of the crowd as the girl Zack must transform into the new prom queen. Zack agrees since he has no option, but as time passes and Laney begins to transform, Zack begins to find her attractive. While all that falls beautifully in place, it's not your typical fairy-tale. Throw in Dean Sampson to complicate the situation, as when he first made the bet he never thought that Zack could rise to the challenge but looking at how Laney has transformed, it looks like Zack could be on a winning streak. (Read More)
| Subgenre: | teen romanceteen moviefish out of watercult filmteen comedy |
| Themes: | friendshipdeceptionhumiliationrivalrybullyingfalling in love |
| Mood: | high schoolnightmare |
| Locations: | schoolbeachlos angeles california |
| Characters: | bullyteenagerfather son relationshipfather daughter relationshiptattoobrother sister relationshipself expression |
| Story: | locker roomeyebrowsugly ducklingcinderella storypopularitymakeoverteen angstqueenkissdancingtitle spoken by characterpartybikinivomiting …transformationpublic nudityloss of mothernerdjeepblack humorbreakupunderage drinkingmakeupyoung lovebetgraduationcafeteriamisfitvolleyballwagerpromjockhouse partychick flickperformance artopposites attractfast food restaurantjerkmodern artsoccer footballperformance artistart classhigh school dancetv starstudent athleteyearbookclown makeuppool cleanerbeeperwrong side of the tracksbeatboxingtrippingpygmalionmusical sequence in non musical workfemale rivalryspontaneous choreographyavante garde art (See All) |
It's the proverbial end of the summer 1962 in a small southern California town. It's the evening before best friends and recent high school graduates, Curt Henderson and Steve Bolander, are scheduled to leave town to head to college back east. Curt, who received a lucrative local scholarship, is see …n as the promise that their class holds. But Curt is having second thoughts about leaving what Steve basically sees as their dead end town. Curt's beliefs are strengthened when he spots an unknown beautiful blonde in a T-bird who mouths the words "I love you" to him. As Curt tries to find that blonde while trying to get away from a local gang who have him somewhat hostage, Curt may come to a decision about his immediate future. Outgoing class president Steve, on the other hand, wants to leave, despite meaning that he will leave girlfriend, head cheerleader and Curt's sister, Laurie Henderson, behind. Steve and Laurie spend the evening "negotiating" the state of their relationship. Meanwhile, two of their friends cruise around town for the evening. Steve has left his car to meek and mild-mannered Terry "Toad" Fields to look after during his absence. The wheels give Toad a new sense of confidence, which he uses to try and impress Debbie Dunham, a more experienced girl generally out of his league. And John Milner, who is seen as the king of the street race in his souped-up yellow deuce coupe, tries to get rid of precocious pre-teen, Carol Morrison, who has somehow become his passenger… (Read More)
| Subgenre: | teen movieindependent filmcult filmcoming of agesemi autobiographical |
| Themes: | first loveunrequited lovedatingdancefriendshipjealousyrobberyanger |
| Mood: | high schoolone night |
| Locations: | police carschoolcarmotorcyclesmall townairplaneairporturban settingschool dance |
| Characters: | police officerteenage boyteenage girlteenagerpoliceboyfriend girlfriend relationshipbrother sister relationshipgirllove triangleself discoveryself esteemdream girlself acceptance |
| Period: | 1960ssummeryear 1962 |
| Story: | popularityscootermakeoverlockergeekcrushteen angstclasscheerleadergymcar accidenttwo word titlefightdancingsinging …partysurprise endingpantiestelephone callsongunderwearfistfightblondepunched in the facewatching tvbookvomitingtearscar crashmarijuanacollegetelephonegangcaliforniadinerwhite pantiesbrunettescantily clad femaleradiogunshotvirginsuburbmini skirtprankconvertiblefemale removes her clotheshigh school studentautomobilethreatrock 'n' rollclass differencesrecord playergirl in pantiesnerdpot smokingrevelationwhat happened to epiloguecountry name in titlelistening to musicragevandalismblockbusterdriving a carforbidden lovevirginitymechanicjanitorunderage drinkingrejectionlove at first sightensemble castfrustrationlipstickyoung loveone daylonerjuvenile delinquentwrestlermusic bandreflectionsexual awakeningmultiple storylineboredomrobberstreet gangfirst datepink pantiesjukeboxearringboy with glassescrashpeer pressureradio stationmaking outtape recordinggeneration gapmooningreference to albert einsteinamericanahallwayhouse partydisc jockeycadillacreference to john f. kennedyroller skatesopposites attractcruisingdrug humorradio djliquor storeairlinercar salesmanconformitydance contestauto theftstreet racinghigh school danceantiheroslumber partydrag racingcableloss of innocenceauthoritypopsicleyearbooktelephone boxhoodlumschool lockerteenage rebelliond.j.yellow pantieshot rodshaving creamteen loveparty dressrebellious youthambiguous titlewrong side of the trackswild partyshy girltwist the dancelistening to the radioteen rebelreference to the lone rangersputnikgreaserhigh school sweetheartrecord collectiondrive in restaurantreference to the beach boyshigh school loveshot in sequencereference to buddy hollyhigh school yearbookexposed underwearmulti protagonistroadsterdandruffthunderbirdblack and white television1955 chevroletliquor store hold upreference to dick clark (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com