Please wait - finding best movies...
Scott Calvin has been Santa Claus for the past eight years, and his loyal elves consider him the best Santa ever. But Santa's got problems (he's even mysteriously losing weight) and things quickly go south when he finds out that his son, Charlie, has landed on this year's "naughty" list. Desperate t β¦o help his son, Scott heads back home, leaving a substitute Claus to watch over things at the Pole. But when the substitute institutes some strange redefinitions of naughty and nice, putting Christmas at risk, it's up to Scott to return with a new bag of magic to try to save Christmas. (Read More)
Themes: | mother naturedatingdivorcemagicweddingchristmas |
Mood: | high school |
Locations: | rooftopairplanesnowrestaurant |
Characters: | children |
Period: | christmas party |
Story: | son of santa claustoy soldiersaving christmaschristmas treehuman duplicationtooth extractiontooth fairysandmananimatroniceaster bunnyebayperiscopesonarcupidsnowball fight β¦fat suitsleighnorth poleweight lossradarsubterraneanpun in titlereindeerschool principalstepfatherelfabsent fathersonamerican footballwristwatchsanta claustoygraffitigiftprankmarriage proposalrobotsecond partsecretcharacter name in titlesequel (See All) |
Divorcee Scott Calvin is disgusted to learn that his ex and her husband have tried - and failed - to break it easy to their 6-year-old son Charlie that Santa isn't real. On Christmas Eve, Scott reads The Night Before Christmas... then receives an unexpected visitor on his roof. When he's startled by β¦ Scott's calling out and falls, the Santa impersonator disappears, leaving only an 8-reindeer sleigh and a suit with instructions to put it on if he's involved in an accident. Scott does, and is transported around the town dropping gifts through chimneys until he's taken to the North Pole and informed by a group who claim they're elves that he is now Santa. Charlie is proud of his dad's new job, though Scott's convinced it's a dream. Until his hair turns white, his beard refuses to stay shaved, he gains weight inexplicably, even for his sudden love of junk food... Now he's accepted it, there's just one problem: how to keep it secret from his disbelieving family? (Read More)
Themes: | magicrevengesurrealism |
Locations: | snowrestaurantschoolpolice stationchicago illinois |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipdoctorboypolice officerlawyerpsychiatristex husband ex wife relationshipstepfather stepson relationshippolice interview |
Story: | son of santa clauschristmas treefat suitsleighnorth polereindeerschool principalelfsonsanta claussecretrescuearrestletterbook β¦handcuffssoccertied to a chairjudgesuburbproduct placementreadingcourtdestinyshavingfireplaceflyinglawlifting someone into the airjail cellflatulenceteddy bearinnocenceobesityrowboatchristmas eveflamethrowerteleportationfirefighterthanksgivingbusiness cardcookiebeliefchild custodydivorced parentsjailbreakholiday seasontreadmillprecocious childcity hallsnowglobechristmas seasonadvertising executivechristmas daytoy traintoy makerhot chocolatefat jokesanta suitegg nogpet as giftgaining weighthair growthdog as giftword play in titlechristmas elfchild visitation rightsdenny's restaurantrenewed faith (See All) |
Buddy was a baby in an orphanage who stowed away in Santa's sack and ended up at the North Pole. Later, as an adult human who happened to be raised by elves, Santa allows him to go to New York City to find his birth father, Walter Hobbs. Hobbs, on Santa's naughty list for being a heartless jerk, had β¦ no idea that Buddy was even born. Buddy, meanwhile, experiences the delights of New York City (and human culture) as only an elf can. When Walter's relationship with Buddy interferes with his job, he is forced to reevaluate his priorities. (Read More)
Subgenre: | fish out of waterstop motion animation |
Themes: | christmaslovemoneydrinkingdrunkennessdeath of mother |
Mood: | breaking the fourth wall |
Locations: | snownew york cityschooltaxielevatoroffice |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipdoctorsingerbrother brother relationshipboygirlpolicemanbabyemployer employee relationship |
Period: | winter |
Story: | christmas treesnowball fightsleighnorth polereindeerelfsanta claustoycharacter name in titlefemale nuditynuditykissfightdancingphotograph β¦singingchaseshowertelephone callvoice over narrationsongunderwearfoodwatching tvdrinkbookvomitingliebedjailhallucinationclassroommanhattan new york cityreporterorphanmontageeatingtoiletnuncoffeeparkliarstorytellingpursuitclasstv newsfireplacefaintingbeardblockbusterteddy bearmilkbreakfastbossdwarfshoesticklinganimated sequenceanthropomorphic animalshopping mallchristmas eveice skatingcorporationfemale in showerholding handspresentcandydirector cameocentral park manhattan new york cityescalatorselfishnesstween girlnaivetywhisperingdepartment storecookiepaparazzimushroomtrollaltered version of studio logotomatofather son reunionsnowmanpolar bearanimated creditsman childspaghettifingerprintraccoonscreaming womanchristmas carolrevolving doorhappy birthdaysnowballgnomeempire state building manhattan new york citybreakdancingpeep showcrawlingblood testchildren's bookbelchjack in the boxtightsfrat packcorporate worldwalrusrocking horseburpingasparagusgumtoy makersouth poleradiatorchristmas cardchristmas spiritbaking cookiesbook publishercandy canereference to the mona lisawavingbook publishingchopping down a treeice floemailroomrockefeller center manhattan new york cityskippingauld lang synereference to dr. seusspuffinsyrupwindow displaybaby nurserycaught shopliftingbaritonepneumatic tubered underwearstorybook in opening shotdrinking on the jobetch a sketchcandy cornelf costumenarwhalsarcasm taken literallywomen's locker roomsanta's workshopproduct testingcobbler the shoemakercotton ballnaughty listpolice hunttoilet trainingchristmas elfshoe shiningstore windowcartoon puffinhanding out flyers (See All) |
During childhood, Fred Claus suffered his younger brother Nick's saintliness. Jump ahead: Fred is a fast-talking, genial but self-centered guy in Chicago looking for $50,000 to open an off-track-betting shop. When one scam goes awry, he calls Nick at the North Pole for a loan: Nick will give him the β¦ money only if Fred comes up to help a few days with the Christmas rush. After his girlfriend dumps him, Fred heads north. Santa's facing an audit from an efficiency expert, and it's not pleasant. Fred's job is to review charts and determine who's naughty and who's nice. Is there any fraternal feeling left, can either learn from the other, and what about Santa getting fired? (Read More)
Subgenre: | black comedyslapstick comedyfish out of water |
Themes: | magicchristmasjealousydeceptiondysfunctional family |
Locations: | snowbarlondon englandchicago illinois |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipdysfunctional relationship |
Period: | year 1993 |
Story: | christmas treesnowball fightsleighnorth polereindeerelfsanta clauscharacter name in titledogdancingchasearrestletterfoot chaseorphan β¦bound and gaggedmontageapologyanti herofactoryrace against timebodyguardglassesholidayactor playing himselfsabotagefireplacejail cellorphanagepromisebarefootpower outageimmortalitysibling rivalryslackerpassionate kisspuppydjnew jobcartoon on tvchristmas presentsydney australiabitternesscheering crowdworkshopbunk bedaltered version of studio logooverweightpost officestresssnowmanreference to bill clintonsledsnowballsnowglobefamily conflicttoy storeinterventiontalking to an animalcounselingdog sledparking ticketconveyor beltcape the garmentfrat packtoy trainsalvation armygood deedtower bridge londonred capehusky dogchristmas in dangerpaper shredderbirdhouseletter to santa clauspet birdmilk and cookiesparking attendantreference to the tooth fairyguided tourchristmas hatercity lightsne'er do wellreference to the easter bunnycomic characterpet as giftefficiency experthit with a snowballrubber stampunhappy lovedog as giftreference to alec baldwinreference to jerry garcia (See All) |
Arthur Christmas reveals the incredible, never-before seen answer to every child's question: 'So how does Santa deliver all those presents in one night?' The answer: Santa's exhilarating, ultra-high-tech operation hidden beneath the North Pole. But at the center of the film is a story about a family β¦ in a state of comic dysfunction and an unlikely hero, Arthur, with an urgent mission that must be completed before Christmas morning dawns. (Read More)
Subgenre: | cgi animation |
Themes: | christmasdysfunctional family |
Locations: | boatdesertbicyclemexico |
Story: | christmas treesleighnorth polereindeerelfsanta clauscharacter name in titlef ratedtitle directed by femalecomputerlettername in titlemapdinnerholiday β¦missilegrandfatherchristmas evelioncubafamily dinnerwishbonfirearrogancechristmas presenttoronto ontario canadaholiday in titleassistantmilitary basequarrelmailboxsunrisehigh techboard gameclumsinesschristmas giftnational parkresentmentidahotanzaniamishaphand heldletter to santa clauschristmas ornamentserengetirowing boatchristmas elfwheelie bin (See All) |
Jack Skellington, the pumpkin king of Halloween Town, is bored with doing the same thing every year for Halloween. One day he stumbles into Christmas Town, and is so taken with the idea of Christmas that he tries to get the resident bats, ghouls, and goblins of Halloween town to help him put on Chri β¦stmas instead of Halloween -- but alas, they can't get it quite right. (Read More)
Subgenre: | cult filmblack comedystop motionstop motion animationpuppet animationholiday horror |
Themes: | christmasghostmonstersupernatural powerunrequited love |
Locations: | woods |
Characters: | vampirewitchmayorghost dog |
Period: | 1990s |
Story: | saving christmaschristmas treeeaster bunnysleighreindeerelfdogfirecorpsefalling from heighthalloweenfour word titlesnakeno opening creditsgraveyard β¦dollskeletonwerewolfgothicmad scientistpresumed deadvisionpumpkinmummycartoon dogsplit personalityholiday in titlefamous scoremicroscopeguillotinejack o'lanternhorror for childrenhunchbacksnowglobemistrusttitle based on poemchristmas in dangerpumpkin headornamentevil toygarlandglowing eyehalloween songhollypet as gifttwo headed person (See All) |
Chris Brander has always been friends with Jamie Palamino, but now decides it is time to take his relationship to the next step. The problem is that Jamie still wants to be 'Just Friends'. When he runs away and moves to L.A., he becomes an attractive music manager, whom everyone wants. When his jet β¦catches fire and is forced to land, when flying to Paris with his newest singing sensation, Samantha James, he ends up back home. To his surprise, he encounters Jamie again, and sets out to be more than 'Just Friends' this time. (Read More)
Subgenre: | teen movieteen romanceteen comedy |
Themes: | christmaslovefriendshipcelebrityfalling in lovefirst love |
Mood: | high school |
Locations: | airplanesnowschoolchurchsmall townlos angeles california |
Characters: | friendbrother brother relationshipteenage boymusicianbest friendgay kissold friendbest friends |
Period: | christmas party1990s2000syear 1995 |
Story: | christmas treefat suitweight losssanta clausflashbackmasturbationkissfightsinginglesbian kisspantiescell phoneblondeface slapfalling from height β¦cafeguitarcleavageambulancejokewhite pantiesscantily clad femalepantyhosebartenderlatex gloveschampagnecheerleaderdategirl in pantiesholidaynerdinjuryhollywood californiamovie theatercrushwomanizerpop starstupiditymovie theatredentistnew jerseyrejectionshopping mallchristmas eveice skatingice hockeyarrogancefemale female kissgraduationtasermedical masksurgical masksuccessmini dressdental maskchangemale protagonistlip synchingchristmas lightshometownpancakemultiple time framesfrozen lakemale female friendshipmicrowavesongwritinggirl next doorrental carblonde stereotypeyounger brothertoothpastepin upteeth knocked outdental retainerchristmas cardhigh school crushmusic executivechristmas carollingfriend zonereference to the notebookface to faceten years (See All) |
Now that Santa/Scott Calvin and Mrs. Claus/Carol Calvin have the North Pole running smoothly, the Counsel of Legendary Figures has called an emergency meeting on Christmas Eve! The evil Jack Frost has been making trouble, looking to take over the holiday! So he launches a plan to sabotage the toy fa β¦ctory and compel Scott to invoke the little-known Escape Clause and wish he'd never become Santa! (Read More)
Themes: | christmaspregnancy |
Locations: | canada |
Characters: | husband wife relationshipcanadianex husband ex wife relationship |
Story: | son of santa clauspun in titlereindeersanta claustoycharacter name in titlesequelpresentin lawssnowboardsecret roomfalling off a roofsnowballsnowglobegingerbread house |
When an evil spirit known as Pitch lays down the gauntlet to take over the world, the immortal Guardians must join forces for the first time to protect the hopes, beliefs, and imaginations of children all over the world.
Subgenre: | cgi animation |
Themes: | memory |
Locations: | snownew york city |
Characters: | children |
Period: | winter |
Story: | tooth fairysandmaneaster bunnysnowball fightsanta clausbased on bookdreamlegendscene during end creditsmoonholidayicefairybeliefglobe β¦toothsledbunnyinaugurationboogeymansaint petersburgeaster eggeaster egg huntjack frostchristmas elfice cracking (See All) |
Six years have elapsed since Guantanemo Bay, leaving Harold and Kumar estranged from one another with very different families, friends and lives. But when Kumar arrives on Harold's doorstep during the holiday season with a mysterious package in hand, he inadvertently burns down Harold's father-in-la β¦w's beloved Christmas tree. To fix the problem, Harold and Kumar embark on a mission through New York City to find the perfect Christmas tree, once again stumbling into trouble at every single turn. (Read More)
Subgenre: | black comedy |
Themes: | christmasmarriagedrugsnear death experience |
Locations: | new york citycity |
Characters: | father daughter relationshiptattoojewishgay kissasian americanfatherrussian mafiaself referential |
Period: | christmas party |
Story: | christmas treesleighreindeersanta clauscharacter name in titlesequelnumber in titlefemale frontal nuditymale frontal nuditymasturbationsex scenepistolfirepunctuation in titledigit in title β¦car accidentshot in the headshotgunpunched in the facebeerlingeriemarijuanahallucinationreference to jesus christnew yorkthroat slittingcocaineexploding carscantily clad femalethird parttreecharacter repeating someone else's dialoguefantasy sequencemissionmassagekicked in the facecharacter says i love yousubtitled scenefreeze frameholidayampersand in titleactor playing himselfloss of virginityslow motionparking garageinterracial friendshipbuddyunderage drinkinganimated sequence3 dimensionalchristmas eveheavenbody landing on a carpipe smokingdrugged drinktorso cut in halfmale objectificationbongcannabishiding in a closetvulgarityinterracial marriageholiday in titleecstasymale protagonistreference to twittercrack cocainedrug humorracial stereotypeholiday seasonfinger gununwed pregnancypretending to be gayfake commercialchristmas movie3 dkorean americandrinking gametied to a poleukrainianman versus machineobscene gesturetoy robotbeer pong3d sequel to 2d filmtied togetherguantanamo bayflashback sequencemall santadress rehearsalwaffleman wearing underwear in publicreference to ryan goslingmysterious packagesacrilegious symbolismwhite castlereference to the notebookblowing smoke ringthrowing an egg (See All) |
Meet Howard Langston, a salesman for a mattress company is constantly busy at his job, and he also constantly disappoints his son, after he misses his son's karate exposition, he tries hard to come up with a way to make it up to him, this is when his son tells Howard that he wants for Christmas is a β¦n action figure of his son's television hero, Turbo Man. Unfortunately for Howard, it is Christmas Eve, and every store is sold out of Turbo Man figures, now Howard must travel all over town and compete with everybody else including a mail man named Myron to find a Turbo Man action figure, and to make it to the Wintertainment parade which will feature Turbo Man. (Read More)
Subgenre: | martial artssuperheroslapstick |
Themes: | christmasherotheftyouth |
Locations: | motorcyclepolice car |
Characters: | husband wife relationshipfather son relationshipafrican americanpolice officerpolicemantough guysingle father |
Period: | 1990s |
Story: | christmas treereindeersonwristwatchsanta claustoygiftfightexplosionchasefirewatching tvbrawlfalling from heightshowdown β¦beerbombrunningneighbortelephonefoot chaseambushdinersearchcoffeecostumekaratemartial artistcontestglassesprofanityfireplaceflyingwarehousecopquestcaucasianparadepromisedwarfshoppingshopping mallraidkarate choplaughingphoneswearingcrowdlaser gunsurprise after end creditskarate kickdjpresentchristmas presentmallradio stationcookieconsumerismtow truckflamerunbadgepostmanmailmanbagminnesotaticketstory tellingradio djyoung boypayphonefire alarmlaughcomic violenceaction figurebeer bottlebustpolice badgemild violencemartial arts schoolplaying against typeflamestelling a storyspeeding ticketcup of coffeecandy canespilled coffeemail carrieregg nogspilling coffeeoutfitrusheggnogfather disappoints childkarate classletter bombwife husband relationshipcoffee spillfather saves sonwoman laughingman laughing (See All) |
Inside a snowflake exists the magical land of Whoville. In Whoville, live the Whos, an almost mutated sort of munchkinlike people. All the Whos love Christmas, yet just outside of their beloved Whoville lives the Grinch. The Grinch is a nasty creature that hates Christmas, and plots to steal it away β¦ from the Whos which he equally abhors. Yet a small child, Cindy Lou Who, decides to try befriend the Grinch. (Read More)
Subgenre: | cult film |
Themes: | christmaslovesurrealismmonsterdepressionredemption |
Mood: | affection |
Locations: | villageusa |
Characters: | girlthieflittle girlnew love |
Period: | christmas party2000s |
Story: | christmas treesleighsanta clauscharacter name in titledogsingingremakeexploding carcreatureholidayfarcelifting someone into the airblockbusterhomecelebration β¦reverse footageswitchbladepublic humiliationholding handsnarratorbroken heartreclusehermitbased on children's bookx rayed skeletonmaterialismvillain turns goodchildhood sweetheartchristmas decorationsfeasthome alonelifting a female into the airbraided hairtrailer narrated by percy rodriguezchristmas in dangersanta costumesnowflakecongamagical landburning treeimaginary creatureimaginary landkey partydr. seuss' how the grinch stole christmassmall child (See All) |
In London, Iris Simpkins writes a wedding column in a newspaper and nurtures an unrequited love for her colleague Jasper Bloom. Near Christmas, she is informed that Jasper is engaged to marry another colleague, and her life turns upside down. In Los Angeles, the movie-trailers maker Amanda Woods has β¦ just split with her unfaithful boyfriend Ethan and wants to forget him. Through a house exchange website, Amanda impulsively swaps her mansion for Iris' cottage in Surrey for the holidays. While in Surrey, Amanda meets Iris' brother and book editor Graham and they fall in love with each other. Meanwhile, Iris meets her new next door neighbor the ninety year old screenplay writer Arthur, who helps her retrieve her self-esteem, and the film composer Miles, with whom she falls in love. (Read More)
Subgenre: | fish out of water |
Themes: | weddingchristmasdrunkennessunrequited love |
Locations: | airplanesnowrestaurantbarswimming poolcarlos angeles californiabathtublondon englandairport |
Characters: | childrenfather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipsister sister relationshipjewishbest friendcheating girlfriendself esteem |
Period: | christmas party |
Story: | christmas treegiftf rateddogsex scenetelephone callcryingcell phonetitle directed by femaleunderwearmaskbooktearsrunningbed β¦alcoholswimmingbedroomwineold mancaliforniamansionhouseinternetdrivingwidowervacationtentspeechlaptoppublifting someone into the aircomposernew year's evecrying mancameobreakuplove at first sightstairsscreenwriterbalconypresentvideo storeeditorcottagepalm treealtered version of studio logomercedes benzenglishmansushidivorced parentscheating boyfriendscrewballluggagenew year's eve partyenglishwomanfemale underwearwalkerairport securityhanukkahfilm composerhollywood boulevardslamming a doorenglish countrysideimpulsivenessbook editortrailer narrated by hal douglaspublic houseworking womendvd playerenglish villagehouse swapsurrey england (See All) |
Anna, a fearless optimist, sets off on an epic journey - teaming up with rugged mountain man Kristoff and his loyal reindeer Sven - to find her sister Elsa, whose icy powers have trapped the kingdom of Arendelle in eternal winter. Encountering Everest-like conditions, mystical trolls and a hilarious β¦ snowman named Olaf, Anna and Kristoff battle the elements in a race to save the kingdom. From the outside Anna's sister, Elsa looks poised, regal and reserved, but in reality, she lives in fear as she wrestles with a mighty secret-she was born with the power to create ice and snow. It's a beautiful ability, but also extremely dangerous. Haunted by the moment her magic nearly killed her younger sister Anna, Elsa has isolated herself, spending every waking minute trying to suppress her growing powers. Her mounting emotions trigger the magic, accidentally setting off an eternal winter that she can't stop. She fears she's becoming a monster and that no one, not even her sister, can help her. (Read More)
Subgenre: | cult filmfairy talecomputer animationcgi animation3d animationdisneybased on fairy taledisney animated cgi musicaldisney animated cgi musical film |
Themes: | magiclovefriendshipbetrayalmonsterdeceptionsupernatural powercourageself sacrificenear death experiencecheating death |
Locations: | snowwoodscastlestorm at sea |
Characters: | female protagonistgirlsister sister relationship |
Period: | winter |
Story: | sleighreindeermarriage proposalsecretf ratedone word titletitle spoken by charactersingingtitle directed by femalebookorphanmountainfalse accusationnarrationjourney β¦princesscursehorse ridingisolationfirst partsacrificequeenprincesistericetraitorwolfheroinebarnblockbusterfateanthropomorphism3 dimensionaldespairscene after end creditscartoondungeonshadowcliffkingdomsurprise after end creditslighthousehappy endingstoretriple f ratedglovesshipwrecktreasoncomic relieftrue lovefalling into waterinfatuationhand over mouthcabin in the woodsfemale herotrollsawdisembodied headfamous scoreorchestral music scorebechdel test passedsnowmancoldcarrotdeath of parentsdelivery manbased on children's bookvillain arrestedwater fountainballroom dancingmagical powerlassosuit of armorshopkeeperx mencoronationlooking through a keyholetroubled productionhans christian andersenaurora borealiswolf packwoman directormountain climberfrozen alivesiblings living togetherice blockchained womandisney princessfjordwoodsmansister lovetrading postmale antagonistopening creditsno narrationpursued by wolvesvisual punanthropomorphic snowmandisney animated musical cinematic universedisney animated musical universesceptrebarqueburied in snowdeceiverhopeless romantic (See All) |
The Stone family unites in common cause when their favorite son brings his uptight girlfriend home for the Christmas holiday, with plans of proposing. Overwhelmed by the hostile reception, she begs her sister to join her for emotional support, triggering further complications.
Themes: | datingchristmasdrunkennessdysfunctional familycanceradoptioncrueltygay adoption |
Locations: | kitchen |
Characters: | family relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipfemale protagonistsister sister relationshipinterracial relationshipgay fatherdeafness |
Story: | christmas treesonmarriage proposalsecretcharacter name in titlef ratedbare chested malephotographthree word titlewritten by directorcar crashambulancewomandinnerring β¦gay coupleterminal illnessfarcegay parentinterracial romancetensionbreakupwedding ringinsultsign languagehomecomingsenior citizenselfishnessadopted songay brotherinterracial coupleinterracial adoptionman wearing towelbrother in lawniecerudenessintrovertdisrespectcharadeswreathdeaf parentdefensiveness (See All) |
While Gru, the ex-supervillain is adjusting to family life and an attempted honest living in the jam business, a secret Arctic laboratory is stolen. The Anti-Villain League decides it needs an insider's help and recruits Gru in the investigation. Together with the eccentric AVL agent, Lucy Wilde, Gr β¦u concludes that his prime suspect is the presumed dead supervillain, El Macho, whose his teenage son is also making the moves on his eldest daughter, Margo. Seemingly blinded by his overprotectiveness of his children and his growing mutual attraction to Lucy, Gru seems on the wrong track even as his minions are being quietly kidnapped en masse for some malevolent purpose. (Read More)
Subgenre: | computer animationcgi animation |
Themes: | datingwedding |
Locations: | restaurantmotorcyclesinging in a car |
Characters: | childrenfather daughter relationshipsingle father |
Period: | 1990s2010s20th century21st century |
Story: | sonsecond partsecretsequelthree word titlecatspyanti herocharacter's point of view camera shotwiglaptopchickencross dressingsharkpet dog β¦3 dimensionaldynamitevolcanomutationflamethrowerwilhelm screamrocketvacuum cleanerwatchlavaelectric shockkiss on the lipsbakeryfall from heighteaglesaving the worldclimbing a treebeltrattlesnakekicking in a doorjujitsuhunchback555 phone numberwedding cakepancakeboy girl relationshipantidotefire alarmstun guncupcakekrav magatranquilizer dartoverprotective fatherminionrussian accentstarfishgarbage bininvented languagearctic circlejellygreen eyeswifibrown eyesundercover spytalking through doorwoman agentguacamoleshock wavecovered in paintgrey eyestrash binpainting someone's bodyfreeze ray (See All) |
Ethan (Joseph Gordon-Levitt), Isaac (Seth Rogen) and Chris (Anthony Mackie) have been friends since childhood, and for a decade, their yearly Christmas Eve reunion has been an annual night of debauchery and hilarity. Now that they're entering adulthood, the tradition is coming to an end, and to make β¦ it as memorable as possible, they set out to find the Nutcracka Ball - the Holy Grail of Christmas parties. (Read More)
Themes: | christmasfriendshipdrugsdrunkennesscelebrity |
Locations: | hospitalnew york citychurchcitystrip clubsex in a bathroom |
Characters: | husband wife relationshipmother son relationshipbabythiefjewishpregnant wifebest friends |
Period: | christmas partyyear 2001year 2008year 2015 |
Story: | sleighelfsanta clausmarriage proposalsexfemale nuditynuditymale nudityfemale frontal nudityflashbackmale frontal nuditymale rear nuditysex sceneinterracial sex β¦nipplessingingthree word titleerectionvoice over narrationcell phoneslow motion scenepunched in the facewritten by directorvomitingcar crashmarijuanahallucinationmanhattan new york cityfoot chasenew yorkdrug dealercocainesubwayno opening creditslimousinefantasy sequenceproduct placementangelreuniondie hard scenariofreeze frametraditionslow motionnosebleedcameofootball playerchristmas evefull frontal male nuditymarijuana jointstabbed in the handvomitmale friendshipecstasydeath of parentsticketsweatersanta claus suitchristmas seasonlimousine drivercellphone videosteroidsholy grailmagic mushroomkaraoke barhanukkaherect penisjumping off a roofreference to instagramwrecking ballchristmas musicchildhood friendsreference to julia robertsrockefeller center manhattan new york citychristmas traditionopening creditssex in public bathroom (See All) |
Jack Frost is a singer who's on the road most of the time so he can't spend a lot of time with his son Charlie, although they love each other very much. When Jack dies in a car accident, Charlie becomes a very sad young man, until... Jack returns as a snowman! Now they can do all the things they've β¦missed when Jack was human, but what will people think when they see Charlie talking to a snowman and what will happen when the weather gets warmer? (Read More)
Themes: | magicchristmasfriendshipsurrealism |
Locations: | snow |
Characters: | husband wife relationshipfather son relationshipfriendsingerboymusicianbest friendbully |
Story: | snowball fightsonsecretcharacter name in titledogcryingcar accidentremakewatching tvbandmountainloss of fatherspiritloss of friendfestival β¦promisereincarnationconfrontationchristmas eveenglishice hockeyloss of husbandalienationbully comeuppanceharmonicacoloradodenialblizzardkindnessheatsnowmanrock musiciansnowboardice rinkworkaholicanimal in cast creditssledice cream truckwish fulfillmentdenver coloradoaudio flashbackschoolyard fightbroken promisesnowplowanthropomorphic snowman (See All) |
Set in futuristic Metro City, Astro Boy is about a young robot with incredible powers created by a brilliant scientist in the image of the son he has lost. Unable to fulfill the grieving man's expectations, our hero embarks on a journey in search of acceptance, experiencing betrayal and a netherworl β¦d of robot gladiators, before he returns to save Metro City and reconcile with the father who had rejected him. (Read More)
Subgenre: | coming of agesuperherocomputer animationslapstick comedyfuturisticcgi animationchrist allegory |
Themes: | betrayalpoliticsescapemonsterdeceptionmilitarysupernatural powerhopecourageself sacrificenear death experienceartificial intelligenceunlikely heroutopiarobotics |
Mood: | high schoolpoetic justice |
Locations: | rooftopairplanetaxitaxi driverlaboratoryfuture city |
Characters: | father son relationshipteenagerteenage girlteenage boysoldierwarrioraction heroprofessorsingle fatherengineer |
Period: | future |
Story: | sonmarriage proposalrobotsecretcharacter name in titletwo word titlebare chested maletitle spoken by characterexplosionchasesurprise endingcell phonebeatingmachine guncar accident β¦rescuewritten by directorbattlearrestfalling from heightshowdownheld at gunpointcar crashsciencecombatscientistsubjective cameradecapitationgood versus evilorphanbased on comic bookambushaxemountainmontagearmyexploding carsevered headno opening creditschild in perildouble crosscreaturetransformationon the runone against manybased on tv serieselectrocutionbased on mangafugitivecharacter's point of view camera shotevil manknocked outdeath of childpresidenthigh school studentexploding bodydeath of sonelectionsevered armgeneralsingle parentpizzachainsawmissiledestinyteen angstdestructionrevelationflyingloss of loved oneexploding buildinggiantservantpress conferencejumping from heightlasercompassioncrushed to deathsocial commentaryback from the deadandroidcannonpresumed deadfull moonrampagestealing a carbraverycrossbowcynicismfight to the deathloss of soninventormanhuntpower outage3 dimensionalresurrectionevacuationbutler3dhologramcapturelonerstadiumdeath of loved oneflamethrowerwilhelm screamtracking devicesatelliteheroismgiant robotfinal showdownoutcastpickpockettaserhigh school teacherjunkyardsuper strengthgiant monstergolf clubdronecomic reliefskyscraperidealismbased on cartoon13 year oldshot in the eyecrash landingarenabaseball capcrashing through a windowloss of childilliteracycorrupt politicianbased on animefinal battletrampolineexperiment gone wrongfeatherhigh techopen endedrepeated linegladiatorfreedom fighterspray paintforce fieldvillain arrestedx rayed skeletonfictional citydeoxyribonucleic acidkiller robotbanishmentstun gunsuper speedintegrityorigin of heroflying carcollapsing buildingleonardo da vincicircular sawgiant creatureorbteenage superherooutrunning explosionelectromagnetic pulsespherefighting in the airhome schoolingrobot as menacerobot as pathosboy geniusfuturistic citydeathmatchflying robotrobot dogscience classx ray visioncrushed carsecret hideoutelectromagnetismstashabsorbing powerfuturistic trainsight gagfloating citysuper hearingcharacter shaped hole (See All) |
Derek Thompson is 'The Tooth Fairy,' a hard-charging minor league hockey player whose nickname comes from his habit of separating opposing players from their bicuspids. When Derek discourages a youngster's hopes, he's sentenced to one week's hard labor as a real tooth fairy, complete with the requis β¦ite tutu, wings and magic wand. At first, Derek "can't handle the tooth" - bumbling and stumbling as he tries to furtively wing his way through strangers' homes...doing what tooth fairies do. But as Derek slowly adapts to his new position, he begins to rediscover his own forgotten dreams (Read More)
Themes: | magicredemptionrivalry |
Characters: | mother son relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage boylittle girlsingle motherinterracial relationship |
Story: | tooth fairymarriage proposalcharacter name in titletwo word titlebare chested malecatjailguitarrock bandman with glassesno opening creditsscene during end creditshuggingathleteflying β¦guitaristmale bondinginterracial romancenicknamefairydrummerice hockeywilhelm screamhockeydrumsinvisibilityguitar playingelectric guitarbelieftalent showanimated creditswingstoothminiaturizationman boy relationshipshrinkingaspiring musiciantalent contesthockey playerdrummingstuffed toytennis ballnickname as titleerased memorywandtooth knocked outjumping off a balconyice hockey playerhockey pucksummonsice hockey teamsmashing guitarone dollar billbroken toothdirect tvpermitadult child bondingfairy dust (See All) |
At the age of 21, Tim Lake (Domhnall Gleeson) discovers he can travel in time... The night after another unsatisfactory New Year party, Tim's father (Bill Nighy) tells his son that the men in his family have always had the ability to travel through time. Tim can't change history, but he can change w β¦hat happens and has happened in his own life-so he decides to make his world a better place...by getting a girlfriend. Sadly, that turns out not to be as easy as you might think. Moving from the Cornwall coast to London to train as a lawyer, Tim finally meets the beautiful but insecure Mary (Rachel McAdams). They fall in love, then an unfortunate time-travel incident means he's never met her at all. So they meet for the first time again-and again-but finally, after a lot of cunning time-traveling, he wins her heart. Tim then uses his power to create the perfect romantic proposal, to save his wedding from the worst best-man speeches, to save his best friend from professional disaster and to get his pregnant wife to the hospital in time for the birth of their daughter, despite a nasty traffic jam outside Abbey Road. But as his unusual life progresses, Tim finds out that his unique gift can't save him from the sorrows and ups and downs that affect all families, everywhere. There are great limits to what time travel can achieve, and it can be dangerous too. (Read More)
Subgenre: | coming of ageblack comedytime travel comedy |
Themes: | weddingchristmasfriendshipmarriagepregnancydrunkennessfuneralsupernatural powertime travelcancerhope |
Mood: | bittersweet |
Locations: | restauranthospitalbeachlondon englandengland |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipactorpriestlawyeralcoholicuncle nephew relationshipamerican abroad β¦uncle niece relationshippregnant wifeamerican in the uk (See All) |
Period: | 2000s2010s |
Story: | songiftmarriage proposalsecretflashbackkissdancingphotographpartysurprise endingvoice over narrationcell phonecar accidentslow motion scenewritten by director β¦bikinibirthdaycar crashbritishf wordsubjective cameragay slurmontagesubwaytrialno opening creditscoffinbirthday partycharacter repeating someone else's dialoguecharacter's point of view camera shotcourtpremarital sexredheadterminal illnessloss of virginityreference to adolf hitlerheavy raineccentricnew year's evetennisart galleryviolinbarefootnicknamelove at first sighttime lapse photographyalzheimer's diseaseraised middle fingerlingerie slipmoral dilemmaunclesubway stationyoung version of characterplaywrightstage playgreenhousewoman in bra and pantiesbeach housemanuscriptcountdowntime loopexpectant motheralternate timelineexpectant fatherreference to charles dickenstable tennisamerican womanlondon undergroundlesbian slurmaternity wardpregnant bridetime travel romancetrapped in a time loopbutterfly effectreaderalternate futurereference to kate mossaltering the future (See All) |
Kevin McCallister is back. But this time he's in New York City with enough cash and credit cards to turn the Big Apple into his very own playground. But Kevin won't be alone for long. The notorious Wet Bandits, Harry and Marv, still smarting from their last encounter with Kevin, are bound for New Yo β¦rk too, plotting a huge holiday heist! Kevin's ready to welcome them with more battery of booby traps the bumbling bandits will never forget! (Read More)
Subgenre: | cult filmslapstick comedy |
Themes: | christmasfriendshiprevengesurrealismfearescapememoryrobberyhome invasionhomelessnessmissing child |
Mood: | rainnightbreaking the fourth wall |
Locations: | rooftopairplanehospitalnew york cityswimming poolhoteltaxiairportelevatorurban settingpolice stationpolice carcitytaxi driver |
Characters: | family relationshipshusband wife relationshippolicemother son relationshipbrother brother relationshipboybrother sister relationshippolice officerlittle boymaidboy hero |
Period: | 1990swinter |
Story: | christmas treetoygiftsecond partsequelnumber in titlegunphotographchaseshowertelephone callfiredigit in titlerescueslow motion scene β¦arrestfalling from heightplace name in titlenumbered sequelmanhattan new york citytelevisioncriminaltelephonesubjective cameranew yorkconcertcolon in titlefishapologybirdparklimousinetreehotel roomperson on fireelectrocutionpay phoneproduct placementvacationscreamskeletoncity name in titlepigtrapfireworkspizzaholidayropehuggingflyingtape recorderlifting someone into the airblockbusterfloridaladderorchestraremote controlburglarvisionseven word titleburglarychild protagonistpower outagemiami floridachristmas evebooby trapatticbody landing on a carroomsequel to cult favoriteworld trade center manhattan new york citypigeonuncleabandoned buildingcartoon on tvcentral park manhattan new york citysecond in seriessenior citizenbrooklyn bridgevacuum cleanercoca colacredit cardreference to donald trumpunsubtitled foreign languagemale protagonistchewing gumtimes square manhattan new york cityjumping into waterroof10 year oldstaffdoveprecocious childrevolving doorice rinkphysical comedydeja vuchristmas giftchristmas movienail gunwish fulfillmentwoman punches a mannumber 2 in titlehotel managerhome alonehomeless womanlost childtoy storechild heromother son reuniontwin towersroom serviceluxury hotelchristmas decorationlifting a male into the airbird attackchildren's choirjumping into a swimming poolmovie reality crossovercredit card fraudhead in a toiletcarnegie hall manhattan new york citymemory lapsekid outsmarts adultblurry visioncartoon reality crossovergreen slimehit with a brickmischievous childrockefeller center manhattan new york cityreference to donald duckmale antagonisttownhousebrick thrown through a windowhitting one's headplaza hotel manhattan new york cityvoice recorderwoman punches manchristmas with familycriminal duohotel guestwoman slaps man in the facehit on the head with a bricki cross my heart and hope to dieschool concertskeleton visible during electrocutionfalling brickforgetting namehotel bellmanscreaming boy (See All) |
SON OF RAMBOW is the name of the home movie made by two little boys with a big video camera and even bigger ambitions. Set on a long English summer in the early '80s, SON OF RAMBOW is a comedy about friendship, faith and the tough business of growing up. We see the story through the eyes of Will, th β¦e eldest son of a fatherless Plymouth Brethren family. The Brethren regard themselves as God's 'chosen ones' and their strict moral code means that Will has never been allowed to mix with the other 'worldlies,' listen to music or watch TV, until he finds himself caught up in the extraordinary world of Lee Carter, the school terror and maker of bizarre home movies. Carter exposes Will to a pirate copy of Rambo: First Blood and from that moment Will's mind is blown wide open and he's easily convinced to be the stuntman in Lee Carters' diabolical home movie. Will's imaginative little brain is not only given chance to flourish in the world of film making, but is also very handy when it comes to dreaming up elaborate schemes to keep his partnership with Lee Carter a secret from the Brethren community. Will and Carter's complete disregard for consequences and innocent ambition means that the process of making their film is a glorious roller-coaster that eventually leads to true friendship. They start to make a name for themselves at school as movie makers but when popularity descends on them in the form of the Pied Piper-esque French exchange student, Didier Revol, their unique friendshiβ¦ (Read More)
Subgenre: | independent filmcoming of ageslapstick comedy |
Themes: | friendshipsurrealismreligiontorturefilmmakingtheftbullyingchildhoodreligious upbringing |
Mood: | nightmare |
Locations: | restauranthospitalschoolchurchforestsmall townbusbicyclewoodswheelchairenglandlake |
Characters: | family relationshipsfather son relationshippolicemother son relationshipmother daughter relationshipfriendbrother brother relationshipboybrother sister relationshipteachergirlnursedanceractorthief β¦artistchristianbullysingle motherbiblefrenchgrandmother grandson relationshipwriter directorreligious sectchildren in love (See All) |
Period: | 1980s |
Story: | absent fathersonwristwatchgraffitigiftpranksecretviolenceflashbackdoggunkissfightcigarette smokingdancing β¦title spoken by characterpartychasethree word titlecryingdreamfoodrescuewatching tvwritten by directorbookvomitinglietearssunglassesrunningcafebathroomhallucinationclassroomprayerrivercookingcandlevideo cameraambulanceeatingwidowtoiletapologyno opening creditsdrawingchild in perilunderwater scenedrowningliarumbrellastatuereadingconvertiblepursuitwigfilm within a filmclasscowsubtitled scenerecord playerrunawaysupermarketinjuryhelmetrecordingmousemale bondingmovie starvideotapevisitskateboardbroken legmovie theatregrocery storeimaginationshopliftingbraverycrossbowmobile phonedrummertheatre audiencemedical examinationscissorsoilschool uniformfriendship between boysclassmatearrowalarm clocksurprise after end creditsprayingcandyboredompickpocketrunning awaydead fathercrutchesalarmdrumgoldfishstuntworkshopkitescarecrowhallwaynursing homegurneyclimbing a treehome videoprivate schoolcamouflageintentionally misspelled titlestuntmanrescue from drowningtoy gunvisitorabsent motherphonographwater fountainmovie fannecktiewater hosefrench accentbuilding collapserole modelheadbandsodabubble gumhead scarfexchange studentcatapulttoilet stallmovie premierepower plantschool lockerold people's homescreen testchild driving a carpiggy bankgood samaritanreference to ramboentouragestitchfishbowltarforeign exchange studentinjured childanimated sceneaneurysmleg in castblood oathflip bookswinging on a ropetool shedblood brothersholding a gun to one's own headyoung filmmakerjumping into a riverabsent parentshit on the head with a ballamateur filmmakingfundamentalist religionguide dogplaying hookynose bandageboy smoking a cigarettescabtalking through a windowbicycle lockpineconestocking feetfake tattooimitating someonejumping from a treelow techprayer meetingschool tiemuscle suitflying dogsliding down a hill (See All) |
Mr. Cedric Brown has just lost his wife and is now left with his seven children who misbehave so much that all the nannies have run away. Now he is told by a mysterious voice that he should get Nanny McPhee who is a magical woman with special powers.
Themes: | magicweddingadoption |
Locations: | snowkitchen |
Characters: | childrenfamily relationshipsbabybullymaidwitchfathersingle father |
Period: | 19th century1800s |
Story: | prankmarriage proposalcharacter name in titlef ratedbased on noveltwo word titletitle spoken by charactervoice over narrationcorpsechildwidowerfirst of seriespigfirst parttea β¦lifting someone into the airoverallsspiderfrogcanenannyspellauntdonkeywedding ceremonystepmotherboy with glasseselectric shockfemale herokitefood fightwedding cakemorticiantarantulagovernesswalking stickmaster servant relationshiplifting a female into the airfake illnesstrailer narrated by hal douglascake in the facechild rearingmagical staffunruly childrenempty chairmerry undertaker (See All) |
A chance encounter between a travelling salesman and a lonely hitman triggers a strangely profound relationship which provokes each to act in ways neither would have imagined possible. Fate steps in to form a friendship between two men from irreconcilable worlds that will alter the lives of both for β¦ever. (Read More)
Themes: | christmasmurderdeathfriendshipmoneydrinkingdrunkennesstravelparanoiadeath of wife |
Mood: | high schoolrainparody |
Locations: | rooftopairplanesnowrestaurantbarchurchswimming poolhotelcarcemeterynightclubtaxiairportkitchenmexico β¦stormschool buscar bombsex in kitchenmexico citybus accidenthotel bar (See All) |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfriendboyteenage girlprostitutedancermusicianhitmansecurity guardsniper rifleself doubtmurder for hire |
Story: | christmas treeeaster bunnyamerican footballsexbloodflashbackdoggunkisscigarette smokingdancingphotographexplosionknife β¦showertelephone callfirecryingcell phoneunderwearcar accidentmirrorurinationslow motion scenewatching tvcomputerdrinkcondomswordlieriflebeersunglassesbombbirthdaycafebathroomhallucinationspybisexualnewspaperassassincandlebandold manexploding carapologyman with glassesradioassassinationunderwater scenegraveyardcigar smokingcoffeebartenderflash forwardparktreehotel roombusinessmanliarstorytellingsuitcaseringbusinessbodyguardcheerleaderdeath of songlassesschoolgirllas vegas nevadaobscene finger gesturekillingrecord playereyeglasseshuggingfireplacebulletballoonfriendship between menswimsuitstrangervictimsharkladderviolinhonorbosscamera shot of feetwhiskeyrear entry sextelescopethundersex talkgreececigarette lighterthunderstormschool uniformdead childarizonasalesmantitle at the endmustachesnowingcanebriefcasenervous breakdownstadiumjobbenchalarm clockpigeonweatherviolinistmoscow russiaphilippinesinterrupted sexdonkeyfire extinguisherfountainmen's bathroomsydney australiamarketstreet marketfruitrestroomcheering crowdflaskretirement homecoloradoaustriavienna austriaballerinagiving a toastbusiness cardcellohungarybullsex clubporscheluckmadrid spaincathedralfailureportugalsitting on a toiletwashing machineoverhead camera shotfeethorse racechance meetingchristmas lightsspeedococktaillockracetrackticketcellistballet dancerstairwellbullfightingchristmas decorationsmanila philippinesone last jobhappy birthdaymortgagepenis jokebisexual manbudapest hungarynail polishwhorehousetelling a jokerendezvousfatal accidentbusiness tripplaying chessvisiting a gravehelium balloonhotel lobbyerectile dysfunctionminneapolis minnesotaroom servicedance studiodenver coloradochristmas decorationmelontraveling salesmansex on a tablewalking canematadorfootsombrerotucson arizonamen's toiletlaundry roombullfightfalling treesuntan lotionmargaritareading newspaperbellboyballet classblood pressureoutdoor cafepainting toenailsplaying celloopen air marketeyesighttown squarebullringworld travelred balloonsleepmaskburning a documentreflection in windowgun for hiregun sightman wearing briefsbomb victimearplugpainted toenailsreference to the easter bunnystubbleescape routeamarillo texasbreaking a lockguacamolepecan piesex on washing machinebrink of nervous breakdown (See All) |
Hugo is an orphan boy living in the walls of a train station in 1930s Paris. He learned to fix clocks and other gadgets from his father and uncle which he puts to use keeping the train station clocks running. The only thing that he has left that connects him to his dead father is an automaton (mecha β¦nical man) that doesn't work without a special key. Hugo needs to find the key to unlock the secret he believes it contains. On his adventures, he meets George Melies, a shopkeeper, who works in the train station, and his adventure-seeking god-daughter. Hugo finds that they have a surprising connection to his father and the automaton, and he discovers it unlocks some memories the old man has buried inside regarding his past. (Read More)
Subgenre: | steampunksilent moviesilent filmmakingfrench filmmakingdieselpunk |
Themes: | magicdeathlovefriendshipdrinkingdrunkennessescapefilmmakingmemoryangerlonelinessdeath of fatherobsessionpoetryphotography β¦theatrefalling in lovewritingdog in love (See All) |
Mood: | nightmarefilm history |
Locations: | snowrestauranttrainschoolcemeteryparis francebathtubfrancemuseum |
Characters: | husband wife relationshipfather son relationshippolicemother son relationshipfriendbrother brother relationshipboyteenage girlteenage boygirlpolice officerpolicemandancermusicianactor β¦photographerwriterthiefartistactresslittle girllittle boyfilmmakerfilm directorfrenchuncle nephew relationshipmermaid (See All) |
Period: | 1930s |
Story: | toy soldierwristwatchtoyrobotsecretcharacter name in titleone word titleflashbackdogdancingphotographexplosionchasetelephone callfire β¦voice over narrationcryingbased on bookdreamcorpserescueslow motion scenecatcameradrinkarrestbooktearsrunningdead bodycaferivertelephonesubjective camerafoot chasenewspaperorphanname in titleold manmontageno opening creditschilddrawingchild in perilbathsearchgraveyardtheatergravelibraryauthorprologuekeyuniformpassionstatuereadingscreampursuitsadnessstageworld war onecinemafloweractingpoettrustcircuspoemapplauseentertainmentbreaking and enteringcagefamehappinessmagicianhidingwatching a movietimeaudienceladderrailway stationorphanagefollowing someoneorchestraclockembarrassmentguardmovie theatregypsychild's point of viewinventorpet dog3 dimensionalwizardtheatre audiencemakeup3dlaughterfilm setdrunksketchbookstorecapturesnowingnotelanternbonfireholding handsmusic bandposterbeing followedsaving a lifeforename as titlemagic tricknotebookrunning awayeiffel tower parisspiral staircasefilm clipmachinefilm projectortween girlflaskshow businesspocket watchfallingtrain tracksindustryfilm studioashescollectorentertainercarpenterhiding placevaultcarousellimpcinematographercollectionenigmalobstermovie cameramerry go roundkiss on the cheekpenhouse fireapprenticeloudspeakerhookspotlightguard dogoverhead shotmovie posterwrenchcard tricktantrumboy girl relationshipspectatorreference to charlie chaplinmusetrain conductormausoleum3 dmovie projectordead brotherstreet kidshopkeeperoil lamptoy storeinkdead parentsgalasideshowsteamfake beardleg bracefire breathing dragonseine riverdobermanscavengerdreamerlooking through a keyholerepairmanclock towerdeath of uncletrain wreckscreenpastrypicking a locklarge format cameramementomagician's assistantlock picknewsstandpost world war onepresentationslidewar injurydachshundtoolscupboardeiffel towerauteurnotre dame cathedraljazz combobook sellernightshirtreference to london england3d glassesdestroying propertymagic actillustrationtrain derailmentrailroad trackshistory of cinemalong underwearreference to rudolph valentinowind up toyclimbing a wallcroissantwearing clothes in a bathtubfilm preservationmechanicalreference to jules vernetraveling circusclockworkfilm restorationautomatoncrankreference to buster keatoninnovatorfilm historianwicker basketdoberman pinschertrain enginereference to douglas fairbanksreference to harold lloydtrampledantiquariandream within a dream within a dreamlistening at a doorreelgodfather goddaughter relationshipsense of timearc de triomphebroken chaircelluloidclockmakerovationpurpose in lifereference to georges meliesarmoireflower selleryear 1895film academygearsreference to the lumiere brothersbass fiddlehand crankedoil canstanding on a chairwind upfootlightsmechanical dragonmechanical manreference to hal roachshoe heelsmelling a flower (See All) |
Ben Stiller returns as night watchman Larry Daily, now a successful business man, who gets back to the museum just in time to find that he needs to get his friends out of trouble. This new installment takes us to the Smithsonian, and introduces us to new characters, such as Amelia Earhart, General C β¦uster, and many more! (Read More)
Locations: | airplanenew york citymotorcyclemuseummuseum of natural history |
Characters: | nursewarriornative americansecurity guardvillain |
Period: | 1940s1930s |
Story: | toy soldiercupidsecond partsequelnumber in titleface slapmanhattan new york citypilotcowboyangelstatuescene during end creditsamerican flagmonkeywashington d.c. β¦imaginationblack and white scenesailorpassionate kissrocketsquirrelemperorsubmachine guntimes square manhattan new york citytyrannosaurus rexoctopuskangaroomotorcycle with a sidecarbird cageparallel worldblack and white segues into colorsicklecamel toehourglassstained glass windowastronomerbustshipping containerhdtvfrat packlisproman soldiersuspended animationarchivesmammothairplane pilotgiant squidnapoleon bonapartemuppettight pantswoolly mammothbobble head dolldinosaur fossilamelia earhartburied to the neckmanic pixie dream girltuskegee airmenlincoln memorial washington d.c.al caponewashington monument washington d.c.ivan the terrible (See All) |
Voldemort's power is growing stronger. He now has control over the Ministry of Magic and Hogwarts. Harry, Ron, and Hermione decide to finish Dumbledore's work and find the rest of the Horcruxes to defeat the Dark Lord. But little hope remains for the Trio, and the rest of the Wizarding World, so eve β¦rything they do must go as planned. (Read More)
Subgenre: | cult filmdark fantasyautobiography |
Themes: | magicweddingchristmasfriendshipfearracismcorruptionparanoiaprejudice |
Locations: | snowbeachtrainchurchforestmotorcyclecemeterylondon englandelevatorcaveschool of magic |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfriendboyfriend girlfriend relationship |
Period: | 1990syear 1997year 1998 |
Story: | subterraneansecretcharacter name in titlesequelbased on novelbloodflashbackbare chested malekissdancingchasesurprise endingfirecryingrescue β¦swordbookshowdownbirthdaycafedemonhallucinationgood versus evilsurvivalfoot chaseambushstabbed in the chestsnakeno opening creditsradiounderwater scenesearchold womanon the runlegendargumentcurseportraitprologueattackfugitivemissionmistaken identityrace against timetenttough girldisappearancehairy chestisolationpowerstrong female characterwerewolfloyaltyjail cellroman numeral in titledesperationstrong female leadmale underweartensionbraverymourningchaoswizardimmortalitycapturedark pastmeetingowlwedding receptionteleportationimprisonmentheroismtombdoppelgangerreturning character killed offhit in the faceold dark houseteenage loveassumed identityboy with glasseschandelierpotionaltered version of studio logopersecutionopen endedplaninfiltrationchosen oneforce fieldlocketteenage heroprotectionseventh parttragic villainswimming in underwearcult figuremagic wandruthlessnessfrozen lakesecrecybased on young adult novelfalling through icecliffhanger endinggrave robbingevil wizardwandloss of petcrusadecaught kissinghereditary gift of witchcraftbitten by a snakeartifactswerewolf biteimax versionnarrow escapebroomstickbildungsromanhobgoblinjumping into a lake (See All) |
John makes a Christmas miracle happen by bringing his one and only friend to life, his teddy bear. The two grow up together and John must then choose to stay with his girlfriend or keep his friendship with his crude and extremely inappropriate teddy bear, Ted.
Subgenre: | coming of ageblack comedyabsurdismslapstickslapstick comedy |
Themes: | magicweddingchristmasfriendshipkidnappingdrunkennessescapedancedeceptionabusehomophobiabreak up |
Mood: | car chase |
Locations: | snowrestaurantbarchurchhotelcarbathtubnightclubapartmentcityoffice |
Characters: | homosexualfriendboyfriend girlfriend relationshipsingerboyprostitutehostagegay kisssecurity guardhomosexualityemployer employee relationshipgay friend |
Period: | 1980s2010s80syear 2012year 1985 |
Story: | christmas treemarriage proposalcharacter name in titleone word titleflashbackmale rear nuditysex scenekissfightphotographtitle spoken by characterpartyknifechasesurprise ending β¦voice over narrationcell phonebeatingfistfightcar accidentblonderescueslow motion scenepunched in the facewatching tvwritten by directorbrawlbare buttfalling from heightpaintingbeercar crashmarijuanapianohallucinationf wordfoot chasegay slurconcertmontagefootballcocainebrunettenarrationritualspankingparksmokingstalkerfantasy sequenceproduct placementmoaninglightningstalkingfirst partthreatened with a knifeobscene finger gesturegay couplekissing while having sexwhippingpot smokingsupermarketwhat happened to epiloguediscohead buttheavy rainflatulenceteddy bearbossback from the deadanthropomorphismcameoanti semitismgrocery storereconciliationthunderitalian americanwhipboston massachusettsjob interviewresurrectionkaraoketvsexual harassmentwisecrack humorrainstormbody landing on a cardressing roomduckstadiumethnic slurcrude humorarrogancetorso cut in halfmarijuana jointanniversaryalleycartoon on tvchristmas presentstabbed in the handbongscene before opening creditsmarketblonde womanfacebookhouse partymassachusettsplaystation 3reference to twitterreference to james bondreference to star warsfart jokedrug humorscatological humortoy gunscoldingcrazy humorlong brown hairvillain arrestedhide and seekbromancefanaticbaseball stadiumbudweiserexcrementmultiple time frameschild swearinggross out humorwoman moaning from pleasurewoman moaningsevered earmoaning womanlong blonde hairrascalstudio logo segues into filmart collectorshooting startoy comes to lifehdtvasian stereotypedirected by co starfat boyrocking horsereference to justin bieberdouble dateobscene gesturereference to indiana joneswild partycomedic sex scenereference to godzillafenway parkreference to joan crawfordends with weddingnegative asian stereotypereference to katy perrycosmic zoomwishes come trueparty gamereference to flash gordonhumorous sex sceneflash gordonco worker co worker relationshipreference to sinead o'connortalking teddy bearknocking a hole in a wallreference to channing tatumreference to tom bradystuffingreference to james franco (See All) |
A petty thief posing as an actor is brought to Los Angeles for an unlikely audition and finds himself in the middle of a murder investigation along with his high school dream girl and a detective who's been training him for his upcoming role...
Subgenre: | cult filmblack comedy |
Themes: | christmasmurderdeathfriendshipsuicidekidnappingmoneydrinkingtorturedrunkennessfuneralfilmmakingincestrobberytheft β¦surveillancehomophobiachildhood (See All) |
Mood: | high schoolsatireneo noircar chase |
Locations: | rooftopairplanehospitalnew york citybarbeachswimming poolhotellos angeles californiabusnightclubairportpolice carlakemotel |
Characters: | homosexualfather son relationshippolicefather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipteenage girlteenage boyteacherdetectivepolicemanactorsister sister relationshipthief β¦actressnative americanlustemployer employee relationshipuncle nephew relationshippolice shootoutsuicide by gunshotold frienddream girlairplane stewardesshomosexual kissgay detective (See All) |
Period: | christmas party |
Story: | christmas treesanta clausrobotfemale nuditybased on novelbloodviolencefemale frontal nudityflashbackdoggunkiss β¦fightcigarette smokingpartyleg spreadingsurprise endingerectionpantiespistolvoice over narrationfondlingcell phoneshootoutbeatingcorpseshot to deathunderwearblood splattercar accidentshot in the chesturinationblondeshot in the headshotgunpunched in the facewatching tvdrinkundressingfalling from heightshootingbooklierunningdead bodybathroomrevolvermanhattan new york cityshot in the backswimmingcleavagegay slurambushvideo camerabridgefemale pubic hairfishnonlinear timelinechild abuseanti heroscantily clad femalecoffindrawingunderwater scenevantalking to the cameraattempted murderprologueelectrocutionauditionreadingbaseball batshot in the shoulderfemale removes her clothescheerleaderwitnessdirectorial debutshot in the armbearsleepingcross dressingtrustgirl in pantiesrunawayprivate detectivechainsawicetv newsdestinyno pantiesnipples visible through clothingbreaking and enteringwoundrepetition in titlecookelephantmagicianpatientstealingspidercarnivalfatechokingmental institutionretirementburglarsevered fingerbuddyburglarykicked in the crotchmental hospitalnovelistframe upaccidental killingdeath of sisterfilm producercanered pantiesabusive fatherreckless drivingdead girlvideo surveillancemental patientface masknotebookrobberset uppedophiliacremationnovelpistol whipfemale removes her dressfilm crewchild molestationtv commercialyoung version of characterlawsuitcliniccredit cardbeach housecookiemissingswimming underwaterepiloguehearserussian roulettecluetimes square manhattan new york cityrainbowhiding under a bedchapter headingsbaltimore marylandborn again christianportdiceprivate eyecasketfinding a dead bodyfleeingindianaluggagepassing outfingerhigh school friendcricketsearch for fatherfoster careanimated opening creditsfalling asleepplastic bagbiological fatherrobbery gone awryreference to marlon brandogay straight relationsdenver coloradochristmas decorationmorse codeneonscreen testhotel desk clerkvenice beach californiadead body in a car trunkfalling off a balconyi.d.reference to imdbairplane ticketreference to kurt cobainderringerelectrical torturemagic actartificial respirationmethod actingelvis presley impersonatortheatre marqueetv announcerstage nameparking attendantdetective sergeantreference to gene kellybirth control pillgay straight alliancedoodlingsawed in half magic actwood pilebreaking someone's noselunch wagonprobabilitythe one that got awayaging parentdemerolreference to joe pesciwiping off fingerprintspie eating competitionreference to olivia newton johnpain pillreference to drew barrymoreslamming a door on someone's fingersthrowing a drink glassurinating on a dead body (See All) |
The Bakers, a family of 14, move from small-town Illinois to the big city after Tom Baker gets his dream job to coach his alma mater's football team. Meanwhile, his wife also gets her dream of getting her book published. While she's away promoting the book, Tom has a hard time keeping the house in o β¦rder while at the same time coaching his football team, as the once happy family starts falling apart. (Read More)
Themes: | christmas |
Mood: | high schoolmoving |
Locations: | hospitalbicycletaxi |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyactorwritersister sister relationshipbully |
Period: | christmas party |
Story: | american footballprankbased on novelinterviewflashbackdogkissvoice over narrationcell phonemirrorremakeslow motion scenevomitingbirthdaybathroom β¦neighbormanhattan new york citynew yorkfour word titlehousesnakelocker roomtwinredheadblockbusterfrogskateboardcommercialbreakfastchaosskateboardingsibling rivalryfamily dinnernew job12 year oldbloopers during creditshiding in a closettwin brotherquitting a jobmegaphonetoastchandelieridentical twinsmoving invanityillinoisfamily mansecret passagemale vomitingaspiring actorlarge familyfootball coachbig familycharacter appears on tvdartfootball stadiumbandannacollege footballmoving vanpep talkpet foodtelevision commercial9 year oldneglected childloss of petoverweight childfraternal twinsfalling off a ladderthrowing fooddoorknobdeath of a petwatching self on tvviperchild's birthday partyhit on the head with a balloldsmobileclarinetistunderwear modelmud masknote read aloudscrambled eggsgetting someone's name wrongkiddie poolthrowing a shoefamily meetingsmart kidtwin boyschild vomittinghanging from a chandelierpet frog (See All) |
Julie and Jason have been best friends for years with no romantic interest in each other. He sleeps with someone new every few days, and she's looking for Mr. Right. Now in their thirties, they notice that their friends seem to lose all their good qualities when they have children - child rearing an β¦d the spark of Eros don't seem to co-exist. So, they decide to have a child together, share in child rearing, but pursue their own romantic lives. Things go well until he meets Mary Jane and she meets Kurt. Both seem like perfect mates. What could go wrong? (Read More)
Themes: | datingdivorcefriendshipjealousypregnancydrunkennessbreak up |
Mood: | moving |
Locations: | snowrestauranthospitalnew york citybarelevator |
Characters: | childrenhusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipdancerbabybest friendinterracial relationshiplittle boychinese foodbaby boy |
Story: | christmas treef rateddogkisstelephone callcryingcell phonetitle directed by femaleurinationbirthdaybedroomnew yorksubwaydinnerwritten and directed by cast member β¦childbirthcabingrandmotherbirthday cakehugginggamegroup of friendsnew year's evebrooklyn new york citybootsskiingthirty somethingbrushing teethpajamasnannyphoto albumatheistbirthday presentbreast feedingloud sexinterracial marriagegiving a toastsnowboardingbiracialhappy birthday to youreference to george w. bushdiarrheapackingoverhearing sexmoving outtoddlerchild swearingtantrumsledvermontgolden retrieverwoman in laborbiracial childcuddlingbaby monitorlistening to sextemper tantrumunconventionalchristmas cardfailed marriageski triplife coachfriends with benefitsbiological clockquichetwo year oldco parentinginterviewing a nanny (See All) |
Don and Ellie were once married and have two children, Lyla and Jared. They adopt a boy from Colombia, Alejandro. Eventually they would divorce, Ellie would move away and Don would hook up with Bebe, Ellie's best friend. When Alejandro is about to get married, he informs Don and Ellie that he never β¦told his natural mother who is so traditional that they got divorced. And she is coming for the wedding so he asks them if they can pretend to still be married. Don and Ellie reluctantly agree to it and Bebe moves out who is also upset that Don doesn't want to commit. Lyla who is married is going through a rough patch in her marriage. And Jared who hasn't had much luck with women finds himself attracted to Alejandro's extremely sensual sister, Nuria. (Read More)
Subgenre: | black comedy |
Themes: | divorceweddingmarriageinfidelitydeceptiondysfunctional familyadoption |
Characters: | childrenfamily relationshipsfather daughter relationshippriestartistcatholicex husband ex wife relationshipcatholic priest |
Story: | marriage proposalthree word titleremakelieconfessionfarcewoman with glassessexual humorwedding receptionmale virginwedding ceremonysculptorremake of french filmbirth motherconfession booth β¦wedding planning (See All) |
The son of a sailor, 5-year old Sosuke lives a quiet life on an oceanside cliff with his mother Lisa. One fateful day, he finds a beautiful goldfish trapped in a bottle on the beach and upon rescuing her, names her Ponyo. But she is no ordinary goldfish. The daughter of a masterful wizard and a sea β¦goddess, Ponyo uses her father's magic to transform herself into a young girl and quickly falls in love with Sosuke, but the use of such powerful sorcery causes a dangerous imbalance in the world. As the moon steadily draws nearer to the earth and Ponyo's father sends the ocean's mighty waves to find his daughter, the two children embark on an adventure of a lifetime to save the world and fulfill Ponyo's dreams of becoming human. (Read More)
Subgenre: | disaster filmdisaster movie |
Themes: | magiclovefriendship |
Mood: | animemyth |
Locations: | beachsmall townboatseashipoceanearthfishing boatfishing town |
Characters: | childrenfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboygirlsister sister relationshipmotherdaughterfathermermaidin love |
Story: | soncharacter name in titleone word titlefishunderwater sceneprincesstransformationmagical realismmoonlifting someone into the airblockbusterfloodtrappedreconciliationpower outage β¦wizardseasidecliffsailorreckless drivingharborlocal blockbustersenior citizenretirement homesorcerertsunamilifting person in airmagic spellfloodingjellyfishmagical powerhoneyyoung girlgeneratorham radiooverprotective fathertidal wavepre schoolsea captainmorse coderunning away from homesave the worldseaside town5 year oldthe moontoy boatfive year oldchildren adventuretest of loveyouth restoredbreaking freesenior centerloss of powerprehistoric fishramen noodlesbecoming humanwanting to be human (See All) |
Willie T. Stokes is a convicted con man who's led a miserable life. He drinks heavily and constantly embarrasses himself publicly. He only works once a year dressed as Santa. But then come Christmas Eve, he and his pint-sized helper dwarf Marcus stage elaborate robberies and take their department st β¦ores for everything they got. This year, they hit a mall in suburban Phoenix, Arizona. This time around, Willie gets distracted by having sex with large women, a bartender who is attracted to Santas, and a kid who's convinced he's the real deal. However, this time around Marcus must once again put up with Willie's heavy drinking and a series of incidents that constantly shoot themselves in the foot. Not to mention a nosy department store security guard who's onto them and wants his cut of the loot. Will Willie and Marcus make it to next Christmas? Or will this be the year the dynamic duo finally face justice? (Read More)
Subgenre: | cult filmblack comedydark comedymelodramaheist |
Themes: | magicchristmasmurderdeathmoneybetrayalprisondrinkingdrunkennessdeceptionrobberytheftbullyinghomophobiaalcoholism β¦car sex (See All) |
Mood: | car chase |
Locations: | snowbarbeachbathtubbicyclemotelsex in a carsex in a hot tubsex in a store |
Characters: | childrenhomosexualfather son relationshippolicemother son relationshipafrican americantattoobrother brother relationshipboyprostitutegirldetectivepolicemanthief β¦jewishbullysecurity guardalcoholicjewmuslimgrandmother grandson relationship (See All) |
Period: | 2000s |
Story: | christmas treesleighnorth polereindeerabsent fatherfemale nuditybloodviolencetwo word titlegunsex scenefightcigarette smokingdancing β¦photographchasesurprise endingvoice over narrationunderweartesticlescar accidenturinationwatching tvdrinkmaskshootingvomitingbeerreference to jesus christshot in the backf wordcleavagegay slurbrasuicide attemptboxingchild abuseanti herohit by a cardouble crossbathcontroversynecklacebartendergunshotscreamingsuburbfired from the jobpay phonebuxomgymprofanityhandgunsleepingobscene finger gesturecult directorblack americananswering machinebulletcaucasianvietnam warswimsuitskateboardblack humorcrushed to deathscampresumed deadshopliftingshoescynicismhit in the crotchpartnerdark humorshopping mallmiami floridachristmas evesafecon artisthot tubblack eyeconvictsexual humorvoice over letterranchcasual sexdivorceecrude humorswearingmannequinirreverenceparking lotcon manstolen carchocolatesandwichstuffed animalexotic dancerbottlegolf clubescalatorhangoverbully comeuppancelosermale rapedepartment storeparamedicunconsciousnesswetting pantspursevolleyballsuicidalstrong languageski maskstableguardianex conembezzlementboxing ringintergenerational friendshipfemale bartenderreference to the virgin maryreference to bill clintonfast food restaurantholiday seasonkicked in the groinpointing a gun at someonechristmas carolsnoringreference to sigmund freudboxing gloveschanging roomchristmas giftpassing outchristmas moviereference to santa clauscelibacypinball machinechristmas seasonfoot massagephoenix arizonasecurity systempower drillcareer criminalsafe deposit boxsafecrackerbeach volleyballmisanthropemerry christmascar alarmchristmas decorationparking ticketkicked in the ballscheckersmilwaukee wisconsinstuffed toyreference to leonardo da vincibegins with narrationlicense platefat boylittle personliverpointing a gun on someonepedicurebad behaviorcombination safesanta claus costumeshot by the policecrawlspacedrum setretardationwedgielechersanta costumefat childpeeadvent calendarmilk and cookiesstuffed toy animalcriminal recordmall santamislaid trustdrinking shotsreference to josephwimphand cutmiami beach floridacandy cornheavy drinkerseven dwarveskwanzaacriminal duoevil santalecherydrunken santakicked in the testiclesmissing armmongoloiddepartment store santafur stolereference to mrs. santa clausadult hitting a childanti christmashandmade giftstore detective (See All) |
Four hundred years ago, a young boy witnessed his father's death during an attack on their ship by the bloodthirsty Sengh Brotherhood. He was washed ashore on Bengalla Island where he swore to devote his life to bring down piracy, greed, cruelty and injustice. He became The Phantom, a masked avenger β¦ whose role was passed down for father to son, leading people to believe in an immortal figure called "The Ghost Who Walks". The 21st successor to the role of Bengalla's resident superhero must travel to New York City to prevent a power-hungry businessman from obtaining three magic skulls that would give him the secret to ultimate power. (Read More)
Subgenre: | martial artssuperhero |
Themes: | magicghosthero |
Mood: | poetic justice |
Locations: | airplanenew york cityelevatortruckcavejungletaxi driversubmarine |
Characters: | tough guyaction herolittle boypolice chase |
Period: | 1930s |
Story: | periscopesonsecretcharacter name in titleviolencetwo word titleguntitle spoken by characterpartypistolshootoutfistfighthorsegunfightbrawl β¦maskshowdownhand to hand combatnewspaperbound and gaggedsword fightambushmixed martial artstied to a chairexploding cardisarming someoneone man armyone against manycostumeprologuelocker roomevil manskeletonringscarloss of fathersemiautomatic pistolvigilantehenchmanpiratewolfskullfemale tied uppresumed deadkatana sworddual wieldstabbed in the eyetied feetdaggerkendovigilantismold flameadventure herovigilante justicetreasure hunthijackingmicroscopecrime fighterfemale criminalmotorcycle copguideunwanted kissnew york skylineexploding airplanebased on comic stripmasked superherotreasure mapseaplaneturbancomic heromasked vigilantemale tied upboard meetingrope bridgebridge collapsestring quartetancient swordcharity ball (See All) |
Toula Portokalos is 30, Greek, and works in her family's restaurant, Dancing Zorba's, in Chicago. All her father Gus wants is for her to get married to a nice Greek boy. But Toula is looking for more in life. Her mother convinces Gus to let her take some computer classes at college (making him think β¦ it's his idea). With those classes under her belt, she then takes over her aunt's travel agency (again making her father think it's his idea). She meets Ian Miller, a high school English teacher, WASP, and dreamboat she had made a fool of herself over at the restaurant; they date secretly for a while before her family finds out. Her father is livid over her dating a non-Greek. He has to learn to accept Ian; Ian has to learn to accept Toula's huge family, and Toula has to learn to accept herself. (Read More)
Subgenre: | independent film |
Themes: | datingweddingracismprejudice |
Mood: | high school |
Locations: | restaurantschoolchurchchicago illinois |
Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteacherstudentpriestlittle girlwaitresscousin cousin relationshipgrandmother granddaughter relationshipaunt niece relationship |
Story: | marriage proposalf ratedflashbackdancingphotographvoice over narrationcomputercameratearscollegeclassroomlimousinesuburbcollege studentsubtitled scene β¦traditionblockbusterculture clashmakeupvegetarianmisogynywedding receptionmusic bandgreekbaptismmakeoverschoolteachercultural differenceritebride and groomwedding gowncustomprotective malelambcross cultural relationshipethnicintoxicationcountry clubinter culturalcontact lensextended familytravel agencycultural conflictgreek americanparthenongreek orthodoxgreek restaurantethnic pridezitbaklavagreek dancingintentional mistranslationouzoetymologywindexgreek family (See All) |
Norma and Arthur Lewis, a suburban couple with a young child, receive a simple wooden box as a gift, which bears fatal and irrevocable consequences. A mysterious stranger delivers the message that the box promises to bestow upon its owner $1 million with the press of a button. However, pressing this β¦ button will simultaneously cause the death of another human being somewhere in the world, someone they don't know. With just 24 hours to have the box in their possession, Norma and Arthur find themselves in the cross-hairs of a startling moral dilemma and must face the true nature of their humanity. (Read More)
Subgenre: | suspensealien conspiracy |
Themes: | weddingchristmasmurderdeathsurrealismkidnappingmoneysupernatural powerhumiliationsurveillancedeath of wifedisabilityblindnessphilosophyregret |
Mood: | rain |
Locations: | snowswimming poolbathtubwaterpolice stationmotelschool busfire truck |
Characters: | husband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyteacherpolice officeraliendeafnessfather in law son in law relationship |
Period: | 1970s |
Story: | christmas treesanta clausgiftviolencekisscigarette smokingdancingphotographtitle spoken by charactersurprise endingpistolcorpseshot to deathmachine gunshot in the chest β¦arrestletterheld at gunpointcar crashrevolverscientistambulancemapno opening creditschild in periltheaterlimousinelibrarykeysuburblocker roombased on short storypay phonechampagnelightningstalkingbasementcharacter says i love yousacrificenewspaper headlineexperimentsupermarketrevelationbabysitternosebleedpress conferencemind controlback from the deadhomicideinvasiongash in the facespecial forcessafedisfigurementtuxedoboxbrushing teethgovernment agentwedding receptionnewspaper clippinglingerie slipmoral dilemmateleportationfirefightersouthern accentnasamoney problemsportaltemptationamputeebus stopstage playfilm starts with texthit by a trucktestvirginiaschoolteacherdisfigured faceprivate schoolconsciousnessmurder by gunshotlimptelevision sethuman experimentlocked in a roomburn victimhusband murders wifekicking in a doormars the planetfake accentemployeemysterious strangerenvelopedecisiondriver's licensebridesmaidhundred dollar billstruck by lightningsuitcase of moneyfilm reelstartledcentral intelligence agencybriefcase of moneysocial experimentcorvettelicense plateadvanced technologyhuman natureshot in the heartdecemberconsequencealien life formlangley virginiamonopoly the board gametheatrical playclassified informationrichmond virginiajack danielspush buttonprosthetic body partreflection in car mirrorsnowplowphysical deformityrocket scientist24 hoursmillion dollarsreference to johnny carsontoenational security agencyresearch scientistwedding rehearsalshot through the chestgatewaymysterious packageresearch centerwind tunnelrehearsal dinner (See All) |
Andy at the age of 40 still hasn't had sex. He lets his secret slip at a poker game with his buds from work. After the revealing all his friends are on a mission to help get him laid. Along the way Andy meets a nice mom, Trish, and they fall head over heels for each other.
Themes: | datingweddinglovefriendshipdance |
Mood: | wedding night |
Locations: | restaurantbarhotellos angeles californiabathtubbicyclebicycle accident |
Characters: | mother daughter relationshipsingle motherself confidencecheating on girlfriend |
Story: | ebaytoysecretfemale nuditynumber in titlemale nudityfemale frontal nudityflashbackmasturbationsex sceneleg spreadingerection β¦pantiesdigit in titlecar accidenturinationcondomundressingvomitingmarijuanabathroomneighborcleavagevideo camerascantily clad femaleracial slurconfessionvirginmini skirtkicked in the facescene during end creditsdirectorial debutflirtingnerdnipples visible through clothingpokerloss of virginityfarcefriendship between mencomic bookdrug abuseimprovisationbarefootmisunderstandingporn starbookstoresalesmanauctionmale virginshynesscannabisdrunk drivingold flamepeer pressuremasturbation referencecollectorcollectionscatological humorfinger gundental bracesjob promotioncelibacysmall businessbirth controlhobbyreference to gandhispeed datingmultiple cameosnipple slipfrat packcatch phrasepornographic videosonogram40 year oldporno moviedrug referencetubaporn actor in mainstream moviestore managerbody hairmusical sequence in non musical workbody waxingplace of workelectronic storesingle guyguy flickreference to slurpee (See All) |
A little boy named Andy loves to be in his room, playing with his toys, especially his doll named "Woody". But, what do the toys do when Andy is not with them, they come to life. Woody believes that he has life (as a toy) good. However, he must worry about Andy's family moving, and what Woody does n β¦ot know is about Andy's birthday party. Woody does not realize that Andy's mother gave him an action figure known as Buzz Lightyear, who does not believe that he is a toy, and quickly becomes Andy's new favorite toy. Woody, who is now consumed with jealousy, tries to get rid of Buzz. Then, both Woody and Buzz are now lost. They must find a way to get back to Andy before he moves without them, but they will have to pass through a ruthless toy killer, Sid Phillips. (Read More)
Subgenre: | martial artscult filmcomputer animationcgi animation |
Themes: | christmasfriendshipjealousytortureescapeheroredemptionrivalry |
Mood: | rainnightmoving |
Locations: | urban setting |
Characters: | family relationshipsfriendboysoldierbabytough guylittle girlbullysingle motherlittle boyvillainbirthday boy |
Period: | 1990s |
Story: | toy soldiertoyviolencedogtwo word titlefightsurprise endingfistfightrescueslow motion scenebrawlshowdownbirthdaybedneighbor β¦fightingsubjective camerabedroomfalse accusationapologybirthday partykaratesuburbcowboycharacter's point of view camera shotmissionproduct placementthreatfirst partdirectorial debutpizzaloyaltyflyinglifting someone into the airwalkie talkieblockbusterpart of trilogycommercialdinosauranthropomorphismthunderpet dogrivalkarate chopopening a doorrescue missionlaughingwilhelm screamrocketbad guyyellingchristmas presentbloopers during creditsbirthday presentohiotelling someone to shut uplooking out a windowbully comeuppancecartoon violencefriends who live togetherbackyardteamworkcomeuppancedoorbellcomic heroaction figurecalling someone an idiotlifting a female into the airfalling out a windowbrattoy comes to lifecgi filmfirst of trilogyclimbing stairsaudio flashbackmoving vanchased by a dogplierstelevision commercialpiggy bankpitbullpterodactylchild's bedroomopening a windowtoolboxsurroundedremote controlled toy carspacemantoy dinosaurcatchphrasereference to marie antoinettecowboy boothockey puckchild's birthday partymr potato headmagic 8 balletch a sketchanimated dogbanisterboy next doorremoval vandog as a giftlocked in roompet as gifttroll dollenemies become friendssliding down a banisterdog as giftslinky dogchild's birthdaylipstick on facepizza restaurantradio controlledresourcefulness (See All) |
Lance Clayton is a man who has learned to settle. He dreamed of being a rich and famous writer, but has only managed to make it as a high school poetry teacher. His only son Kyle is an insufferable jackass who won't give his father the time of day. Lance is dating Claire, the school's adorable art t β¦eacher, but she doesn't want to get serious -- or even acknowledge publicly that they are dating. Then, in the wake of a freak accident, Lance suffers the worst tragedy and greatest opportunity of his life. He is suddenly faced with the possibility of all the fame, fortune and popularity he ever dreamed of, if he can only live with the knowledge of how he got there. (Read More)
Subgenre: | independent filmblack comedydark comedytragedy |
Themes: | datingdeathjealousydeceptiongriefsexualitypoetry |
Mood: | high schoolsatire |
Locations: | schoolapartment |
Characters: | father son relationshipfriendteenage boyteacherstudentwriterbest friendhomosexualitysingle fathergay studentghost writer |
Story: | sonsexnuditymale nuditymasturbationthree word titlepantiespunctuation in titleslow motion scenesex in bedlieapostrophe in titlecleavageaccidentwhite panties β¦anti heroscantily clad femaleconfessiondeath of childhigh school studentdeath of sonpot smokingteen angstfameaccidental deathcoituspeeping tomrejectiontitle appears in writingdeceitvegetariansexual humoralienationcopulationhigh school teacheradolescencejournalvulgarityprincipalpopularityhorninessmemorialgoth girlfather son conflicthigh school friendhigh school principalfictional talk showfreak accidentcoworker relationshipfake suicidehigh school boydeath by strangulationautoerotic asphyxiationhigh school newspaperview under tableschool psychologistforged letterpoetry class (See All) |
Karol (Polish) marries Domininque (French) and moves to Paris. The marriage breaks down and Dominique divorces Karol, forcing him into the life of a metro beggar and eventually back to Poland. However, he never forgets Dominique and while building a new life for himself in Warsaw he begins to plot.. β¦. (Read More)
Subgenre: | black comedy |
Themes: | divorceweddingmurderdeathfriendshiprevengesurrealismmarriagemoneyprisondrinkingfuneralmemoryrobbery β¦corruptiontheftobsessionhumiliationcrueltyvengeancewealthcheating (See All) |
Mood: | nightmare |
Locations: | airplanesnowchurchcarcemeteryparis franceairportcourtroomfrancerunning after a car |
Characters: | husband wife relationshippolicefriendbrother brother relationshippolice officerlawyerthieffrenchex husband ex wife relationship |
Period: | winter |
Story: | christmas treegiftsecond partsequelsexnumber in titlebloodflashbackbare chested malegunsex scenekisscigarette smokingpistoltelephone call β¦firecryingbeatingcorpseunderwearblondepunched in the facewritten by directordrinkarrestvomitingtearsbeddead bodycolor in titleriverf wordold manstrangulationbridgesuicide attemptimmigrantsubwaymapjudgetrialcoffingraveyardpaingravehotel roombinocularsbusinessmankeypay phonesuitcasestatuecourtbusinessbodyguardcharacter says i love youhandgunsleepingtypewriterarsonpickup truckshavingcard gameslow motioninjuryhong konghidingphone boothpart of trilogybridefaked deathburialscammale underweargas maskpassportguardboxer shortsintriguepartnerhomelessscissorscigarette lightercard playingcon artistpolandcanebruisepigeonsign languagecoinholding handsframed for murdervodkatombhairdresserimpotencechristmas presenthit in the facelong hairlast will and testamenttelephone boothstreet marketphone sexloancredit cardobsessive lovecrushed headhearsemoney launderingrags to richesfablesexual frustrationhair salonbeauty salonequalityholebeggingtrunkmetrosilhouettecasketrebirthluggagecard trickwarsaw polandinterpreterreference to charlie chaplinhandkerchiefautomated teller machinelongingpadlockvolvohand on crotchneon signbusiness partnerphone booktear gasdesertiongarbage dumpsecond in trilogywashing hairhair stylistbusiness dealbeauticianconveyor beltparis metrowedding dayreturn homesearch warrantfaking own deathcombelderly manfaxbuskingpanhandlingdeath certificateblank bulletdiplomareference to brigitte bardottelephone bookpretending to sleepbaggagepaper shredderconsulatepole the personhired assassinfrench lessonlost luggageshiveringsummonsbaggage claimpolish immigrantbaggage handlerdivorce courtswallowing a keybusiness mancurrency exchangeunconsummated marriagecivil courtexecutorfrancfrozen riverarmed guardbrothholding a gun to someone's headsliding on icepolish mantoilet stoolcompany ownerland salereflection in picture frame glass (See All) |
John and Jane Smith are a normal married couple, living a normal life in a normal suburb, working normal jobs...well, if you can call secretly being assassins "normal". But neither Jane nor John knows about their spouse's secret, until they are surprised to find each other as targets! But on their q β¦uest to kill each other, they learn a lot more about each other than they ever did in five (or six) years of marriage. (Read More)
Subgenre: | martial artscult filmblack comedy |
Themes: | divorceweddingchristmasmurderdeathfriendshipmarriagemoneydrinkingdrunkennessescapedancememorygamblingexecution β¦panictechnology (See All) |
Mood: | raincar chase |
Locations: | airplanerestaurantnew york citybarhotelhelicoptermotorcyclenightclubdesertbicycletaxielevatorkitchenstormsinging in a car β¦yachtsuv (See All) |
Characters: | husband wife relationshipmother son relationshipfather daughter relationshipfriendsingerboydanceractorhostagetough guyjewishbest friendwaitressjewchinese β¦sniper rifleengineer (See All) |
Story: | wristwatchmarriage proposalsecretcharacter name in titlesexf ratedbloodinterviewdoggunkissfightdancingphotographexplosion β¦singingpartyknifechasesurprise endingpistoltelephone callfirecell phonesongshootoutunderwearfistfightfoodmachine guncar accidentmirrorshot in the chesturinationface slapshotgunrescuepunched in the facewatching tvcomputerdrinkfalling from heightshootinglieriflebeerhand to hand combatsunglassesbombrunninglingeriebedcafebathroomneighborhandcuffsreference to jesus christmanhattan new york cityshot in the backspynewspaperbraassassincookingwinecandleambushmassacrebasketballwomaneatingmixed martial artsboxingweapondinnerexploding carapologychilddisarming someoneassassinationhit by a carsearchbinocularssuburbfbichampagnepassionsuitcasedollreadingkicked in the facetough girllightningsensualitygymcrosswitnessneck breakingtrapdie hard scenariotied upsemiautomatic pistolshot in the armsecret agentsilencerkissing while having sexciasubtitled scenetrusttherapygaragestrong female characterak 47eyeglassesmissiletv newsuzihand grenadegrenadehead buttassassination attemptwoundmass murdertouristhelmetboxerexploding buildingdysfunctional marriageblockbustersharkteddy bearbrooklyn new york citystrong female leadfollowing someonerocket launchers&mgun fupassportpump action shotgunremote controltarget practicesurveillance camerabootsconstruction sitedual wieldwhipbroken glassevacuationm 16amusement parkcard playingassault riflewedding ringbulletproof vestknife throwingtangosecret identityreckless drivingsign languagedaggergatling gunmannequinlaptop computerfemale assassindesert eaglebazookaearphonesdark secretcar racegolf clubarms dealerquick drawstandoffgardenerskyscraperflaskdepartment storecredit cardstakeoutveganbaseball capmailboxlocked doormeat cleaverbreaking a windowatlanta georgiamurderessexploding housedistrustmailmansleeplessnessbutcher knifeman on firetoy gunsaltwhite brareference to the virgin marydeath of parentstargetdicemountain climbingelevator shaftgoggleswedding anniversaryu.s. mexico borderovenmartinitime bombart historywall street manhattan new york cityarsenalconvoypenthousesecret lifebody armorshooting galleryroom serviceconey island brooklyn new york citywelderhk 5 machine gunblack leatherneonpliersslip the undergarmenthit with a golf clubdune buggywoman murders a manmarriage counselingsecret compartmentslothbogota colombiafictional government agencyautomatic pistolwedding videomorning afterreading in bedd box motion codepvcreconnaissancefrench rivierathumbcurtainsbuilding constructionnewspaper boybuilding contractorchristmas morningmassachusetts institute of technologytool shedhusband hits wifepeace corpsknife in the thighseductive dancewoman breaks man's neckdatabasedriving in the wrong directionpicket fencecomputer technologyhusband and wifepurposeful car accidentfirst meetinghusband wife teamhusband wife fightsoccer on tvabandoned airfieldliving with one's mothergift cardmuzakpower grid (See All) |
In this continuation to the adventure of the demon superhero, an evil elf breaks an ancient pact between humans and creatures, as he declares war against humanity. He is on a mission to release The Golden Army, a deadly group of fighting machines that can destroy the human race. As Hell on Earth is β¦ready to erupt, Hellboy and his crew set out to defeat the evil prince before The Golden Army can destroy humanity's existence. (Read More)
Subgenre: | martial artssuperheroparanormal phenomenasteampunkparanormal investigation |
Themes: | christmasdeathsuicidepregnancydrunkennessherowrestlingabductionapocalypsefalling in loveself sacrificenear death experience |
Locations: | new york city |
Characters: | father son relationshipfather daughter relationshipbrother sister relationshipbabyaction herogerman |
Period: | 1950s |
Story: | tooth fairyelfsecond partcharacter name in titlesequelbloodviolenceflashbackfighttitle spoken by charactersingingsurprise endingpistolshowershootout β¦fistfightshot in the chestface slapbattlegunfightbrawlfalling from heightbookbased on comicshowdownhand to hand combatdemondecapitationgood versus evilsword fightbased on comic bookimpalementmixed martial artsstabbed in the chestmapsevered headno opening creditsanti heroone man armychild in perilfictional warcreaturecigar smokingone against manystabbed in the backprologueperson on fireskeletonsplit screenfilm within a filmthreatened with a knifesevered armtwinprincespearmutantroman numeral in titlenosebleedrebellioncrushed to deatheaten alivehit in the crotchgash in the facesuper villainstabbed in the headexilechristmas evethrown through a windowsoulbody landing on a carexploding helicopterauctionblood on camera lensoutcastremorsecrownquitting a jobpatricidesuperhero teamtrollgoblinhead cut offshot through the mouthblacksmithnorthern irelandgoggleshead ripped offregenerationunwed pregnancyresignationarm ripped offmultiple time framesstabbed in the mouthtumorcut armstabbed in the footfederal bureau of investigationturned to stoneson murders fatherpyrokinesisreference to the wizard of ozthrown through a glass doorangel of deathdark horse comicsteeth knocked outtruceinterspecies romancenazi experimentsecret government organisationindestructibilityoccult detectiveowning many catswebbed fingersaquatic humanoidbreathing apparatushumanoid demon (See All) |
The story picks up four weeks after the first film, and already Bridget Jones is becoming uncomfortable in her relationship with Mark Darcy. Apart from discovering that he's a conservative voter, she has to deal with a new boss, strange contractor, and the worst vacation of her life.
Subgenre: | british comedy |
Themes: | datingweddingbetrayalprison |
Locations: | airplanenew york citybeachlondon englandurban settingenglandgermany |
Characters: | boyfriend girlfriend relationshipfemale protagonistself doubt |
Story: | marriage proposalsecond partcharacter name in titlesequelf ratedbased on novelkisslesbian kisstitle directed by femaleblondereporterbradiarypremarital sex β¦six word titlekissing while having sexblockbusterattorneyparachuteskiingirreverencefountainblonde womanold flamechick flickopposites attractinternbangkok thailandlaw firmillegal drugbritish womanreference to jane austenamerican actress playing british character (See All) |
The needy Gigi Haim is a young woman seeking her prince charming somewhere amongst her unsuccessful dates. After dating estate agent Conor Barry, Gigi anxiously expects to receive a phone call from him. However Conor never calls her. Gigi decides to go to the bar where he frequents to see him, but s β¦he meets his friend Alex who works there. They become friends and Alex helps Gigi to interpret the subtle signs given out by her dates. (Read More)
Themes: | datingdivorceweddingmarriageinfidelityextramarital affairunrequited lovebreak upaffairtechnology |
Mood: | breaking the fourth wall |
Locations: | restaurantbarswimming poolboatapartmentsex in an office |
Characters: | family relationshipshusband wife relationshiphomosexualfather daughter relationshipboyfriend girlfriend relationshiplove trianglebest friendgay friend |
Period: | 2000s |
Story: | marriage proposalfemale nudityflashbackcigarette smokingpartytelephone callvoice over narrationpunctuation in titlebased on bookcell phonebeerapostrophe in titlewomanroommatebartender β¦smokingliarscene during end creditsgymsix word titleheart attackclaim in titlemonologuedysfunctional marriagecheating husbandyogagrocery storerejectionensemble castadvertisingplaystation 2e mailmarital problemlingerie slipengagement ringreal estate agentunhappy marriageblind datefemale friendshipadvicesailboatconstructionsailingbroken mirrorinfatuationkiss on the lipsxbox 360office workercontraction in titlechick flickbattle of the sexesrealtorsinglebaltimore marylandguruinternet datingsingle womannintendo wiiensemble filmrenovationbridesmaidreference to led zeppelinmusic producerinterlinked storiesaspiring singerhome renovationbar ownercheating on wifehdtvreference to al pacinowanting a divorcenewspaper adreference to myspacerestaurateurironing boardncaasinglestestimonialyoga instructorromantic rejectionhome decoratinglove confessionhoneycombboyfriend girlfriend reunionwanting to marryboyfriend girlfriend reconciliationreluctant to marrycaring for fatherlays potato chips (See All) |
Siblings Kate and Teddy try to prove Santa Claus is real, but when they accidentally cause his sleigh to crash, they have to save Christmas.
Themes: | christmas |
Locations: | police car chase |
Characters: | childrenbrother sister relationshipsingle mother |
Story: | north polesanta clausgiftthree word titlecameravideo camerawidowjourneybrotherfirst partsisterstealing a carchristmas evefirefightermassachusetts β¦christmas moviechristmas seasonchristmas spiritsanta claus hatchronicles (See All) |
June has a garage in Boston. At an airport heading home, a man bumps into her a few times and tries to keep her off the plane. He's under FBI surveillance; they wonder if he and she are working together, so they let both on a flight full of armed men wanting to arrest the stranger. He's Roy, he shoo β¦ts his way out of trouble and tells her she's in danger. She's home the next day, miraculously, when agents pick her up; Roy saves her again, and a transcontinental chase ensues with Roy convincing her that he's the good guy, protecting an energy source that a rogue agent wants to sell on the black market. Can she trust Roy, and will trust matter when the bullets start flying? (Read More)
Subgenre: | martial arts |
Themes: | weddingmurderdeathkidnappingescapeherodeceptionsurveillance |
Mood: | car chase |
Locations: | rooftopairplanesnowrestauranthospitalnew york citybarbeachtrainhotelhelicoptermotorcyclebathtubbusairport β¦kitchenpolice cargas stationgermanylaboratorytunnelspainsinging in a carfire truckcar motorcycle chaseairplane trip (See All) |
Characters: | teenagerhostagesister sister relationshiptough guyaction herogermanamerican abroadex boyfriend ex girlfriend relationshippolice chaseex soldier |
Story: | toy soldierpun in titlecharacter name in titlebloodviolencebare chested malekissfightphotographexplosionknifechasethree word titlesurprise endingpistol β¦cell phoneshootoutcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescuepunched in the facecomputergunfightbikinibrawlfalling from heightshowdownheld at gunpointhand to hand combatsunglassescar crashinterrogationhandcuffsislandrevolverriverscientistf wordsubjective cameraspyfoot chaseassassinambushstrangulationmountaindisguiseambulancemansionwomanbridgedinertoilettied to a chairexploding caranti herodisarming someoneone man armyhit by a cardouble crossfemme fatalenews reportshot in the legon the runone against manypilothotel roomcharacter repeating someone else's dialoguestabbed in the backfbifugitiveundercoverproduct placementknocked outkicked in the facegyminjectiongardenmercenarysemiautomatic pistolsecret agentsilencerciagaragewashington d.c.flirtingiceeavesdroppingmissileropeuzisyringegrenadehead buttsecurity camerafbi agentexploding buildingswat teamjumping from heightbrooklyn new york cityparking garageanimal attackpresumed deadmechanicdamsel in distressreverse footageinventorboston massachusettschaosairplane crashknife fightparachutewedding dressbody landing on a carknife throwinglasersightdrugged drinktracking devicefiremansatellitedesert eaglecia agentmysterious manbag over headarms dealerbrooklyn bridgegun held to headplane crashweightliftingwhisperinghanging upside downaustriacornfieldbody in a trunkhit by a truckbaseball capdruggedmailboxman punching a womantrain ridemacguffinbullscarecrowbullet woundhammockcodeoverturning carrogue agentkansasalpstrampenfighter planeexploding airplaneabandoned warehousewoman in dangermotor scootercanalhit by a trainwoman in bikiniknife in the chestjumping from a rooftopwoman punching a manbridesmaidseaplanespaniardcrushed by a carbatteryjumping off a bridgeipodnunchuckssafe housevolvospiked drinkexploding planeshot in the sideaction figurecockpitcentral intelligence agencylawn sprinklerdesert islandold coupleflipping cartransmitterambiguous titleboy geniustruth serumfalling into a rivernikon cameraringtonesalzburg austriabullringtunnel chase scenerunning of the bullsbench presspontiac gtocellular phone tracefiring two guns simultaneouslyseville spaineagle scoutfake nursehotwire (See All) |
Tom Popper grew up having very little interaction with his father who was off exploring the world. When he grows up he spends most of time on his work and ignores his children. One day his father sends him an unusual gift: a penguin. Popper can't help but wonder why his father would send him a pengu β¦in. He tries to get rid of it, but accidentally orders five more. When his children and ex-wife show up to celebrate his son's birthday, the kids are taken with the penguins. And Popper finally gets to connect with his kids while his work suffers. (Read More)
Themes: | christmasescapememorydeath of fatherinheritance |
Locations: | snowrestauranthelicopterbathtubtaxielevatorocean |
Characters: | childrenfamily relationshipsfather son relationshipfather daughter relationshipteenage girlpolice officerlawyerlittle boyex husband ex wife relationshipchinese food |
Period: | 1980s1970swinteryear 1980year 1976year 1981year 1978 |
Story: | christmas treegiftcharacter name in titlebased on noveldancingsingingthree word titlepunctuation in titlecryingcell phonewatching tvcomputerlettertearsanimal in title β¦apostrophe in titlemanhattan new york citycandlevideo camerabridgebirdold womanmicrophonechampagnetrapsisterperiod in titleiceapplauseeggwatching a moviebridebirthcgiremote controlzooshovellaughterice skatingmarital separationabbreviation in titlemidlife crisiswilhelm screammusic bandlaptop computerbriberywifelast will and testamentfirst datepenguinstreet marketreference to the beatlesreal estatesecurityold ladyhusbandstethoscopeassistantreference to donald trumpteenage daughtermercedes benzsoccer ballbadgebird in titlesnowmannew york skylinestatue of libertydoormanantarcticanew york city new yorkcity parkmultiple time framesreference to winston churchillreference to charlie chaplinsnowballsnowglobedeath of parentice cubenesttaxi ridesquidfamily vacationnext door neighborreference to ernest hemingwaycartgalaicebergthe beatles songham radiobondinghockey stickhigh riserusepartnershiphdtvreference to fred astairereference to martha stewartslidenoisy neighborzookeepercell phone cameraice skatesreal estate developerreference to beyonceskating rinkford motor companyreference to howard hughesidreading of willhatching egglincoln automobilereference to morgan freemanreference to the doorsanimal controldance routineoverflowing bathtublost letternosey neighborapple macbookhockey fanflatiron building manhattan new york cityhatchlingiphone 4reference to james stewart (See All) |
Peter Pan (Williams) has grown up to be a cut-throat merger and acquisitions lawyer, and is married to Wendy's granddaughter. Captain Hook (Hoffman) kidnaps his children, and Peter returns to Never Land with Tinkerbell (Roberts). With the help of her and the Lost Boys, he must remember how to be Pet β¦er Pan again in order to save his children by battling with Captain Hook once again. (Read More)
Subgenre: | cult filmswashbuckler |
Themes: | magicchristmasrevengekidnappingherodysfunctional familyadoption |
Locations: | airplanesnowboatlondon englandenglandbaseballcity of children |
Characters: | childrenfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipgirllawyerlittle girllittle boyself discoverymermaid |
Period: | 1990s20th century |
Story: | character name in titlebased on novelviolenceone word titledogtitle spoken by characterbased on playtelephone callcryingcell phonerescuebattleswordtearsbed β¦islandgood versus evilorphansword fightdeath of friendman with glassesno opening creditschilddrawingfictional warold womanduelcostumeuniformstorytellinghuggingpiratecaptainslow motionlifting someone into the airblockbusteranthropomorphismreverse footagechild's point of viewfairyskateboardingsnowingdead boyplaysword duelvillain played by lead actoryellingbroken windowshoutingadventure herofantasy worldbaseball capbaseball gamechild kidnappingfriends who live togetheracrobatfather son estrangementoutlaw gangvictorychristmas lightsacrobaticshooksurname as titlefood fightlifting female in airstockholm syndromechristmas decorationsminiaturizationbig ben londonchild's drawingdollhouseteenager fighting adultreference to gandhicaught in a netflying manactress playing male rolefear of flyingbaseball glovechild fighting adulthook for handbattle of witstinker bellcaptain hookflying boyturbulencepants falling downgang that lives togethersheepdogslashexposed underwearopen windowexpression taken literallyanthropomorphic flowernever neverlandseashell bikinicrowingflying girlold english sheepdogthrowing a telephone out a window (See All) |