Please wait - finding best movies...
Radio DJ Vanita 'Stretch' Brock's open request night is plagued by the annoying phone pranking of two road tripping, party-hard, hoodlums, but things take a disturbing turn when the hoodlums meet their demise at the hands of familiar chainsaw wielding maniacs. With the entire gruesome ordeal recorde …d on tape, Stretch seeks out the help of a former Texas Marshall who's on a personal quest of vengeance against this family of cannibals. While at first he turns her down, he eventually decides to use her tape to his advantage, asking her to air it during her request block- effectively baiting the cannibals to the radio station where he'll personally deal with them. (Read More)
| Subgenre: | sadistic horrorpsycho thrillersurvival horrorslasher flickindependent horroramerican horrorcampyabsurdismb moviedark comedyblack comedycult filmindependent film |
| Themes: | near death experiencemadnessself sacrificecannibalismpanicexploitationhome invasionevilsadisminsanitydysfunctional familyparanoiabrutalitypsychopathanger …deceptioninvestigationescapedrunkennesstorturefearkidnappingsuicidemurderrevengedeath (See All) |
| Mood: | car chaseambiguous endingslashernightparodysatiregore |
| Locations: | cave inback countrytunneltexascavetruckroad tripwheelchairelevator |
| Characters: | slasher killerpolice lieutenantserial murdererserial killerself mutilationterrorvillainkillerhostagepolice officerteenage boypoliceteenager |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerwearing human skinmeat hookcannibal familypsychotronic filmpsycho filmchainsaw fightchainsaw murdergrindhouse filmhit with a hammerhomicidal maniackilling spreedallas texas …evil familyevil laughterradio hostradio djvillain not really dead clichemasked villainradio showradio stationcowboy hatpsychopathic killermasked killerpickup truckevil manfinal showdownpsychological tortureescape attemptfoot chasereference to sonny bonoabandoned amusement parkgory violencehole in floorreference to bonodriving backwardscut headchillibased on ed geinfemale djcult favoritepower toolstabbed through the chestchilileatherfacebrutaleating human fleshvictimizationhell on earthsplit headman eatermusic score composed by directorthrown from heightcar phonescream queengruesomedrive in classicstate trooperbased on supposedly true storyover the topstar spangled bannermidnight movieentrailssevered facespit takestate in titleanthropophagushoodlummurder spreesadistictorturerbonesbloody violencedisturbingfalling through the floordecomposing bodydinner tablehigh school seniorpranksterweirdoskingross out humorhands tiedextreme violencelifting person in aircrime spreetoothstupid victimvinylchantinghookfreewayrecreational vehiclebutcherywoman fights a mansledgehammerrepeated lineshrinesubterraneanslaughterhouseaudio cassettewoman kills a manhead injurycarnagefilm starts with textone linerhillbillyserial murderslashinghuman monstertowersequel to cult favoritefire extinguishervietnam veterandirector cameoface maskbad guyharassmentmadmansouthern accentgothblood on shirtfight to the deathcharacters killed one by onereckless drivingpsychoticlens flarebody countraised middle fingerbody landing on a carlaughingfalling to deathlieutenantwisecrack humorone daypunched in the chestcigarette lighteramusement parkdisembowelmentdark humorpsychotronicbutcherdual wieldmutechaoscannibalmercilessnesshatredreverse footagedamsel in distresswoman in jeopardycrime scenefemale warriorpresumed deadsocial commentaryrampageredneckmasked manfollowing someonecarnivalskullgrindhousepsychochefeccentrichammerlifting someone into the airelectronic music scoresociopathgothicjeephead buttfalling down stairshand grenadedestructioneavesdroppingchainsawrecord playermaniacnewspaper headlinekillingcult directorobscene finger gesturetypewriterhandgunprofanitytied upmurdererexploding bodyrathigh school studentautomobileconteststalkingcountrysideconvertibleopening action sceneprankkicked in the facetough girlskeletoncover upproduct placementmini skirtbeaten to deathcowboyattackstabbed in the backattempted murderpuppetscreamingdangerpolice officer killednews reportdouble crossradioman with glassessevered headtied to a chairstabbed in the chestdeath of friendbridgeambushflashlightsurvivaldecapitationf wordtelephonerevolvercar crashrunningsecond partsunglassesshowdownfalling from heightwatching tvpunched in the faceslow motion scenerescuecar accidentblood splatterdigit in titlecorpsebeatingpistolsurprise endingchaseknifepartysingingexplosiondancingcigarette smokingnumber in titlesequelviolencefightbloodgun (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | psycho thrillersurvival horrorslasher flickindependent horroramerican horrorblack comedycult filmindependent film |
| Themes: | near death experiencemadnesscannibalismpanicexploitationevilsadisminsanitydysfunctional familyparanoiabrutalitypsychopathescapetorturefear …kidnappingmurderdeath (See All) |
| Mood: | ambiguous endingslasher |
| Locations: | back countrytexastruckroad tripwheelchair |
| Characters: | slasher killerserial murdererserial killerself mutilationterrorvillainkillerhostageteenage boyteenager |
| Story: | wearing human skinmeat hookcannibal familypsychotronic filmpsycho filmchainsaw murdergrindhouse filmhit with a hammerhomicidal maniackilling spreeevil familyevil laughtermasked villainpsychopathic killermasked killer …pickup truckevil manpsychological tortureescape attemptfoot chasebased on ed geinpower toolleatherfacebrutaleating human fleshhell on earthman eaterscream queengruesomedrive in classicmidnight moviestate in titleanthropophagusmurder spreesadistictorturerbonesdisturbingbloody violencedecomposing bodydinner tableskinweirdolifting person in airtoothbutcherysledgehammershrineslaughterhousefilm starts with texthillbillyserial murderslashinghuman monsterface maskbad guymadmansouthern accentcharacters killed one by onelens flarebody countlaughingone daycigarette lighterdark humorpsychotronicbutchermutecannibalmercilessnessdamsel in distresswoman in jeopardyredneckrampagemasked manskullgrindhousepsychohammerlifting someone into the airgothicchainsawmaniackillingcult directortied upmurdererstalkingcountrysideskeletonproduct placementbeaten to deathattackscreamingdangernews reportdouble crossradioman with glassestied to a chairstabbed in the chestdeath of friendambushflashlightsurvivaldecapitationrunningsunglassesfalling from heightblood splattercorpsebeatingsurprise endingchaseknifeviolenceblood (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | sadistic horrorpsycho thrillerindependent horroramerican horrorcult film |
| Themes: | evilsadisminsanitybrutalitypsychopathtorturedeathmurder |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boy |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killergrindhouse filmhomicidal maniackilling spreevillain not really dead clichemasked villainpsychopathic killermasked killerevil mangory violencegruesomedrive in classicmurder spree …torturerbloody violencedisturbingextreme violencecrime spreebutcheryhillbillyserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countbody landing on a cardisembowelmentbutcherrampageredneckmasked mangrindhousepsycholifting someone into the airmaniackillingobscene finger gesturemurdererstalkingstabbed in the backsevered headdecapitationblood splattercorpsesurprise endingnumber in titleviolencebloodsequel (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | psycho thrillerindependent horroramerican horrorcult film |
| Themes: | exploitationevilinsanitybrutalitypsychopathfeardeathmurder |
| Mood: | slashergore |
| Locations: | wheelchair |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenager |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerpsychotronic filmgrindhouse filmhomicidal maniackilling spreevillain not really dead clichemasked villainpsychopathic killermasked killerevil manbrutalgruesomedrive in classic …murder spreesadistictorturerbloody violencedisturbingweirdocrime spreebutcheryhillbillyserial murderslashinghuman monsterbad guymadmancharacters killed one by onepsychoticlens flarebody countpsychotronicbutcherrampageredneckmasked mangrindhousepsycholifting someone into the airgothicchainsawmaniackillingobscene finger gesturemurdererstalkingconvertibleopening action scenesevered headdecapitationsecond partslow motion sceneblood splatterdigit in titlecorpsesurprise endingnumber in titleviolencefightbloodsequel (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
| Themes: | exploitationevilsadisminsanitybrutalitypsychopathfearrevengemurderdeath |
| Mood: | slashernightgore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenagerpolice |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerpsychotronic filmgrindhouse filmhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil mangory violencedrive in classicmurder spreebloody violence …weirdoextreme violencecrime spreebutcheryhillbillyserial murderslashinghuman monstersequel to cult favoritebad guymadmancharacters killed one by onepsychoticbody countpsychotronicbutcherredneckrampagemasked mangrindhousepsycholifting someone into the airchainsawmaniackillingobscene finger gesturemurdererstalkingdecapitationblood splatterdigit in titlesurprise endingchasedancingnumber in titlebloodviolencesequel (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | sadistic horrorpsycho thrillerblack comedycult filmindependent film |
| Themes: | near death experiencemadnessself sacrificecannibalismexploitationevilsadisminsanityparanoiabrutalitypsychopathangerdeceptionescapetorture …fearkidnappingsuiciderevengemurderdeath (See All) |
| Mood: | ambiguous endinggore |
| Locations: | texasroad trip |
| Characters: | serial killerterrorvillainhostagepolice officerpolice |
| Story: | grindhouse filmhomicidal maniackilling spreecowboy hatpsychopathic killerevil manpsychological tortureescape attemptfoot chasesevered faceentrailsmurder spreesadisticcrime spreebutchery …film starts with textserial murderhuman monsterface maskbad guymadmansouthern accentgothblood on shirtbody countwisecrack humorone daypunched in the chestcigarette lighterbutchermercilessnesscannibalhatredcrime sceneredneckrampagemasked mangrindhousehead buttmaniaccult directorobscene finger gestureprofanitymurdereropening action scenebeaten to deathattackstabbed in the backscreamingpolice officer killednews reportdouble crosstied to a chairstabbed in the chestdeath of friendambushsurvivalf wordrevolversecond partshowdownpunched in the faceslow motion scenerescueblood splattercorpsebeatingpistolchaseknifeexplosioncigarette smokingsequelbloodviolence (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | psycho thrillerslasher flickamerican horrorcult film |
| Themes: | evilinsanitypsychopathmurderdeath |
| Mood: | car chaseslashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenagerpolice |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmhomicidal maniackilling spreevillain not really dead clichemasked villainpsychopathic killermasked killerevil mangory violencebrutaldrive in classicmurder spree …bloody violencerecreational vehiclebutcheryserial murderslashingsequel to cult favoritebad guymadmanbody countbutcherrampagemasked manpsycholifting someone into the airgothicmaniackillingmurdererstalkingsevered headflashlightdecapitationblood splattersurprise endingnumber in titleviolencesequel (See All) |
| Subgenre: | survival horrorslasher flickblack comedycult filmindependent film |
| Themes: | near death experiencecannibalismpanichome invasioninsanityparanoiabrutalitypsychopathescapetorturefearkidnappingdeathrevengemurder |
| Mood: | slashergore |
| Locations: | cavetruck |
| Characters: | slasher killerself mutilationhostagepolice officerteenage boyteenager |
| Story: | evil laughtervillain not really dead clichepickup truckpsychological torturefoot chasevictimizationstate trooperstupid victimslaughterhousehillbillyhuman monstersouthern accentblood on shirtcharacters killed one by onebody count …one daymercilessnesscannibaldamsel in distressrednecknewspaper headlinestalkingprankstabbed in the backscreamingdangerpolice officer killedsevered headstabbed in the chestdeath of friendambushflashlightsurvivaldecapitationcar crashshowdownfalling from heightslow motion scenerescuecar accidentblood splattercorpsebeatingpistolsurprise endingchaseknifeexplosioncigarette smokingbloodviolence (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | psycho thrillerindependent horroramerican horrorcult filmindependent film |
| Themes: | exploitationhome invasionevilinsanitybrutalitypsychopathtorturedeathmurder |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkiller |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killergrindhouse filmhomicidal maniackilling spreepsychopathic killerevil mangruesomebased on supposedly true storymurder spreesadisticextreme violencecrime spreebutchery …serial murderslashinghuman monsterbad guymadmanbody countdark humorpsychotronicbutcherrampagepsychomaniackillingstalkingattacksevered headstabbed in the chestdecapitationblood splattersurprise endingbloodgunviolence (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | psycho thrillerslasher flickamerican horror |
| Themes: | home invasionevilsadisminsanitydysfunctional familybrutalitypsychopathtorturekidnappingsuicidedeathmurder |
| Mood: | slashernightgore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhostageteenager |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmkilling spreevillain not really dead clichemasked villainpsychopathic killermasked killerevil mangory violencebrutalmurder spreesadistictorturer …bloody violencedisturbingweirdoextreme violencecrime spreebutcherycarnageserial murderslashinghuman monsterbad guymadmancharacters killed one by onepsychoticbody countbutchercrime scenerampagemasked manpsycholifting someone into the airelectronic music scoremaniackillingprofanitymurdererstalkingbeaten to deathattackstabbed in the backstabbed in the chestf wordfalling from heightblood splattercorpsebeatingpistolchaseknifeviolenceblood (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
| Subgenre: | psycho thrillerslasher flickamerican horrorcult film |
| Themes: | madnessinsanityparanoiabrutalitypsychopathtorturefeardeathmurder |
| Mood: | slashernightgore |
| Locations: | wheelchair |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolice officerteenagerpolice |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmgrindhouse filmhomicidal maniacvillain not really dead clichemasked villaincowboy hatpsychopathic killermasked killerdrive in classicmurder spreetorturerbloody violence …disturbingextreme violencebutcheryserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countcigarette lighterbutchermutemercilessnesspresumed deadrampagemasked mangrindhousepsycholifting someone into the airhammerelectronic music scoredestructionmaniacmurdererstalkingproduct placementbeaten to deathstabbed in the backattempted murderscreamingnews reportflashlightrevolversecond partwatching tvcar accidentblood splatterchaseknifeexplosioncigarette smokingnumber in titleviolencebloodsequel (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent film |
| Themes: | evilsadisminsanitybrutalitypsychopathfearmurderrevengedeath |
| Mood: | slashernightgore |
| Locations: | truck |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolice officerteenage boyteenagerpolice |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmgrindhouse filmhomicidal maniackilling spreevillain not really dead clichepsychopathic killergruesomedrive in classicmurder spreesadisticdisturbingbloody violence …weirdoextreme violencecrime spreebutcheryserial murderslashinghuman monstercharacters killed one by onepsychoticlens flarebody countdisembowelmentpsychotronicbutchermutemercilessnessrampagegrindhousepsychohammerelectronic music scoregothicjeepmaniackillingmurdererstalkingprankscreamingdangerdecapitationrunningslow motion sceneblood splatterdigit in titlecorpsebeatingsurprise endingnumber in titleviolence (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
| Subgenre: | psycho thrillersurvival horroramerican horrorblack comedy |
| Themes: | near death experiencecannibalismpanicinsanityparanoiabrutalitypsychopathdeceptionescapefearkidnappingdeathmurder |
| Mood: | slashergore |
| Locations: | tunnel |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhostagepolice officerteenager |
| Story: | psycho terrorsadistic psychopathpsycho killerhomicidal maniackilling spreepsychopathic killerevil manescape attempteating human fleshanthropophagusdisturbingbloody violenceweirdoserial murderhuman monster …director cameobad guycharacters killed one by onebody countmercilessnesscannibaldamsel in distresswoman in jeopardyrampagepsychoeccentricsociopathmaniackillingmurdererhigh school studentstalkingattempted murderdangernews reportdouble crossman with glassesdeath of friendflashlightsurvivalsecond partwatching tvrescuecorpsesurprise endingchaseknifepartydancingsequelviolenceblood (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those …friends. (Read More)
| Subgenre: | slasher flickamerican horrorcult film |
| Themes: | exploitationpsychopathdeathmurderrevenge |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boyteenager |
| Period: | 1980s |
| Story: | sadistic psychopathpsycho killerpsychotronic filmgrindhouse filmhomicidal maniackilling spreemasked villainpsychopathic killermasked killerevil mangory violencecult favoritebrutalgruesomedrive in classic …murder spreedisturbingextreme violencecrime spreehillbillyserial murderslashinghuman monstersequel to cult favoritebad guymadmancharacters killed one by onepsychotronicrampagemasked mangrindhousepsycholifting someone into the airmaniacmurdererdigit in titlepartynumber in titlesequelblood (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | sadistic horrorslasher flickcult filmindependent film |
| Themes: | exploitationevilsadisminsanitybrutalitypsychopathescapedrunkennesstorturefearkidnappingmurderdeath |
| Mood: | car chaseslashernightgore |
| Locations: | cavetruckroad trip |
| Characters: | slasher killerserial murdererserial killerself mutilationterrorvillainkillerhostage |
| Story: | psycho terrorsadistic psychopathpsycho killergrindhouse filmhomicidal maniackilling spreevillain not really dead clichepsychopathic killerpickup truckevil mangory violencebrutalmurder spreebloody violencedecomposing body …extreme violencebutcheryfilm starts with textserial murderslashinghuman monsterbad guymadmanblood on shirtcharacters killed one by onebody countbutchermercilessnessredneckrampagepsychomaniackillingobscene finger gesturemurdererautomobilecountrysidestabbed in the backattempted murderdangerflashlightf wordsunglassesslow motion scenecar accidentblood splattercorpsechaseknifepartysingingexplosioncigarette smokinggunbloodviolence (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent film |
| Themes: | evilinsanitybrutalitypsychopathdrunkennesstorturefearkidnappingsuicidemurderrevengedeath |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boy |
| Story: | psycho terrorsadistic psychopathpsycho killerpsychotronic filmpsycho filmhomicidal maniackilling spreevillain not really dead clichemasked villainpsychopathic killermasked killerevil manfinal showdownfoot chasegory violence …brutalhell on earthgruesomemurder spreesadistictorturerbloody violencebutcheryserial murderslashingbad guymadmancharacters killed one by onebody countpsychotronicbutcherrampagemasked manpsycholifting someone into the airmaniackillingmurdererhigh school studentstalkingcover upsevered headdecapitationcar crashfalling from heightslow motion sceneblood splattercorpsepistolsurprise endingpartyexplosionsequelviolenceblood (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
| Subgenre: | slasher flickblack comedycult film |
| Themes: | near death experiencesadisminsanityparanoiapsychopathdeceptioninvestigationescapedrunkennessfearmurderdeathrevenge |
| Mood: | slashersatiregore |
| Characters: | serial killerkillerhostagepolice officerteenagerpolice |
| Story: | killing spreevillain not really dead clichemasked killerescape attemptfoot chasethrown from heightstupid victimwoman kills a mansequel to cult favoritedirector cameocharacters killed one by onebody countlens flarefalling to deathmercilessness …crime scenefemale warriorpresumed deadsocial commentarymasked manfalling down stairseavesdroppingkillingcult directorstalkingprankkicked in the facecover upproduct placementattackattempted murderstabbed in the backscreamingpolice officer killednews reportdouble crossstabbed in the chestdeath of friendambushflashlightsurvivalf wordtelephonecar crashsecond partsunglassesshowdownwatching tvpunched in the faceslow motion scenerescuecar accidentblood splatterdigit in titlecorpsebeatingpistolsurprise endingchaseknifepartysingingcigarette smokingnumber in titlesequelviolenceblood (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
| Subgenre: | black comedycult film |
| Themes: | near death experiencepanicsadismparanoiabrutalitypsychopathdeceptionescapefearkidnappingmurderdeathrevenge |
| Mood: | car chaseslashergore |
| Locations: | road trip |
| Characters: | serial killerhostagepolice officerteenage boyteenagerpolice |
| Story: | homicidal maniacevil laughtervillain not really dead clichefinal showdownescape attemptmurder spreedecomposing bodystupid victimrecreational vehiclerepeated linewoman kills a mansequel to cult favoriteface maskharassmentgoth …raised middle fingerwisecrack humorcigarette lighterdark humordual wielddamsel in distresswoman in jeopardypresumed deadskullsociopathgothichead buttchainsawmaniacnewspaper headlineobscene finger gesturetied upratexploding bodystalkingskeletonstabbed in the backattempted murderscreamingdangerpolice officer killednews reportdouble crosstied to a chairstabbed in the chestbridgeambushflashlightf wordtelephonerevolvercar crashshowdownwatching tvslow motion scenerescuecar accidentblood splattercorpsebeatingpistolsurprise endingchaseknifecigarette smokinggunbloodfightviolencesequel (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | sadistic horrorindependent horrorb movieindependent film |
| Themes: | madnessexploitationhome invasionevilsadisminsanitybrutalitypsychopathtorturefearkidnappingmurderdeath |
| Mood: | car chaseslashernightgore |
| Locations: | back countrytruckroad trip |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolice |
| Story: | sadistic psychopathpsycho killergrindhouse filmhomicidal maniackilling spreepsychopathic killerevil mangory violencemurder spreesadisticbloody violenceweirdoextreme violencecrime spreebutchery …serial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countbutcherredneckrampagefollowing someonegrindhousepsychochainsawmaniackillingmurdererstalkingsevered headstabbed in the chestflashlightsurvivaldecapitationtelephonecar crashsunglassesslow motion scenecar accidentblood splattercorpsesurprise endingchaseknifecigarette smokinggunbloodviolence (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | psycho thrillerindependent horroramerican horrordark comedyblack comedycult filmindependent film |
| Themes: | evilsadisminsanitypsychopathescapetorturemurderdeath |
| Mood: | slashergore |
| Locations: | road trip |
| Characters: | slasher killerserial murdererserial killerself mutilationterrorvillainkillerteenager |
| Story: | psycho terrorsadistic psychopathpsycho killerhomicidal maniackilling spreepsychopathic killerevil manfinal showdowngory violencegruesomedrive in classicmurder spreesadistictorturerdisturbing …bloody violencefalling through the floorbutcheryserial murderhuman monsterbad guymadmanpsychoticbody countraised middle fingerbutcherrampagepsychogothichead buttfalling down stairsmaniackillingmurdererexploding bodykicked in the facebeaten to deathstabbed in the chestshowdownfalling from heightslow motion scenerescueblood splatterknifesequelviolenceblood (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent film |
| Themes: | evilparanoiapsychopathfeardeathmurder |
| Mood: | slashernight |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage boyteenager |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmgrindhouse filmhomicidal maniackilling spreevillain not really dead clichemasked villainpsychopathic killermasked killerevil manmusic score composed by directordrive in classicmurder spree …weirdoserial murderhuman monsterbad guymadmangothbody countmercilessnesswoman in jeopardymasked mangrindhousepsycholifting someone into the airelectronic music scoremaniackillinghandgunmurdererstalkingattempted murdertelephonerunningfalling from heightwatching tvblood splattersurprise endingknifecigarette smokingviolencegun (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
| Subgenre: | black comedyindependent film |
| Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapedrunkennessfearkidnappingmurderdeathrevenge |
| Mood: | slashersatiregore |
| Characters: | serial killerkillerhostagepolice officerpolice |
| Story: | killing spreevillain not really dead clichemasked killerpsychological torturefoot chasecar phonethrown from heightstupid victimwoman kills a mansequel to cult favoritedirector cameoblood on shirtcharacters killed one by oneraised middle fingerfalling to death …punched in the chestmercilessnesscrime scenefemale warriorpresumed deadmasked mansociopathhead buttfalling down stairseavesdroppingcult directorobscene finger gestureexploding bodystalkingprankkicked in the facetough girlcover upbeaten to deathstabbed in the backscreamingnews reportdouble crosstied to a chairstabbed in the chestambushflashlightsurvivalf wordrevolvercar crashsunglassesshowdownfalling from heightwatching tvpunched in the facerescuecar accidentblood splatterdigit in titlecorpsebeatingpistolsurprise endingchaseknifepartycigarette smokingnumber in titlebloodfightsequelviolence (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | slasher flickindependent horroramerican horrorcult filmindependent film |
| Themes: | evilpsychopathrevengemurder |
| Mood: | slashergore |
| Characters: | slasher killerpolice lieutenantserial murdererserial killerself mutilationterrorvillainkiller |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathgrindhouse filmhomicidal maniacvillain not really dead clichepsychopathic killerevil manfoot chasedrive in classicsevered facedisturbingbutcherysledgehammerserial murderbad guy …madmancharacters killed one by onebody countbutchergrindhousepsycholifting someone into the airelectronic music scoregothicfalling down stairsmaniaccult directorstalkingstabbed in the chestdeath of friendtelephonefalling from heightslow motion sceneblood splattercorpsesurprise endingcigarette smokingviolenceblood (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | slasher flickamerican horrorcult filmindependent film |
| Themes: | evilpsychopathdeceptionfeardeathrevengemurder |
| Mood: | slashersatiregore |
| Locations: | wheelchair |
| Characters: | slasher killerserial killervillainkillerteenage boy |
| Story: | sadistic psychopathhomicidal maniackilling spreepsychopathic killermasked killerevil manfoot chasecrime spreestupid victimserial murderhuman monstersequel to cult favoritebad guycharacters killed one by onebody count …raised middle fingerrampagemasked manskulllifting someone into the airchainsawmaniackillingobscene finger gesturemurdererkicked in the faceskeletonproduct placementstabbed in the backpolice officer killednews reportsevered headstabbed in the chestflashlightdecapitationf wordshowdownfalling from heightwatching tvblood splattercorpsesurprise endingchaseknifebloodviolencefightsequel (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | sadistic horrorindependent horroramerican horrorindependent film |
| Themes: | exploitationhome invasionevilsadisminsanitybrutalitypsychopathescapetorturemurderdeath |
| Mood: | slashernightgore |
| Characters: | serial killerself mutilationterrorvillainkillerhostageteenager |
| Story: | sadistic psychopathpsycho killerpsychotronic filmgrindhouse filmhomicidal maniacmasked villainpsychopathic killermasked killerevil manescape attemptfoot chasemurder spreesadisticcrime spreebutchery …carnageserial murderslashinghuman monsterbad guycharacters killed one by onepsychoticbody countdisembowelmentpsychotronicbutchermercilessnesswoman in jeopardyrampagemasked manpsychohammerfalling down stairsmaniacscreamingdangertied to a chairstabbed in the chestflashlightsurvivalcar crashshowdownpunched in the faceslow motion sceneblood splattercorpsebeatingpistolsurprise endingknifecigarette smokingbloodviolencefight (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent film |
| Themes: | evilinsanityparanoiapsychopathdeathmurder |
| Mood: | slasher |
| Locations: | truckelevator |
| Characters: | slasher killerserial killerterrorvillainteenage boypoliceteenager |
| Story: | psycho terrorsadistic psychopathpsycho killerhomicidal maniacvillain not really dead clichemasked villainpsychopathic killermasked killerevil mancult favoritemurder spreesadisticbloody violenceserial murderslashing …fire extinguisherbad guymadmancharacters killed one by onebody countrampagemasked manpsycholifting someone into the airmaniacstalkingstabbed in the backattempted murdersevered headstabbed in the chestdeath of friendflashlightdecapitationtelephonefalling from heightcar accidentpistolchaseknifenumber in titleviolencesequelblood (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | psycho thrilleramerican horrorblack comedy |
| Themes: | evilpsychopathescapedeath |
| Mood: | car chaseslashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolice |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmhomicidal maniacvillain not really dead clichepsychopathic killerevil manfoot chasecar phonegruesomebloody violencebutcherysequel to cult favoritebad guy …madmanbody countraised middle fingerbutcherpsycholifting someone into the airgothicfalling down stairsmaniacobscene finger gesturemurdererbeaten to deathtied to a chairstabbed in the chestsecond partfalling from heightslow motion scenecar accidentdigit in titlecorpsesingingcigarette smokingbloodsequel (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
| Subgenre: | survival horrorslasher flickindependent film |
| Themes: | near death experienceself sacrificepanicbrutalityescapefearkidnappingdeathmurderrevenge |
| Mood: | ambiguous endingslasherparodysatire |
| Characters: | slasher killerserial killerkillerhostageteenage boyteenager |
| Period: | 1980s |
| Story: | psychotronic filmgrindhouse filmmasked killerfinal showdownescape attemptfoot chasescream queenhigh school seniorstupid victimvinylwoman kills a manone linerface maskcharacters killed one by onebody count …cigarette lightermercilessnesspresumed deadmasked manelectronic music scorerecord playerhigh school studentprankstabbed in the backattempted murderscreamingdangerdouble crosssevered headstabbed in the chestambushsurvivaldecapitationf wordcar crashshowdownslow motion scenerescuecar accidentsurprise endingchaseknifeexplosiondancingcigarette smokingviolence (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | slasher flickamerican horrorcult film |
| Themes: | panicevilsadismparanoiabrutalitypsychopathescapefearkidnappingmurderdeathrevenge |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerself mutilationterrorvillainkillerteenage boyteenager |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerpsychotronic filmgrindhouse filmhomicidal maniackilling spreevillain not really dead clichepsychopathic killerevil manescape attemptfoot chasegory violencehell on earthdrive in classic …murder spreesadisticbutcheryserial murderslashingbad guymadmanbody countraised middle fingerbutcherdamsel in distressrampagegrindhousepsycholifting someone into the airelectronic music scoregothicmaniacnewspaper headlineobscene finger gesturemurdererratexploding bodyhigh school studentconvertiblekicked in the facestabbed in the backscreamingstabbed in the chestf wordsecond partsunglasseswatching tvslow motion sceneblood splatterdigit in titlesurprise endingchaseknifepartycigarette smokingnumber in titlefightviolencebloodsequel (See All) |
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the …mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
| Subgenre: | survival horrorindependent horroramerican horrorabsurdismb moviedark comedyblack comedycult filmindependent film |
| Themes: | near death experiencecannibalismpanicexploitationsadismparanoiabrutalityescapefearkidnappingsuiciderevengemurderdeath |
| Mood: | satiregore |
| Locations: | truckelevator |
| Characters: | villainhostagepolice officerpolice |
| Story: | grindhouse filmhit with a hammercowboy hatescape attemptgory violencehell on earthdrive in classicmidnight movieentrailsanthropophagusbloody violencedecomposing bodyextreme violencevinylsledgehammer …repeated linehillbillybad guyblood on shirtbody countpunched in the chestcigarette lighterdisembowelmentpsychotronicbutcherdual wieldchaosmercilessnesscannibalfemale warriorsocial commentaryredneckgrindhousehammerelectronic music scoresociopathhead butthand grenadecult directorhandgunopening action scenekicked in the facetough girlattackstabbed in the backscreamingdangerpolice officer killednews reportradiosevered headstabbed in the chestdeath of friendbridgeambushsurvivaldecapitationrevolversecond partsunglassesfalling from heightwatching tvpunched in the facerescueblood splattercorpsebeatingpistolsurprise endingchaseknifeexplosioncigarette smokingsequelgunviolencefightblood (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
| Subgenre: | slasher flickblack comedycult film |
| Themes: | near death experiencehome invasionparanoiabrutalitypsychopathinvestigationescapedrunkennessfearrevengemurderdeath |
| Mood: | slashersatiregore |
| Characters: | slasher killerserial killervillainkillerteenage boypoliceteenager |
| Story: | villain not really dead clichemasked killerpsychological tortureescape attemptfoot chaserepeated linedirector cameoblood on shirtcharacters killed one by onelens flaredisembowelmentdamsel in distresscrime scenepresumed deadsocial commentary …masked manlifting someone into the airfalling down stairseavesdroppingcult directorhigh school studentstalkingprankproduct placementstabbed in the backdangernews reporttied to a chairstabbed in the chestdeath of friendflashlightsurvivalf wordtelephonecar crashshowdownfalling from heightwatching tvpunched in the faceslow motion scenerescuecar accidentblood splattercorpsepistolsurprise endingchaseknifepartycigarette smokingbloodviolence (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
| Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
| Themes: | madnesspanicparanoiapsychopathdeceptioninvestigationfearsuicidedeathmurder |
| Mood: | slasher |
| Locations: | tunneltruckwheelchair |
| Characters: | serial murdererserial killerself mutilationvillainpolice officer |
| Period: | 1980s |
| Story: | psychotronic filmgrindhouse filmhomicidal maniacpsychopathic killerdrive in classichead injuryserial murderslashingbad guysouthern accentbody countpsychotronicmercilessnesscrime scenepresumed dead …rampagegrindhouseelectronic music scoresociopathgothicmaniacnewspaper headlinecult directormurdererproduct placementattempted murderdangerpolice officer killednews reportman with glassesstabbed in the chestflashlightf wordtelephonerevolvercar crashfalling from heightwatching tvslow motion scenerescuecar accidentblood splattercorpsepistolsurprise endingchaseexplosionblood (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
| Subgenre: | psycho thrillerslasher flickblack comedyindependent film |
| Themes: | near death experiencemadnesspanicinsanityparanoiapsychopathdeceptioninvestigationescapedrunkennessfearkidnappingdeathmurderrevenge |
| Mood: | car chaseslashergore |
| Locations: | elevator |
| Characters: | slasher killerhostagepolice officerpolice |
| Story: | pickup truckpsychological tortureescape attemptfoot chasestupid victimwoman fights a manwoman kills a manblood on shirtcharacters killed one by onereckless drivingbody countone daydisembowelmentdamsel in distresswoman in jeopardy …sociopatheavesdroppingrecord playermaniacobscene finger gestureexploding bodystalkingkicked in the faceproduct placementattackstabbed in the backattempted murderscreamingdouble crosstied to a chairflashlightsurvivalf wordcar crashrunningpunched in the facecar accidentblood splatterdigit in titlecorpsebeatingsurprise endingchaseknifepartyexplosionnumber in titleviolencebloodfight (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
| Subgenre: | survival horrorb movieblack comedycult filmindependent film |
| Themes: | near death experiencepanichome invasionparanoiadeceptionescapedrunkennessfearkidnappingdeathmurder |
| Mood: | nightsatire |
| Characters: | hostagepolice officerteenager |
| Period: | 1980s |
| Story: | psychotronic filmevil laughterpickup truckescape attemptstupid victimaudio cassettesouthern accentlaughingone daycigarette lighterpsychotronicchaosmercilessnessreverse footagedamsel in distress …woman in jeopardysocial commentaryredneckeccentricelectronic music scoredestructionexploding bodyprankscreamingdangerpolice officer killednews reportradioambushflashlightsurvivaltelephonerevolvercar crashwatching tvslow motion scenerescuecar accidentblood splattercorpsesurprise endingknifeexplosioncigarette smokingbloodviolence (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | slasher flickamerican horrorcult filmindependent film |
| Themes: | evilsadisminsanitybrutalitypsychopathinvestigationfeardeathmurder |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenager |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerpsychotronic filmpsycho filmgrindhouse filmhomicidal maniackilling spreepsychopathic killerevil manfoot chasebrutalgruesomedrive in classicmidnight movie …murder spreesadisticbloody violencecarnageserial murderslashingtowerbad guymadmancharacters killed one by onepsychoticbody countdamsel in distressrampagefollowing someonelifting someone into the airfalling down stairsmaniackillingmurdererautomobilestalkingskeletonscreamingdangerdeath of friendflashlightcar crashfalling from heightwatching tvslow motion scenecar accidentblood splatterpistolsurprise endingchaseknifepartyviolencebloodgunsequel (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
| Subgenre: | psycho thrillersurvival horroramerican horrordark comedyblack comedycult filmindependent film |
| Themes: | cannibalismhome invasionevilsadisminsanitypsychopathdeceptionkidnappingdeathmurder |
| Mood: | slashersatiregore |
| Characters: | terrorvillainpolice |
| Story: | psycho terrorsadistic psychopathpsycho killergrindhouse filmhomicidal maniacpsychopathic killerevil mananthropophagusmurder spreeserial murderslashinghuman monsterbad guymadmangoth …body countcannibalrampagemasked manskullgrindhousepsychogothicfalling down stairsmaniaccult directorskeletonflashlightblood splattercorpsepistolknifecigarette smokingviolenceblood (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
| Themes: | evilsadisminsanitypsychopathmurderdeath |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerself mutilationterrorvillainkillerteenager |
| Period: | 1980s |
| Story: | sadistic psychopathpsycho killerhomicidal maniackilling spreevillain not really dead clichepsychopathic killerevil manfoot chasedrive in classicmurder spreesadisticbonesdisturbingbloody violencechanting …butcherycarnageone linerserial murderslashingbad guymadmancharacters killed one by onebody countfalling to deathbutchermuterampagelifting someone into the airelectronic music scorefalling down stairsmaniackillingmurdererskeletonstabbed in the backpuppetscreamingradiostabbed in the chestdeath of frienddecapitationfalling from heightslow motion scenerescueblood splatterdigit in titlecorpsesurprise endingcigarette smokingnumber in titlesequelviolence (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | cult film |
| Themes: | panichome invasionsadisminsanityparanoiabrutalitypsychopathangerinvestigationdrunkennessdeathmurder |
| Mood: | slashernightgore |
| Locations: | truckwheelchairelevator |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolice |
| Story: | sadistic psychopathpsychotronic filmgrindhouse filmhomicidal maniackilling spreepsychopathic killercult favoritebrutalsplit headgruesomedrive in classicmurder spreetorturerdisturbingextreme violence …butcheryserial murderslashinghuman monstercharacters killed one by onepsychoticbody countbutchermutemercilessnesscrime scenerampagegrindhousegothicrecord playermaniackillingcult directormurdererstalkingskeletonattempted murderstabbed in the backpuppetscreamingdangersevered headflashlightsurvivaldecapitationtelephonerevolverrunningwatching tvblood splattercorpsebeatingsurprise endingchaseknifesingingcigarette smokingbloodgunviolence (See All) |
Zombies rule the world, except for a small group of scientists and military personnel who reside in an underground bunker in Florida. The scientists are using the undead in gruesome experiments; much to the chagrin of the military. Finally the military finds that their men have been used in the scie …ntists' experiments, and banish the scientists to the caves that house the Living Dead. Unfortunately, the zombies from above ground have made their way into the bunker. (Read More)
| Subgenre: | survival horroramerican horrorb movieblack comedycult filmindependent film |
| Themes: | self sacrificecannibalismexploitationsadisminsanityparanoiabrutalitydeceptionescapefearsuiciderevengedeathmurder |
| Mood: | satiregore |
| Locations: | caveelevator |
| Period: | 1980s |
| Story: | psychotronic filmgrindhouse filmevil maneating human fleshhell on earthsplit headgruesomedrive in classicanthropophagusbloody violenceextreme violencerepeated linesubterraneansequel to cult favoriteblood on shirt …fight to the deathcigarette lighterdisembowelmentpsychotroniccannibalreverse footagefemale warriorsocial commentaryrampagegrindhouseelectronic music scoresociopathnewspaper headlinecult directortough girlskeletonattackscreamingradioman with glassessevered headdeath of friendsurvivaldecapitationf wordtelephonerevolverrunningsunglassesshowdownrescueblood splattercorpsepistolsurprise endingchasecigarette smokingbloodfightviolencesequel (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | cannibalismevilinsanitypsychopathtorturesuiciderevengemurderdeath |
| Mood: | slashergore |
| Characters: | slasher killerserial killerterrorvillain |
| Story: | sadistic psychopathpsycho killerpsychotronic filmgrindhouse filmhomicidal maniackilling spreepsychopathic killerevil mansadisticbloody violenceextreme violencestupid victimsledgehammerserial murderhuman monster …bad guymadmanbody countcannibalrampagepsychomaniacexploding bodykicked in the facebeaten to deathstabbed in the backstabbed in the chestsurvivalf wordfalling from heightrescueblood splattercorpsepistolsurprise endingexplosionfightsequel (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | psycho thrillerslasher flickamerican horrorcult filmindependent film |
| Themes: | evilpsychopathescapemurderrevengedeath |
| Mood: | slashergore |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolice officerteenage boy |
| Period: | 1980s |
| Story: | psycho terrorsadistic psychopathpsycho killerhomicidal maniacmasked villainpsychopathic killermasked killerevil manmurder spreebutcheryserial murdersequel to cult favoritebad guymadmancharacters killed one by one …body countdisembowelmentbutcherrampagemasked manpsycholifting someone into the airmaniacflashlightdecapitationblood splatterexplosionnumber in titlebloodsequelviolence (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
| Subgenre: | absurdismb moviedark comedyblack comedyindependent film |
| Themes: | self sacrificeparanoiabrutalitypsychopathescapefeardeathmurder |
| Mood: | ambiguous endingslashergore |
| Characters: | terrorvillainteenager |
| Story: | villain not really dead clichemasked villaincowboy hatpsychopathic killermasked killerevil manstabbed through the chestextreme violencestupid victimwoman fights a manslashinghuman monsterface maskmadmanblood on shirt …characters killed one by onewisecrack humordual wieldpresumed deadrampagemasked manelectronic music scoreexploding bodystalkingkicked in the facetough girlbeaten to deathstabbed in the backdangersevered headstabbed in the chestambushflashlightsurvivaldecapitationshowdownfalling from heightpunched in the facerescueblood splattercorpsebeatingpistolsurprise endingchaseknifeexplosionnumber in titlesequelbloodfightviolence (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
| Subgenre: | survival horrorblack comedy |
| Themes: | near death experienceself sacrificepanicexploitationhome invasionsadisminsanityparanoiabrutalitypsychopathdeceptionescapefearkidnappingmurder …revengedeath (See All) |
| Mood: | slashernightgore |
| Locations: | tunneltruck |
| Characters: | self mutilationhostage |
| Story: | evil manfinal showdownface maskblood on shirtraised middle fingerbody landing on a carpunched in the chestdual wieldchaosmercilessnesshatreddamsel in distresssocial commentarymasked mansociopath …hand grenadechainsawobscene finger gestureexploding bodykicked in the faceproduct placementstabbed in the backattempted murderdangernews reportman with glassessevered headtied to a chairstabbed in the chestdeath of friendambushflashlightsurvivaldecapitationf wordrevolvercar crashshowdownpunched in the faceslow motion scenerescueblood splattercorpsebeatingpistolchaseknifeexplosionfightbloodsequelviolence (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | psycho thriller |
| Themes: | panicevilinsanityparanoiapsychopathescapetorturefearkidnappingsuicidemurderdeath |
| Mood: | slashernightgore |
| Characters: | slasher killerserial murdererserial killerself mutilationterrorvillainkillerpolice |
| Story: | psycho terrorsadistic psychopathpsycho killerpsycho filmhomicidal maniackilling spreepsychopathic killerevil manfoot chasesadisticdisturbingbloody violenceextreme violenceserial murderslashing …bad guymadmangothreckless drivingwoman in jeopardypsychogothicmaniackillingmurdererstalkingattempted murderscreamingbridgeflashlightsurvivalcar crashrunningwatching tvcar accidentblood splattercorpsepistolsurprise endingchaseknifeexplosiongunfightviolenceblood (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
| Subgenre: | black comedycult filmindependent film |
| Themes: | near death experiencesadisminsanitypsychopathdeceptioninvestigationescapedrunkennessfearkidnappingdeathrevengemurder |
| Mood: | car chaseambiguous endingnightgore |
| Locations: | texastruck |
| Characters: | hostagepolice officerteenagerpolice |
| Period: | 1980s |
| Story: | cowboy hatpickup truckfoot chasestate trooperstar spangled bannerspit takerecreational vehicleone linerhuman monstersouthern accentblood on shirtpunched in the chestmercilessnessreverse footageredneck …electronic music scoresociopathgothicexploding bodyproduct placementcowboyattempted murderscreamingpolice officer killeddouble crossstabbed in the chestflashlightf wordrevolverrunningsunglassesshowdownwatching tvpunched in the faceslow motion scenerescuecar accidentblood splattercorpsebeatingpistolsurprise endingchaseknifeexplosioncigarette smokingbloodgunfightviolence (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t …he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
| Subgenre: | sadistic horrorindependent film |
| Themes: | sadisminsanitybrutalitypsychopathtorturekidnappingsuicidedeathmurder |
| Mood: | slashergore |
| Locations: | texasroad tripwheelchair |
| Characters: | serial killerpolice officerpolice |
| Story: | meat hookchainsaw murdermasked villaincowboy hatmasked killerevil manbased on ed geinleatherfacesevered faceanthropophagusstupid victimslaughterhousehillbillyhuman monsterbody count …canniballifting someone into the airfalling down stairschainsawmaniacobscene finger gesturepolice officer killedsevered headtelephonerunningblood splattersurprise endingknifebloodviolence (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
| Subgenre: | survival horrorabsurdismb movieblack comedycult filmindependent film |
| Themes: | panicexploitationhome invasioninsanityparanoiabrutalityescapedrunkennessfearrevengedeathmurder |
| Mood: | car chaseambiguous endinggore |
| Locations: | cavetruck |
| Characters: | self mutilationpolice officerpolice |
| Story: | hit with a hammerpickup truckescape attemptfoot chasedecomposing bodystupid victimhillbillydirector cameosouthern accentcharacters killed one by onepunched in the chestdisembowelmentreverse footageredneckgrindhouse …eccentriceavesdroppingobscene finger gesturecult directorproduct placementbeaten to deathstabbed in the backscreamingradiosevered headtied to a chairstabbed in the chestdeath of friendambushsurvivaldecapitationf wordrevolverpunched in the faceslow motion scenecar accidentblood splattercorpsebeatingpistolsurprise endingchaseknifepartycigarette smokingbloodviolence (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
| Subgenre: | survival horror |
| Themes: | self sacrificepanicinsanityparanoiabrutalityangerdeceptionescapefearkidnappingdeathmurderrevenge |
| Mood: | gore |
| Locations: | tunnelwheelchair |
| Characters: | hostage |
| Story: | evil manfinal showdownwoman fights a mansubterraneanwoman kills a manfight to the deathraised middle fingerbody landing on a carpunched in the chestcigarette lighterdual wieldchaosmercilessnesshatredfemale warrior …social commentaryelectronic music scoresociopathhead butthand grenadedestructionobscene finger gestureexploding bodyopening action scenekicked in the facetough girlcover upbeaten to deathstabbed in the backdangerdouble crosssevered headstabbed in the chestambushflashlightsurvivaldecapitationcar crashrunningsunglassesshowdownfalling from heightpunched in the faceslow motion scenerescuecar accidentblood splattercorpsebeatingpistolsurprise endingchaseknifeexplosionviolencesequelbloodfight (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
| Subgenre: | sadistic horrorslasher flickdark comedycult filmindependent film |
| Themes: | madnesscannibalismsadisminsanitytorturefearkidnappingmurderdeath |
| Mood: | slashergore |
| Locations: | cave intunnelcaveroad trip |
| Characters: | slasher killerpolice lieutenantserial killer |
| Story: | radio djevil manmusic score composed by directorsevered facehuman monstermadmanpsychoticraised middle fingerbody landing on a carmasked manskullpsycholifting someone into the airmaniaccult director …tied upskeletonman with glassessevered headtied to a chairstabbed in the chestrevolverwatching tvslow motion scenecar accidentblood splatterdigit in titlecorpsebeatingpistolsurprise endingchaseknifedancingnumber in titleviolenceblood (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou …nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
| Subgenre: | survival horrorindependent horroramerican horrorcult filmindependent film |
| Themes: | near death experienceself sacrificecannibalismpanicparanoiabrutalityescapefearmurderdeathrevenge |
| Mood: | nightgore |
| Locations: | truck |
| Characters: | terrorpolice |
| Story: | meat hookpsychotronic filmgrindhouse filmpickup truckescape attemptfoot chasehell on earthdrive in classicmidnight movieentrailsanthropophagushillbillyone daypsychotronicchaos …cannibalmercilessnesssocial commentaryskullgrindhousehammerelectronic music scoregothicfalling down stairscult directorhandgunexploding bodybeaten to deathattackscreamingdangernews reportradioman with glassesstabbed in the chestbridgesurvivalrevolverrunningwatching tvpunched in the facerescuecar accidentblood splattercorpsebeatingpistolsurprise endingchaseknifeexplosioncigarette smokinggunviolencebloodfight (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com