Please wait - finding best movies...
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | psycho thrillersurvival horrorslasher flickindependent horroramerican horrorteen horrortragedysuspenseblack comedycult filmindependent film |
Themes: | near death experiencemadnessinheritancecannibalismpanicexploitationevilsadisminsanitydysfunctional familyparanoiabrutalitypsychopathescapetorture …fearkidnappingmurderdeathfriendship (See All) |
Mood: | ambiguous endingdarknessslasheravant garde |
Locations: | back countrycountrytexasgas stationtruckroad tripfarmwheelchairkitchencemeterycar |
Characters: | slasher killerserial murdererself mutilationtruck driverserial killerself inflicted injuryterrorvillainkillerhostageteenage boybrother sister relationshipteenage girlbrother brother relationshipboyfriend girlfriend relationship …family relationshipsteenager (See All) |
Period: | year 19731970s |
Story: | victim invited to dinnerscreaming in fearhorror movie remadewearing human skinpower generatorhit with a broomhuman bonemeat grindermeat hookyelling for helpporch swingcannibal familypsychotronic filmhit on the head with a hammerpsycho film …human skullchainsaw murdergrindhouse filmfemale victimsouthern gothichit with a hammeroffscreen killinghomicidal maniacscreaming in horrorfacial scarkilling spreegrave robbinggrave diggerscreaming womanwoman in dangerevil familyevil smileevil laughterradio newsdinner tablemasked villainhit by a truckpsychopathic killermasked killerpickup truckman with glassesevil manrunning out of gasman in a wheelchairwheelchair boundpolaroid cameracar washcar troublerotting corpsepsychological tortureescape attemptblood splatterpocket knifepolaroid photographburning a photographthreatened with a knifefoot chasesucking bloodcutting the palm of one's handblowing a raspberryrolling downhillstrapped to a tabletool in titlehaving picture takeneighteen wheelerscreen doorreference to zorrocut legsoda machinehouse of horrorsfood traygroup of fivecontemporary settingrolling down a hillshot in sequencebell bottomshead traumacut fingermad familydead teenagerforeshadowbased on ed geinflashbulbdesolate18 wheelerbroomstickatonal music scorepenknifefrozen alivepower toolheadlightsfarmlandwriting in bloodbrutalleatherfaceeating human fleshdisorientationhell on earthmisdirectionman eaterdesecrationreference to draculadreadtroubled productionscream queenarmadillolifting a female into the airsummertimegruesomeinbreedingdrive in classiccontroversialhand woundfinger cutsickomidnight moviehypothermiamallethoroscopestate in titleanthropophagusbirdcagebanned filmmurder spreehenremadesadistictorturerbonesruralgas station attendantdisturbinggeneratorbloody violencefrozen bodydecomposing bodycreepyskinweirdojumping out a windowstate name in titlecut armbird cagecaged animaldeath of boyfriendno endingstraight razordisturbed individualextreme close upsouthlifting person in airwrenchleg injurytoothbroomsocial decayclose up of eyecreepcryptsinistercut handbludgeoningbutcherybonesole survivorastrologyfurnituresledgehammershrineslaughterhousesummer vacationmacabrewindmillheld captivefilm starts with texteyeballhillbillyanimal crueltyserial murderabandoned housescene before opening creditsslashingfarmhousehuman monsterold dark houseurban legendtexanestatehead woundmeatminimal castvomitface maskbad guyyellingmadmanhysteriaclose up of eyessouthern accentcharacters killed one by oneloss of brothertank topbloodbathbody countlens flarelaughingbarbecueswingjumping through a windowone dayvegetarianhit on the headcigarette lighterdark humorpsychotronicbutchermutecannibalmercilessnesshippielow budgetgrandfatherdamsel in distresswoman in jeopardycovered in bloodtensionfull moonredneckrampagemasked manhitchhikinghitchhikerproduced by directorskullvictimgrindhousepsychoblockbusterspiderhammerlifting someone into the airloss of friendbeardgroup of friendsvandalismcookbarnmutilationgothicropechainsawfreeze framemaniacsplattercross dressingkillingcult directorcowdirectorial debutgrandmotherdeath of brotherfirst partchickentied upmurdererpigglassestragic eventhairy cheststalkingcountrysidescarknocked outskeletonproduct placementbeaten to deathfirst of seriesattackscreamingdangergravefive word titlenews reportgraveyardvancontroversydouble crossradiodinnertied to a chairstabbed in the chestdeath of friendimpalementmassacreambushbound and gaggedflashlightsurvivaldecapitationcollegelow budget filmrunningsunglassesvomitingfalling from heightwritten by directorcamerablondeurinationcorpsebeatingvoice over narrationsurprise endingchaseknifephotographviolenceblood (See All) |
Subgenre: | survival horrorslasher flickteen horrorsuspenseblack comedycult filmindependent film |
Themes: | near death experiencecannibalismpanicinsanityparanoiabrutalitypsychopathescapetorturefearkidnappingfriendshipmurderdeath |
Mood: | slasher |
Locations: | gas stationtruck |
Characters: | slasher killerself mutilationhostageteenage boyteenage girlboyfriend girlfriend relationshipteenager |
Story: | offscreen killingevil laughterpickup truckcar troublepsychological tortureblood splatterthreatened with a knifefoot chaserolling down a hilldead teenagerinbreedinggas station attendantdeath of boyfriendextreme close upsinister …slaughterhousehillbillyhuman monsterold dark housesouthern accentcharacters killed one by onetank topbody countone daycannibalmercilessnessdamsel in distressredneckgroup of friendsfirst partstalkingfirst of seriesscreamingdangerstabbed in the chestdeath of friendambushbound and gaggedflashlightsurvivaldecapitationcollegefalling from heightcorpsebeatingsurprise endingchaseknifebloodviolence (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
Subgenre: | psycho thrillerindependent horroramerican horrorsuspensecult film |
Themes: | exploitationevilinsanitybrutalitypsychopathfeardeathmurder |
Mood: | darknessslasher |
Locations: | wheelchair |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshipteenager |
Story: | horror movie remadepsychotronic filmgrindhouse filmhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil mancar troubleblood splatteratonal music scorebrutallifting a female into the airgruesome …drive in classicsickomurder spreesadistictorturerbloody violencedisturbingweirdocreepbutcherysole survivorhillbillyserial murderslashinghuman monsterbad guymadmancharacters killed one by onelens flarebody countpsychotronicbutcherrampageredneckmasked manvictimgrindhousepsycholifting someone into the airmutilationgothicchainsawmaniacsplatterkillingmurdererstalkingcontroversyimpalementmassacredecapitationblondecorpsesurprise endingviolenceblood (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | psycho thrillerindependent horroramerican horrorcult film |
Themes: | evilsadisminsanitybrutalitypsychopathtorturedeathmurder |
Mood: | slasher |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boybrother sister relationshipteenage girl |
Story: | grindhouse filmhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil mancar troubleblood splatterlifting a female into the airgruesomedrive in classicmurder spreetorturerrural …bloody violencedisturbingdisturbed individualbutcherysole survivorhillbillyserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countbutcherrampageredneckmasked mangrindhousepsycholifting someone into the airmutilationmaniackillingmurdererstalkingimpalementmassacredecapitationlow budget filmcorpsesurprise endingviolenceblood (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | exploitationevilsadisminsanitybrutalitypsychopathfeardeathmurder |
Mood: | darknessslasher |
Locations: | cemetery |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerbrother brother relationshipteenager |
Story: | psychotronic filmgrindhouse filmfemale victimhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil mancar troubleblood splatterdrive in classicmurder spreeruralbloody violence …weirdodisturbed individualbutcheryeyeballhillbillyserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countpsychotronicbutcherrampageredneckmasked manvictimgrindhousepsycholifting someone into the airbarnmutilationchainsawmaniackillingdeath of brothermurdererstalkinggraveimpalementmassacredecapitationlow budget filmsurprise endingchasebloodviolence (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent horrorsuspenseindependent film |
Themes: | madnessexploitationevilsadisminsanitybrutalitypsychopathtorturefearkidnappingfriendshipdeathmurder |
Mood: | darknessslasher |
Locations: | back countrycountrygas stationtruckroad tripfarm |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationshipteenage girlfamily relationships |
Story: | grindhouse filmfemale victimhomicidal maniackilling spreepsychopathic killerevil manblood splattersickomurder spreesadisticgas station attendantbloody violenceweirdostraight razordisturbed individual …creepbludgeoningbutcheryserial murderslashingfarmhousehuman monsterminimal castbad guymadmancharacters killed one by onebody countswingbutchertensionredneckrampagegrindhousepsychomutilationchainsawmaniacsplatterkillingdeath of brothermurdererstalkingvanstabbed in the chestimpalementmassacrebound and gaggedflashlightsurvivaldecapitationlow budget filmsunglassesurinationcorpsesurprise endingchaseknifephotographviolenceblood (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult film |
Themes: | evilinsanitypsychopathmurderdeath |
Mood: | darknessslasher |
Locations: | cemetery |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenager |
Story: | psycho filmfemale victimhomicidal maniackilling spreegrave robbingmasked villainpsychopathic killermasked killerevil manblood splatterdead teenagerbrutallifting a female into the airdrive in classicmurder spree …bloody violencebutcheryserial murderslashingbad guymadmanbloodbathbody countbutcherrampagemasked manvictimpsycholifting someone into the airmutilationgothicmaniacsplatterkillingmurdererstalkinggraveyardmassacreflashlightdecapitationsurprise endingviolence (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | psycho thrillerblack comedycult filmindependent film |
Themes: | near death experiencemadnesscannibalismexploitationevilsadisminsanityparanoiabrutalitypsychopathescapetorturefearkidnappingmurder …deathfriendship (See All) |
Mood: | ambiguous ending |
Locations: | texasgas stationroad tripfarm |
Characters: | serial killerterrorvillainhostagebrother sister relationshipbrother brother relationshipboyfriend girlfriend relationshipfamily relationships |
Period: | 1970s |
Story: | grindhouse filmfemale victimhomicidal maniackilling spreehit by a truckpsychopathic killerevil manrunning out of gaspsychological tortureescape attemptblood splatterthreatened with a knifefoot chasewriting in bloodmurder spree …sadisticsouthbutcherymacabrefilm starts with textserial murderhuman monsterface maskbad guymadmanclose up of eyessouthern accentbody countbarbecuejumping through a windowone daycigarette lighterbutchercannibalmercilessnesscovered in bloodrampageredneckmasked mangrindhousefreeze framemaniaccult directorcowdeath of brotherchickenmurdererpigknocked outbeaten to deathattackscreamingnews reportdouble crosstied to a chairstabbed in the chestdeath of friendimpalementambushbound and gaggedsurvivallow budget filmvomitingwritten by directorcorpsebeatingchaseknifephotographviolenceblood (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
Subgenre: | slasher flicksuspensecult filmindependent film |
Themes: | exploitationevilsadisminsanitybrutalitypsychopathescapetorturefearkidnappingdeathmurder |
Mood: | darknessslasher |
Locations: | gas stationtruckroad tripcar |
Characters: | slasher killerserial murdererself mutilationserial killerterrorvillainkillerhostage |
Story: | screaming in feargrindhouse filmfemale victimhomicidal maniackilling spreepsychopathic killerpickup truckevil mancar troublerotting corpseblood splatterbrutalsickomurder spreebloody violence …decomposing bodycaged animaldisturbed individualcreepbutcherysole survivorfilm starts with textserial murderscene before opening creditsslashinghuman monsterhead woundbad guymadmancharacters killed one by onebloodbathbody countbutchermercilessnessredneckrampagevictimpsycholoss of friendmutilationmaniackillingfirst partmurdererpigtragic eventcountrysidedangervancontroversyimpalementmassacrebound and gaggedflashlightlow budget filmsunglassesvomitingurinationcorpsechaseknifephotographviolenceblood (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorsuspensecult filmindependent film |
Themes: | evilsadisminsanitybrutalitypsychopathfeardeathmurder |
Mood: | darknessslasher |
Locations: | truckcar |
Characters: | slasher killerserial murderertruck driverserial killerterrorvillainkillerteenage boyteenager |
Period: | 1970s |
Story: | psycho filmgrindhouse filmfemale victimhomicidal maniackilling spreepsychopathic killercar troubleblood splatterdead teenageratonal music scoregruesomedrive in classicmurder spreesadisticremade …disturbingbloody violenceweirdobutcherysole survivorsummer vacationserial murderslashinghuman monstercharacters killed one by onetank topbody countlens flarepsychotronicbutchermutemercilessnesslow budgetfull moonrampagevictimgrindhousepsychohammergothicfreeze framemaniackillingfirst partmurdererstalkingfirst of seriesscreamingdangermassacredecapitationlow budget filmrunningblondecorpsebeatingsurprise endingviolence (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrortragedy |
Themes: | evilsadisminsanitydysfunctional familybrutalitypsychopathtorturekidnappingdeathmurder |
Mood: | darknessslasher |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerhostageboyfriend girlfriend relationshipteenager |
Period: | 1970s |
Story: | psycho filmfemale victimkilling spreemasked villainpsychopathic killermasked killerevil manblood splatterbrutallifting a female into the aircontroversialsickomurder spreesadistictorturer …bloody violencedisturbingcreepyweirdocreepbutcheryserial murderabandoned houseslashinghuman monsterbad guymadmancharacters killed one by onebloodbathbody countbutchertensionrampagemasked manvictimpsycholifting someone into the airloss of friendmaniacsplatterkillingmurdererstalkingbeaten to deathattackgraveyardcontroversystabbed in the chestimpalementmassacrefalling from heightcorpsebeatingchaseknifephotographviolenceblood (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | psycho thrillersurvival horroramerican horrorteen horrortragedysuspenseblack comedy |
Themes: | near death experiencecannibalismpanicinsanityparanoiabrutalitypsychopathescapefearkidnappingmurderfriendshipdeath |
Mood: | slasher |
Locations: | kitchen |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerhostageteenage girlteenager |
Story: | female victimhomicidal maniackilling spreepsychopathic killerman with glassesevil manescape attemptdead teenagereating human fleshdreadanthropophagusdisturbingbloody violenceweirdodisturbed individual …creepsinistersole survivormacabreserial murderscene before opening creditshuman monsterbad guycharacters killed one by onebody countmercilessnesscannibaldamsel in distresswoman in jeopardyrampagevictimpsycholoss of friendmaniackillingmurderertragic eventstalkingscarknocked outdangernews reportdouble crossdeath of friendflashlightsurvivalwritten by directorcorpsesurprise endingchaseknifebloodviolence (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | psycho thrillerindependent horroramerican horrorcult filmindependent film |
Themes: | exploitationevilinsanitybrutalitypsychopathtorturemurderdeath |
Mood: | slasher |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationship |
Story: | grindhouse filmhomicidal maniackilling spreepsychopathic killerevil manblood splattergruesomesickomurder spreesadisticdisturbed individualcreepbutcheryserial murderslashing …human monsterbad guymadmanbody countdark humorpsychotronicbutcherlow budgetrampagepsychomutilationmaniacsplatterkillingstalkingattackcontroversystabbed in the chestdecapitationlow budget filmsurprise endingbloodviolence (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | psycho thrillerslasher flickamerican horrorsuspensecult film |
Themes: | madnessinsanityparanoiabrutalitypsychopathtorturefearmurderdeath |
Mood: | darknessslasher |
Locations: | wheelchaircar |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationshipteenager |
Period: | 1970s |
Story: | yelling for helphit on the head with a hammerpsycho filmgrindhouse filmfemale victimhomicidal maniacmasked villainpsychopathic killermasked killercar troubleblood splatterdrive in classicmurder spreetorturerdisturbing …bloody violencesinisterbutcheryserial murderslashinghuman monsterbad guymadmancharacters killed one by onebloodbathbody counthit on the headcigarette lighterbutchermutemercilessnessrampagemasked manvictimgrindhousepsycholifting someone into the airhammermutilationmaniacsplattermurdererglassesstalkingproduct placementbeaten to deathscreamingnews reportflashlightblondechaseknifeviolenceblood (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those …friends. (Read More)
Subgenre: | slasher flickamerican horrorcult film |
Themes: | exploitationpsychopathmurderdeath |
Mood: | darknessslasher |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boyteenage girlboyfriend girlfriend relationshipteenager |
Story: | psychotronic filmgrindhouse filmhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil mancar troublebrutalgruesomedrive in classicmurder spreedisturbingdisturbed individual …sole survivoreyeballhillbillyserial murderslashinghuman monsterbad guymadmancharacters killed one by onepsychotronicrampagemasked mangrindhousepsycholifting someone into the airbarnmaniacsplattermurdererimpalementblood (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorsuspensecult filmindependent film |
Themes: | evilinsanitybrutalitypsychopathtorturefearkidnappingdeathmurder |
Mood: | slasher |
Locations: | cemetery |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boyteenage girlboyfriend girlfriend relationship |
Story: | psychotronic filmpsycho filmfemale victimhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil manblood splatterfoot chasedead teenagerbrutalhell on earthgruesome …murder spreesadistictorturerbloody violencedeath of boyfriendbutcheryserial murderslashingbad guymadmancharacters killed one by onebody countpsychotronicbutcherrampagemasked manvictimpsycholifting someone into the airmutilationmaniacsplatterkillingdeath of brothermurdererstalkingvanimpalementdecapitationfalling from heightcorpsevoice over narrationsurprise endingphotographviolenceblood (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent film |
Themes: | evilparanoiapsychopathfeardeathmurder |
Mood: | slasher |
Locations: | car |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boyteenage girlteenager |
Period: | 1970s |
Story: | horror movie remadepsycho filmgrindhouse filmfemale victimhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil manblood splatterhouse of horrorsdead teenagerdrive in classicmurder spree …creepyweirdono endingserial murderhuman monsterbad guyyellingmadmanbody countmercilessnesswoman in jeopardymasked mangrindhousepsychoblockbusterlifting someone into the airmutilationmaniackillingfirst partmurdererstalkingfirst of serieslow budget filmrunningfalling from heightsurprise endingknifeviolence (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou …nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
Subgenre: | survival horrorindependent horroramerican horrortragedysuspensecult filmindependent film |
Themes: | near death experiencecannibalismpanicparanoiabrutalityescapefearmurderdeath |
Mood: | darkness |
Locations: | truckfarmkitchencemeterycar |
Characters: | terrorbrother sister relationshipboyfriend girlfriend relationship |
Story: | horror movie remademeat hookpsychotronic filmgrindhouse filmoffscreen killingradio newspickup truckman with glassesrunning out of gasescape attemptblood splatterfoot chasecontemporary settinghell on earthdrive in classic …midnight movieanthropophagusremadewrenchsocial decaybludgeoninghillbillyabandoned housefarmhouseloss of brotherone daypsychotronicmercilessnesscannibalskullgrindhousehammerbarngothiccult directordirectorial debutdeath of brotherfirst parttragic eventknocked outbeaten to deathfirst of seriesattackscreamingdangergravenews reportgraveyardcontroversyradiostabbed in the chestmassacresurvivallow budget filmrunningcorpsebeatingsurprise endingchaseknifebloodviolence (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
Subgenre: | slasher flickindependent horroramerican horrorteen horrorcult filmindependent film |
Themes: | evilpsychopathmurder |
Mood: | slasheravant garde |
Locations: | cemetery |
Characters: | slasher killerserial murdererself mutilationserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationship |
Story: | horror movie remadegrindhouse filmhomicidal maniacpsychopathic killerevil manblood splatterfoot chasedead teenagerdrive in classicremadedisturbingdeath of boyfriendcreepbutcherysledgehammer …serial murderbad guymadmancharacters killed one by onebody countbutchervictimgrindhousepsycholifting someone into the airgothicmaniaccult directorfirst partstalkingfirst of seriesstabbed in the chestdeath of friendfalling from heightcorpsesurprise endingbloodviolence (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t …he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
Subgenre: | independent film |
Themes: | sadisminsanitybrutalitypsychopathtorturekidnappingdeathmurder |
Mood: | slasher |
Locations: | texasgas stationroad tripwheelchair |
Characters: | serial killerboyfriend girlfriend relationship |
Period: | 1970s |
Story: | meat hookchainsaw murdermasked villainmasked killerevil mancar troubleblood splattertool in titlegroup of fivebased on ed geinleatherfaceanthropophagusgas station attendantsole survivorslaughterhouse …hillbillyhuman monstertank topbody countcannibalfull moonhitchhikerlifting someone into the airgroup of friendsmutilationchainsawmaniaccowdirectorial debutchickenpigvanimpalementmassacrerunningvoice over narrationsurprise endingknifeviolenceblood (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
Subgenre: | psycho thrilleramerican horrorsuspensecult filmindependent film |
Themes: | madnessinsanitypsychopathfeardeathmurder |
Mood: | darknessslasher |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationships |
Story: | victim invited to dinnerscreaming in fearhorror movie remadepsycho filmgrindhouse filmfemale victimhomicidal maniacscreaming in horrorpsychopathic killerrotting corpsethreatened with a knifehouse of horrorsbased on ed geinlifting a female into the airdrive in classic …murder spreeremadebloody violencedisturbingweirdodisturbed individualbutcheryserial murderabandoned houseslashinghuman monsterold dark housebad guymadmancharacters killed one by onebloodbathbody countbutcherskullvictimgrindhousepsychoblockbusterlifting someone into the airmutilationmaniaccross dressingkillingfirst partmurderercountrysidefirst of seriesstabbed in the chestcorpsevoice over narrationsurprise endingphotographviolenceblood (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | independent horroramerican horrorsuspenseindependent film |
Themes: | exploitationevilsadisminsanitybrutalitypsychopathescapetorturedeathmurder |
Mood: | slasher |
Characters: | self mutilationserial killerterrorvillainkillerhostageteenage girlteenager |
Story: | psychotronic filmgrindhouse filmhomicidal maniacmasked villainpsychopathic killermasked killerevil manescape attemptblood splatterthreatened with a knifefoot chasemurder spreesadisticcut handbutchery …macabreheld captiveserial murderslashinghuman monsterbad guycharacters killed one by onebloodbathbody countpsychotronicbutchermercilessnesswoman in jeopardycovered in bloodrampagemasked manvictimpsychospiderhammermutilationmaniacfirst partscreamingdangertied to a chairstabbed in the chestimpalementflashlightsurvivalcorpsebeatingsurprise endingknifeviolenceblood (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | slasher flickamerican horrorcult filmindependent film |
Themes: | evilsadisminsanitybrutalitypsychopathfearmurderfriendshipdeath |
Mood: | slasher |
Locations: | car |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshipteenager |
Story: | victim invited to dinnerpsychotronic filmpsycho filmgrindhouse filmhomicidal maniacfacial scarkilling spreescreaming womanhit by a truckpsychopathic killerevil manblood splatterfoot chasebrutallifting a female into the air …gruesomedrive in classicmidnight moviemurder spreesadisticbloody violencedeath of boyfriendcut handserial murderslashingbad guymadmancharacters killed one by onebody countdamsel in distresstensionrampagevictimspiderlifting someone into the airloss of friendmutilationfreeze framemaniacsplatterkillingmurdererstalkingskeletonscreamingdangerdeath of friendimpalementflashlightfalling from heightsurprise endingchaseknifephotographviolenceblood (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent film |
Themes: | evilinsanityparanoiapsychopathdeathmurder |
Mood: | slasher |
Locations: | truckkitchen |
Characters: | slasher killerserial killerterrorvillainteenage boybrother sister relationshipteenage girlboyfriend girlfriend relationshipfamily relationshipsteenager |
Story: | female victimhomicidal maniacmasked villainpsychopathic killermasked killerevil mancar troubledead teenagermurder spreesadisticbloody violenceserial murderslashingbad guymadman …characters killed one by onebody countrampagemasked manvictimpsycholifting someone into the airloss of friendmaniacsplatterstalkingstabbed in the chestdeath of friendflashlightdecapitationfalling from heightchaseknifeviolenceblood (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | psycho thrillerindependent horroramerican horrorblack comedycult filmindependent film |
Themes: | evilsadisminsanitypsychopathescapetorturedeathmurder |
Mood: | darknessslasher |
Locations: | road trip |
Characters: | slasher killerserial murdererself mutilationserial killerterrorvillainkillerfamily relationshipsteenager |
Period: | 1970s |
Story: | homicidal maniackilling spreepsychopathic killerevil manblood splattergruesomedrive in classicmurder spreesadistictorturerdisturbingbloody violencecreepycreepbutchery …serial murderhuman monsterbad guymadmanbody countbutcherrampagevictimpsychomutilationgothicmaniackillingmurdererknocked outbeaten to deathstabbed in the chestimpalementfalling from heightknifebloodviolence (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | slasher flickamerican horrorteen horrorcult filmindependent film |
Themes: | evilpsychopathfeardeathmurder |
Mood: | slasher |
Locations: | wheelchairkitchen |
Characters: | slasher killerserial killervillainkillerteenage boyteenage girl |
Story: | homicidal maniackilling spreepsychopathic killermasked killerevil manblood splatterthreatened with a knifefoot chasedead teenagerlifting a female into the airserial murderabandoned househuman monsterold dark housebad guy …characters killed one by onebody countrampagemasked manskulllifting someone into the airchainsawmaniackillingmurdererskeletonproduct placementnews reportstabbed in the chestimpalementflashlightdecapitationfalling from heightcameracorpsesurprise endingchaseknifeviolenceblood (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | survival horrorsuspenseblack comedycult filmindependent film |
Themes: | panicexploitationinsanityparanoiabrutalityescapefeardeathmurderfriendship |
Mood: | ambiguous ending |
Locations: | gas stationtruckfarm |
Characters: | self mutilationboyfriend girlfriend relationship |
Story: | porch swinghit with a hammeroffscreen killingpickup truckescape attemptblood splatterthreatened with a knifefoot chasegroup of fivedecomposing bodymacabrehillbillyabandoned housesouthern accentcharacters killed one by one …covered in bloodtensionredneckgrindhousegroup of friendscult directorcowdirectorial debutpigknocked outproduct placementbeaten to deathscreamingradiotied to a chairstabbed in the chestdeath of friendimpalementmassacreambushsurvivaldecapitationcollegelow budget filmvomitingwritten by directorblondeurinationcorpsebeatingsurprise endingchaseknifephotographviolenceblood (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | slasher flickteen horrorsuspenseblack comedycult film |
Themes: | near death experienceparanoiabrutalitypsychopathescapefeardeathmurderfriendship |
Mood: | darknessslasher |
Locations: | kitchen |
Characters: | slasher killerserial killervillainkillerteenage boybrother sister relationshipteenage girlboyfriend girlfriend relationshipfamily relationshipsteenager |
Story: | woman in dangermasked killerpsychological tortureescape attemptblood splatterthreatened with a knifefoot chasedead teenagercut armdeath of boyfriendyellingcharacters killed one by onelens flarejumping through a windowdamsel in distress …covered in bloodmasked manlifting someone into the airgroup of friendsropecult directorfirst partstalkingproduct placementfirst of seriesdangernews reportvantied to a chairstabbed in the chestdeath of friendbound and gaggedflashlightsurvivalfalling from heightblondecorpsesurprise endingchaseknifebloodviolence (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
Subgenre: | suspensecult film |
Themes: | panicsadisminsanityparanoiabrutalitypsychopathdeathmurder |
Mood: | darknessslasher |
Locations: | truckwheelchairkitchencemeterycar |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationship |
Period: | 1970s |
Story: | psychotronic filmgrindhouse filmfemale victimhomicidal maniackilling spreehit by a truckpsychopathic killerblood splatterbrutalgruesomedrive in classicmurder spreetorturerdisturbingclose up of eye …butcherymacabreeyeballserial murderslashinghuman monsterclose up of eyescharacters killed one by onebody counthit on the headbutchermutemercilessnessrampagevictimgrindhousegothicmaniackillingcult directormurdererstalkingskeletonscreamingdangergraveyardimpalementflashlightsurvivaldecapitationrunningvomitingcameracorpsebeatingsurprise endingchaseknifephotographviolenceblood (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit …h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
Subgenre: | psycho thrillertragedy |
Themes: | madnesscannibalismevilsadismbrutalitypsychopathtorturekidnappingdeathmurder |
Mood: | slasher |
Locations: | gas station |
Characters: | serial killerterrorvillainkillerteenage boybrother sister relationshipteenage girlfamily relationships |
Story: | homicidal maniackilling spreepsychopathic killerevil manblood splatterfoot chaseinbreedinganthropophagusgas station attendantbloody violenceserial murderhuman monsterbad guyhysteriamadman …body countcannibalrampagevictimmutilationmaniacsplatterkillingfirst partmurdererglassescontroversystabbed in the chestimpalementfalling from heightsurprise endingviolenceblood (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
Subgenre: | slasher flickamerican horrorteen horrorcult film |
Themes: | panicevilsadismparanoiabrutalitypsychopathescapefearkidnappingfriendshipmurderdeath |
Mood: | darknessslasher |
Characters: | slasher killerserial murdererself mutilationserial killerterrorvillainkillerteenage boybrother sister relationshipteenage girlboyfriend girlfriend relationshipfamily relationshipsteenager |
Story: | psychotronic filmgrindhouse filmhomicidal maniackilling spreepsychopathic killerevil manescape attemptblood splatterthreatened with a knifefoot chasehell on earthdrive in classicmurder spreesadisticcut arm …caged animalno endingleg injurybutcheryserial murderslashingurban legendbad guymadmanbody countbarbecuehit on the headbutcherdamsel in distresscovered in bloodfull moonrampagegrindhousepsycholifting someone into the airmutilationgothicmaniacmurdererscreamingstabbed in the chestimpalementmassacresunglassessurprise endingchaseknifeviolenceblood (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | psycho thrillersurvival horroramerican horrorblack comedycult filmindependent film |
Themes: | cannibalismevilsadisminsanitypsychopathkidnappingdeathmurder |
Mood: | darknessslasher |
Characters: | terrorvillainbrother sister relationship |
Story: | grindhouse filmhomicidal maniacpsychopathic killerevil manblood splatterhouse of horrorssickoanthropophagusmurder spreedisturbed individualserial murderslashinghuman monsterold dark housebad guy …madmanbody countcannibalrampagemasked manskullgrindhousepsychospidermutilationgothicmaniaccult directorskeletonvanimpalementflashlightcorpseknifebloodviolence (See All) |
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the …mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
Subgenre: | survival horrorindependent horroramerican horrorblack comedycult filmindependent film |
Themes: | near death experiencecannibalismpanicexploitationsadismparanoiabrutalityescapefearkidnappingmurderdeath |
Locations: | truckfarmcar |
Characters: | villainhostageboyfriend girlfriend relationship |
Period: | 1970s |
Story: | horror movie remadegrindhouse filmhit with a hammeroffscreen killingradio newshit by a truckescape attemptblood splatterthreatened with a knifecontemporary settinghell on earthdrive in classicmidnight movieanthropophagusremade …bloody violencedecomposing bodydeath of boyfriendwrenchsocial decaysledgehammerhillbillyvomitbad guyhysteriabody countcigarette lighterpsychotronicbutchercannibalmercilessnesscovered in bloodredneckgrindhousehammerbeardcult directorscarknocked outattackscreamingdangernews reportvancontroversyradiostabbed in the chestdeath of friendmassacreambushsurvivaldecapitationlow budget filmsunglassesvomitingfalling from heightwritten by directorcameracorpsebeatingsurprise endingchaseknifephotographviolenceblood (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathdeathmurder |
Mood: | slasher |
Locations: | cemetery |
Characters: | slasher killerserial murdererself mutilationserial killerterrorvillainkillerteenager |
Story: | homicidal maniackilling spreepsychopathic killerevil manwheelchair boundblood splatterfoot chasedead teenagerlifting a female into the airdrive in classicmurder spreesadisticbonesbloody violencedisturbing …creepycut armbutcheryserial murderabandoned houseslashingbad guymadmancharacters killed one by onebody countjumping through a windowbutchermuterampagevictimlifting someone into the airmaniacsplatterkillingmurdererskeletonscreamingradiostabbed in the chestdeath of friendimpalementdecapitationfalling from heightcorpsesurprise endingviolence (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
Subgenre: | slasher flickteen horrorsuspenseblack comedycult film |
Themes: | near death experiencesadisminsanityparanoiapsychopathescapefeardeathmurder |
Mood: | slasher |
Characters: | serial killerkillerhostageboyfriend girlfriend relationshipteenager |
Story: | offscreen killingkilling spreemasked killerescape attemptblood splatterthreatened with a knifefoot chasecut armdeath of boyfriendclose up of eyescharacters killed one by onebody countlens flaremercilessnessmasked man …blockbustergroup of friendskillingcult directorstalkingscarknocked outproduct placementattackscreamingnews reportvandouble crossstabbed in the chestdeath of friendimpalementambushflashlightsurvivalcollegesunglassesurinationcorpsebeatingsurprise endingchaseknifeviolenceblood (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | psycho thrilleramerican horrortragedysuspensecult filmindependent film |
Themes: | madnesspanicparanoiapsychopathfeardeathmurder |
Mood: | slasher |
Locations: | truckwheelchaircar |
Characters: | serial murdererself mutilationserial killervillainboyfriend girlfriend relationship |
Period: | 1970s |
Story: | screaming in fearpsychotronic filmgrindhouse filmhomicidal maniacpsychopathic killerman with glassesblood splattercontemporary settingdrive in classicserial murderslashingbad guysouthern accentbody countpsychotronic …mercilessnessrampagegrindhousemutilationgothicmaniaccult directormurderertragic eventscarproduct placementdangernews reportstabbed in the chestflashlightfalling from heightcorpsesurprise endingchasephotographblood (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
Subgenre: | survival horrorsuspenseblack comedycult filmindependent film |
Themes: | near death experiencepanicparanoiaescapefearkidnappingdeathmurder |
Locations: | farmkitchen |
Characters: | hostagebrother sister relationshipteenage girlboyfriend girlfriend relationshipfamily relationshipsteenager |
Story: | psychotronic filmevil laughterpickup truckescape attemptblood splatterruraldeath of boyfriendscene before opening creditsfarmhouseclose up of eyessouthern accentlaughingone daycigarette lighterpsychotronic …mercilessnessdamsel in distresswoman in jeopardyredneckbarncowfirst partknocked outfirst of seriesscreamingdangernews reportradioimpalementambushflashlightsurvivalcorpsesurprise endingknifephotographviolenceblood (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent film |
Themes: | evilpsychopathescapemurderdeath |
Mood: | slasher |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boyteenage girl |
Story: | homicidal maniacmasked villainpsychopathic killermasked killerevil manblood splatterdead teenagerlifting a female into the airmurder spreebutcheryserial murderbad guymadmancharacters killed one by onebody count …butcherrampagemasked manpsycholifting someone into the airmutilationmaniacimpalementflashlightdecapitationviolenceblood (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | madnessevilsadisminsanitybrutalitypsychopathescapetorturekidnappingdeathmurder |
Mood: | slasher |
Locations: | cemeterycar |
Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage girlfamily relationships |
Period: | 1970s |
Story: | horror movie remadehomicidal maniacpsychopathic killerevil manrunning out of gasblood splatterpocket knifefoot chasedrive in classicsickobanned filmsadisticdisturbingbloody violencedisturbed individual …held captivefilm starts with textserial murderhuman monsterbad guymadmanbloodbathhippiewoman in jeopardyhitchhikingvictimgrindhousemutilationchainsawmaniackillingcult directordirectorial debutchickenmurdererscreamingcontroversybound and gaggedurinationknifeviolenceblood (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | black comedycult film |
Themes: | near death experiencepanicsadismparanoiabrutalitypsychopathescapefearkidnappingmurderdeath |
Mood: | slasher |
Locations: | road tripkitchencemetery |
Characters: | serial killerhostageteenage boyteenage girlboyfriend girlfriend relationshipteenager |
Story: | homicidal maniacevil laughterhit by a truckescape attemptblood splattermurder spreedecomposing bodyscene before opening creditsface maskhysteriaclose up of eyescigarette lighterdark humordamsel in distresswoman in jeopardy …skullspidermutilationgothicchainsawmaniactied upstalkingscarskeletonknocked outscreamingdangernews reportgraveyardvandouble crosstied to a chairstabbed in the chestimpalementambushflashlightcorpsebeatingsurprise endingchaseknifephotographviolenceblood (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
Subgenre: | slasher flickcult filmindependent film |
Themes: | madnesscannibalismsadisminsanitytorturefearkidnappingmurderdeath |
Mood: | slasher |
Locations: | gas stationroad tripcemetery |
Characters: | slasher killerserial killerbrother sister relationshipboyfriend girlfriend relationshipfamily relationships |
Period: | 1970s |
Story: | victim invited to dinnerman with glassesevil manblood splatterthreatened with a knifedeath of boyfriendhuman monsterold dark houseurban legendmadmanmasked manhitchhikerskullpsycholifting someone into the air …maniaccult directortied uppigskeletongravegraveyardtied to a chairstabbed in the chestbound and gaggedcorpsebeatingsurprise endingchaseknifephotographbloodviolence (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | exploitationevilsadismbrutalitypsychopathtorturefearkidnappingdeathmurder |
Mood: | slasher |
Locations: | countrygas stationcar |
Characters: | serial murdererserial killervillainkiller |
Period: | 1970s |
Story: | grindhouse filmfemale victimkilling spreepsychopathic killerman with glassesevil mangruesomedrive in classicbanned filmmurder spreesadisticdisturbingcreepyheld captiveserial murder …human monstercharacters killed one by onebody countmercilessnesslow budgetwoman in jeopardyredneckvictimgrindhousemutilationkillingmurdererglassesscreaminggravecontroversylow budget filmbeatingknifebloodviolence (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | psycho thrillerslasher flicksuspenseblack comedyindependent film |
Themes: | near death experiencemadnesspanicinsanityparanoiapsychopathescapefearkidnappingmurderdeath |
Mood: | darknessslasher |
Locations: | car |
Characters: | slasher killerhostage |
Story: | victim invited to dinnerfemale victimpickup truckcar troublepsychological tortureescape attemptblood splatterfoot chasewrenchyellingcharacters killed one by onebody countone daydamsel in distresswoman in jeopardy …covered in bloodtensionmaniacstalkingknocked outproduct placementattackscreamingdouble crosstied to a chairbound and gaggedflashlightsurvivalrunningcorpsebeatingsurprise endingchaseknifeviolenceblood (See All) |
After the first massacre in 1974, the townspeople suspected that the Sawyer family were responsible. A vigilante mob of enraged locals surrounded the Sawyer house, burning it to the ground and killing every last member of the family. Decades later, a young woman named Heather learns that she has inh …erited a Texas estate from her grandmother. She decides to bring her friends along on the road trip to investigate her inheritance. On arrival, she discovers she has inherited a mansion, but is yet to uncover the terrors that lurk in the basement underneath it. (Read More)
Subgenre: | slasher flick |
Themes: | inheritancedeathmurder |
Mood: | slasher |
Locations: | texasroad tripcemetery |
Characters: | slasher killerkiller |
Period: | 1970s |
Story: | wearing human skinmeat grinderpsychotronic filmchainsaw murdergrindhouse filmhit with a hammermasked killerblood splatterfoot chaseleatherfacemidnight movieboneslaughterhouseestatecharacters killed one by one …masked manhitchhikerbarnchainsawkillinggrandmotherscarknocked outbeaten to deathgraveyardstabbed in the chestimpalementmassacrebound and gaggedcorpsephotographblood (See All) |
After a car accident, Michelle awakens to find herself in a mysterious bunker with two men named Howard and Emmett. Howard offers her a pair of crutches to help her remain mobile with her leg injury sustained from the car crash and tells her to "get good on those" before leaving the bunker. She has …been given the information that there has been an alien attack and the outside world is poisoned. However, Howard and Emmett's intentions soon become questionable and Michelle is faced with a question: Is it better in here or out there? (Read More)
Subgenre: | psycho thrillersuspenseblack comedy |
Themes: | near death experiencepanicparanoiaescapefearkidnappingmurderdeath |
Mood: | ambiguous endingdarkness |
Locations: | gas stationtruckfarmkitchencar |
Characters: | hostage |
Story: | yelling for helppsychotronic filmoffscreen killingradio newsdinner tablepickup truckescape attemptthreatened with a knifedreadruralleg injurysole survivorheld captivescene before opening creditsfarmhouse …human monsterminimal castclose up of eyescigarette lighterdamsel in distresswoman in jeopardytensionredneckbeardbarndirectorial debutpigstalkingscarattackscreamingdangernews reportdouble crossradiodinnerstabbed in the chestambushflashlightsurvivalcorpsesurprise endingchaseknifephotographblood (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | survival horrorslasher flickteen horrorindependent film |
Themes: | near death experiencepanicbrutalityescapefearkidnappingdeathmurderfriendship |
Mood: | ambiguous endingslasher |
Characters: | slasher killerserial killerkillerhostageteenage boyteenage girlteenager |
Story: | psychotronic filmgrindhouse filmmasked killerescape attemptfoot chasescream queenurban legendface maskcharacters killed one by onebody countjumping through a windowcigarette lightermercilessnessmasked manbarn …scarscreamingdangervandouble crossstabbed in the chestimpalementambushsurvivaldecapitationvomitingblondesurprise endingchaseknifeviolence (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | cannibalismevilinsanitypsychopathtorturedeathmurder |
Mood: | slasher |
Characters: | slasher killerserial killerterrorvillain |
Story: | psychotronic filmgrindhouse filmhomicidal maniackilling spreepsychopathic killerevil manblood splattersickosadisticbloody violenceno endingsledgehammerserial murderhuman monsterbad guy …madmanbody countcannibalrampagepsychoropemaniacsplattertragic eventbeaten to deathstabbed in the chestimpalementsurvivalfalling from heightcorpsesurprise ending (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
Themes: | exploitationevilinsanitybrutalitypsychopathdeath |
Mood: | darknessslasher |
Characters: | serial killer |
Story: | screaming in fearfemale victimhomicidal maniackilling spreepsychopathic killerevil manblood splattersadisticbloody violencefilm starts with textserial murderslashinghuman monsterbad guycharacters killed one by one …body counthippiecovered in bloodrampagevictimmaniacmurdererglassesstalkingscarattackstabbed in the chestdeath of friendimpalementflashlightdecapitationvomitingcameraurinationcorpsebeatingchaseviolenceblood (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
Subgenre: | teen horrorsuspenseblack comedyindependent film |
Themes: | paranoiabrutalitypsychopathescapefeardeathmurder |
Mood: | ambiguous endingslasher |
Characters: | terrorvillainboyfriend girlfriend relationshipteenager |
Story: | female victimoffscreen killingwoman in dangermasked villainpsychopathic killermasked killerevil manblood splatterthreatened with a knifedeath of boyfriendslashinghuman monsterface maskmadmancharacters killed one by one …tank topjumping through a windowcovered in bloodrampagemasked manvictimmutilationstalkingbeaten to deathdangerstabbed in the chestimpalementmassacreambushflashlightsurvivaldecapitationfalling from heightcorpsebeatingsurprise endingchaseknifeviolenceblood (See All) |
After returning from a wedding reception, a couple staying in an isolated vacation house receive a knock on the door in the mid-hours of the night. What ensues is a violent invasion by three strangers, their faces hidden behind masks. The couple find themselves in a violent struggle, in which they g …o beyond what either of them thought capable in order to survive. (Read More)
Subgenre: | survival horrorsuspenseindependent film |
Themes: | panicparanoiapsychopathtorturefearmurder |
Mood: | slasher |
Locations: | kitchen |
Characters: | serial killerterrorboyfriend girlfriend relationship |
Story: | homicidal maniacmasked villainmasked killerpickup truckevil manpsychological tortureblood splatterfoot chasewriting in bloodcut handfilm starts with textswingcovered in bloodmasked manvandalism …barnstalkingknocked outtied to a chairstabbed in the chestdeath of friendflashlightwritten by directorcorpsebeatingsurprise endingknifebloodviolence (See All) |