Please wait - finding best movies...
In this ambitious and unsettling Florida-set horror film, a young couple travels to the Everglades to help relieve their anxiety and to bring them closer together. What at first appears to be a seemingly pastoral paradise soon transforms into a sinister, dread-soaked nightmare as a vicious madman te β¦rrorizes them for his demented experiments. (Read More)
Themes: | writingracismdeath |
Mood: | nightmarespoofrain |
Locations: | lakefarmwoodsforest |
Story: | welding torchdeceased wiferaw meatmixed raceold househorror storyhorror filmcharacter developmentsound designact uppastoralarrivalbooksbackgroundforeshadowing β¦nobleleavingcondemnationcreditlearnbloodydreadplayingracialfunmonsterscreepyweldingyoungparadisemindsinistersleepwalkingfairtargethandymancinematographercrazystressweekendsocialmacabrewalkingmissingmessagedronemeatwifemadmanranchnoteboyfriendracisttensiontorchracecouplehatehouseflashback (See All) |
Young newlyweds Paul and Bea travel to remote lake country for their honeymoon. Shortly after arriving, Paul finds Bea wandering and disoriented in the middle of the night. As she becomes more distant and her behavior increasingly peculiar, Paul begins to suspect something more sinister than sleepwa β¦lking took place in the woods. (Read More)
Locations: | lakewoodsforest |
Story: | horror filmsinistersleepwalkingmessagewifetensioncouplehouseflashback |
After a stint in a psychiatric facility Jessica, her husband and a friend move to remote farm they have recently purchased. There they find a young woman by the name of Emily living in the house and they invite her to stay. When Jessica goes for a swim in the lake, she sees a body just below the wat β¦er's surface. When they go into the village to sell some old furniture, they learn that a woman by the name of Abigail Bishop drowned in the lake and her body was never found. Local folklore has that Abigail is now a vampire roaming the countryside. A mute blond girl leads her to the body of a dead man but the body is not there when Jessica goes for help. Jessica and those around begin to wonder if she is losing her mind. (Read More)
Themes: | death |
Mood: | nightmare |
Locations: | lakefarm |
Story: | old houselearnyoungmindhouse |
Nursery teacher Jenny and her boyfriend Steve, escape for a romantic weekend away. Steve, planning to propose, has found an idyllic setting: a remote lake enclosed by woodlands and seemingly deserted. The couple's peace is shattered when a gang of obnoxious kids encircles their campsite. Reveling in β¦ provoking the adults, the gang steals the couple's belongings and vandalizes their car leaving them completely stranded. When Steve confronts them, tempers flare and he suffers a shocking and violent attack. Fleeing for help, Jenny is subject to a brutal and relentless game of cat-and-mouse as she desperately tries to evade her young pursuers and find her way out of the woods. (Read More)
Themes: | death |
Locations: | lakewoodsforest |
Story: | leavingyoungweekendboyfriend |
A team consisting of a physicist, his wife, a young female psychic and the only survivor of the previous visit are sent to the notorious Hell House to prove/disprove survival after death. Previous visitors have either been killed or gone mad, and it is up to the team to survive a full week in isolat β¦ion, and solve the mystery of the Hell House. (Read More)
Themes: | death |
Story: | old houseyoungsleepwalkingwifetorchhouse |
John James is a writer; his wife has left him. He moves with his middle-school aged daughter and young son to an isolated house off a dirt road in South Carolina. The property has an Indian burial mound, which fascinates his daughter, Louisa, who's entering puberty. Strange things: noises on the roo β¦f and in the woods, the cat missing, Luisa sleepwalking clutching a straw doll no one's seen before. She visits the mound often, staying late, coming home covered with mud. John's younger son, Sam, is frightened. John learns the house has a history and seeks out the previous owner. Louisa's behavior becomes more bizarre. Is there an explanation? An ant farm and a missing babysitter provide clues. (Read More)
Locations: | farmwoods |
Story: | youngsleepwalkingmissingwifehouse |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Themes: | death |
Mood: | rain |
Locations: | lakefarmwoodsforest |
Story: | macabreranchracisttensiontorchflashback |
In New York, Dr. Norman Boyle assumes the research about Dr. Freudstein of his colleague Dr. Petersen, who committed suicide after killing his mistress. Norman heads to Boston with his wife Lucy Boyle and their son Bob to live in an isolated house in the woods that belonged to Dr. Petersen. Bob befr β¦iends the girl Mae that only he can see and she warns him to leave the house. Soon his parents hire the mysterious babysitter Ann and creepy things happen in the house, When Bobby goes to the basement, his parents discover the secret of the house. (Read More)
Themes: | death |
Mood: | nightmare |
Locations: | woodsforest |
Story: | old housecreepywifemadmanhouseflashback |
Follows a novelist who visits her family for Christmas and finds a mysterious Nutcracker doll, which soon becomes possessed and wreaks havoc.
Themes: | death |
Story: | horror filmfuncreepymindfairwalkingboyfriendtensioncouplehouse |
When a normal American family moves into a beautiful old English house in a wooded area, strange, paranormal appearances befall them in this interesting twist to the well-known haunted-house tale. Their daughter Jan sees, and daughter Ellie hears, the voice of a young teenage girl who mysteriously d β¦isappeared during a total solar eclipse decades before... (Read More)
Locations: | farmwoodsforest |
Story: | old houseyounghouseflashback |
Popular college student Laura (Alycia Debnam-Carey) has tons of friends, both on Facebook and IRL. She graciously accepts social outcast Marina's (Liesl Ahlers) online friend request, until Marina crosses the line and Laura unfriends her. To everyone's shock, Marina takes her own life in a ritual me β¦ant to torment Laura, which appears in a video posted on Laura's profile. Even though it wasn't Laura who posted the video, or other creepy content that begins appearing on her page, her Facebook friend count begins to dwindle as a result. When her real-life friends start dying mysterious, cruel deaths, Laura must figure out how to break the deadly curse before it's too late. (Read More)
Themes: | death |
Locations: | forest |
Story: | horror filmcreepysocialboyfriend |
Ledoyen and Considine play a young married couple at the end of the 1970s, who come to visit a friend (Oldman) who now lives in the Basque region because he has married a woman from there (Sanchez-Gijon). Their tranquil summer turns to horror when they discover a girl with horribly mutilated hands i β¦n the forest. They try to help her by taking her away from the home in which she is locked, but the local villagers, who have to protect the girl, start a pursuit in the forest they know much better than the visitors. (Read More)
Mood: | rain |
Locations: | woodsforest |
Story: | youngweekendcouple |
Wrongfully executed 100 years earlier, brothers Thomas and Meeks Griffin rise from the grave to exact vengeance on the descendants of those responsible.
Themes: | racism |
Locations: | farm |
Story: | horror filmcharacter developmentbloodyfunsocialmessagecouple |
A penguin drifting through the polluted waters of a flooded Earth must see if he has what it takes to survive the new ways of the world.
Themes: | death |
Locations: | woods |
Story: | horror filmcreditbloodycreepyfairboyfriendtensioncouple |
In Louisianna,Detective Mark Lewis is summoned to attend a call from the notorious Livingston House and he finds three bodies and one survivor, John, who is in shock. He calls for backup and also the police psychologist Dr. Elizabeth Klein to interrogate John. They learn that the team of ghost-buste β¦rs Bryan, John's pregnant girlfriend Michelle, Jules, Donnie and Sam decided to perform a seance in the house, where the owner Marta Livingstone had committed a violent slaughter, to summon their spirits. The seance went wrong and released evil spirits that killed Jules, Donnie and Sam; however Michelle and Bryan are missing. While Elizabeth interrogates John, Mark and the technical team tries to retrieve the hard disks with the footages from the house to find where the other two survivors may be, Detective Lewis discloses a dark supernatural secret about John. (Read More)
Themes: | death |
Story: | learnmissingboyfriendhouseflashback |
Two campers in the New Jersey woods have their outdoor fun interrupted by the arrival of a meteorite crashing nearby. They go to investigate the crater, but are suddenly attacked and devoured by alien parasites who have hitched a ride to Earth. After finishing off the campers, the hungry space monst β¦ers head for a nearby town, where they make their domain in the basement of an old house soon begin polishing off one hapless inhabitant after another. Four young teenagers, plus one pre-teen boy, try to find a way to stop the angry space monsters before they reproduce and literally eat humanity. (Read More)
Mood: | rain |
Locations: | woods |
Story: | arrivalfunmonstersyounghouse |
A couple of college students known only as the Girl and the Guy are traveling home to Delaware the day before Christmas Eve. They're on a frozen road that the Guy is convinced is a scenic short-cut. In the middle of nowhere in below freezing conditions they are run off the road by a hit and runner. β¦They soon realize they're caught in a supernatural bubble where a crime from 1953 is doomed to repeat itself, year after year threatening new victims. The Guy attempts to walk back to the last petrol station but his wounds from the crash are worse than he let on. (Read More)
Themes: | death |
Mood: | nightmare |
Locations: | woodsforest |
Story: | horror filmmacabreracisttensioncoupleflashback |
A young girl witnesses her brother murder a man through a reflection in a mirror. Twenty years later the mirror is shattered, freeing his evil spirit, which seeks revenge for his death.
Themes: | death |
Mood: | nightmare |
Story: | old houseyoungcouplehouseflashback |
A Scotland Yard investigator looks into four mysterious cases involving an unoccupied house and its tragic previous tenants: 1) A hack novelist encounters a strangler who's the villain of his books, leading his wife to question his sanity, 2) Two men are obsessed with a wax figure of a woman from th β¦eir past, 3) A little girl with a stern, widowed father displays an interest in witchcraft, and 4) An arrogant horror film actor purchases a black cloak which gives him a vampire's powers. (Read More)
Themes: | writingdeath |
Story: | horror filmbookswifehouse |
In July of 2013 Sean Miller disappeared for four days. Seven years later a documentary film crew found out why.
Story: | horror filmbackgroundcreepysinistermissingwifetensionhouse |
In 1966, somewhere in Russia, a wounded woman drives a truck to an isolated farm with two babies. Forty years later, the film producer Marie Jones leaves her daughter in California and travels back to her home land in the wilderness of Russia. Marie is one of the children and had received a phone ca β¦ll from the notary public Andrei Misharin, who told her where the farm of her family is located. Marie arrives at the abandoned house and meets the stranger Nicolai, who tells her that he had also received a call from Misharin and he is her twin brother. Weird things happen in the house and Marie and Nicolai are haunted by zombie-like ghosts of themselves. Further, they find that they are trapped in the house and can not leave the place. (Read More)
Themes: | death |
Mood: | rain |
Locations: | lakefarmwoodsforest |
Story: | houseflashback |
Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn β¦that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)
Themes: | death |
Mood: | nightmare |
Locations: | lakewoodsforest |
Story: | arrivallearnyoungtorchflashback |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Themes: | death |
Mood: | nightmare |
Locations: | farmwoodsforest |
Story: | madmantensioncouplehouseflashback |
In 1976, in Jotunheimen, an abused boy stabs to death his mother Sigrid and his stepfather Gunnar in an abandoned hotel and the family is considered missing by the local Sheriff Einar and authorities. Twelve years later, the teenagers Hedda and her boyfriend Anders, Siri, Knut, Magne and Simen take β¦a lift with Sheriff Einar telling that they will hike in the woods. However they go to the abandoned hotel expecting to spend the night in the place but they find dust and rats and prefer to stay camping in the woods. In the morning, Siri and Knut fall into a trap of the eremite hunter Jon and Knut is seriously wounded. Siri climbs the hole to seek for help to Knut, but she is captured by Jon while a stranger kills Knut. Soon the teenagers are hunted down by the creepy serial-killer. (Read More)
Themes: | death |
Locations: | lakewoods |
Story: | creepymissingboyfriend |
Peaceful, rustic Berkeley is a charming fishing community where life is sweet and the people friendly. All that is about to change. After losing her childhood farm to the bank, local beauty Rene decides to leave town and head for the big city. Suddenly, an avalanche of meteorites races through the s β¦ky, bombarding the town and bringing an otherworldly infection. Departing is going to be much more difficult than she had planned. The living dead are awakened and Rene is now caught in a nightmare of zombies hungry for human flesh. She manages to find salvation in a small isolated farm house owned by the town loony, Marion. There she is met with four other desperate survivors. Together they battle their way through a plague of walking dead and discover that there is more transpiring than just an infection. (Read More)
Themes: | death |
Mood: | nightmarerain |
Locations: | farmwoods |
Story: | walkinghouseflashback |
It was the perfect family vacation for composer John Russell and his family when a freak automobile accident claims the lives of his wife and daughter. Consumed by grief, John, at the request of friends, rents an old turn of the century house. Mammoth in size, the house seems all the room that John β¦needs to write music and reflect. He does not realize that he is not alone in the house. He shares it with the spirit of a murdered child who has homed in on John's despair and uses him to uncover decades of silence and deceit. With the help of Claire Norman, the one who aided John in procuring the house, they race to find the answers and soon learn that a devious and very powerful man guards them. (Read More)
Themes: | death |
Mood: | nightmare |
Locations: | lake |
Story: | learnwiferacehouseflashback |
An artist in crisis is haunted by nightmares from the past in Ingmar Bergman's only horror film, which takes place on a windy island. During "the hour of the wolf" - between midnight and dawn - he tells his wife about his most painful memories.
Mood: | nightmare |
Locations: | woodsforest |
Story: | horror filmwifeflashback |
Tourists take a boat to a remote island, where they find that most of the people have disappeared, and something is stalking them. They find a hidden room in the big mansion on a hill, and an ancient diary, which gives them clues to the source of the terror.
Themes: | death |
Mood: | nightmare |
Locations: | woodsforest |
Story: | macabremadmantorchhouseflashback |
Francis, a young man, recalls in his memory the horrible experiences he and his fiancee Jane recently went through. It is the annual fair in Holstenwall. Francis and his friend Alan visit The Cabinet of Dr. Caligari, an exhibit where the mysterious doctor shows the somnambulist Cesare, and awakens h β¦im for some moments from his death-like sleep. When Alan asks Cesare about his future, Cesare answers that he will die before dawn. The next morning Alan is found dead. Francis suspects Cesare of being the murderer, and starts spying on him and Dr. Caligari. The following night Cesare is going to stab Jane in her bed, but softens when he sees the beautiful woman, and instead of committing another murder, he abducts her. Jane's father awakens because of the noise, and he and some servants follow the fleeing Cesare. When Cesare cannot outrun his pursuers anymore, he gently places Jane down on the ground, and runs away. Francis and the police investigate the caravan of Dr. Caligari, but the doctor succeeds in slipping away. Francis pursues the fleeing Dr. Caligari, and sees him disappear into a madhouse. Francis enters the madhouse, where he is sure he will find the truth behind all these mysterious events. (Read More)
Themes: | death |
Story: | youngsleepwalkingfairmacabremadmanflashback |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou β¦nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
Themes: | death |
Locations: | farmwoodsforest |
Story: | youngwalkingtorchcouplehouse |
Roger Cobb is a Vietnam vet whose career as a horror novelist has taken a turn for the worse when his son Jimmy mysteriously disappears while visiting his aunt's house. Roger's search for Jimmy destroys his marriage and his writing career. The sudden death of his aunt brings Roger back to the house β¦where his nightmares began. The evil zombies in the house force Roger to endure a harrowing journey into his past. (Read More)
Themes: | writingdeath |
Mood: | nightmare |
Story: | houseflashback |
Cristian and his sister, July, travel from Madrid to El Garraf with their parents and their little brother to spend the Holy Week in their old vacation home. They learn the legend of Melinda, a girl wearing a red dress that got lost in the labyrinth near the house, who helps people that also get los β¦t in the spot. Carlos, a visiting family friend, tells the siblings that there are different, more sinister versions of the legend. July and Cristian use two hand-held cameras to explore the labyrinth and investigate the mystery of Melinda, until something horrible happens. (Read More)
Themes: | death |
Locations: | woodsforest |
Story: | learnsinisterhouse |
Two high profile couples are forced to examine the cost of success when they're invited to an exclusive self-help retreat where their ancestors sold their souls generations prior.
Story: | horror filmcharacter developmentact upbloodycreepyweekendboyfriendracehouse |
Jennifer Corvino, the daughter of a famous actor, has had trouble with sleepwalking for some time. Her doctor said that it can develop a split personality. She discovers her alternate personality when she stays at a boarding school that was once the home a Richard Wagner. But someone has been killin β¦g the students, and it relates only indirectly to the criminal sanitorium nearby. So it's up to "the two greatest detectives the world has ever known, or should I say, unknown" (Read More)
Themes: | death |
Mood: | nightmarerain |
Locations: | lakeforest |
Story: | creepysinistersleepwalkinghouseflashback |
A young man under house arrest and his friends are haunted by an unknown force after logging onto a website that broadcasts images from a haunted room.
Story: | horror filmleavingyoungmindmessagenotecouplehouse |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Themes: | death |
Locations: | farm |
Story: | dreadcreepysinisterweekendmacabremeatmadmantension |
In 1666, a colonial town is gripped by a hysterical witch-hunt that has deadly consequences for centuries to come, and it's up to teenagers in 1994 to finally put an end to their town's curse, before it's too late.
Themes: | death |
Story: | horror filmbooksbloodyracialfunmonstersyoungsinistermacabrenoteflashback |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
Themes: | racismdeath |
Locations: | forest |
Story: | old houseleavingbloodymonstersflashback |
Aiming to find the Bigfoot, a group of graduate students venture deep into an area of the Northeastern wilderness known for its strange creature sightings. Soon, they learn that there is a much more sinister evil lurking in the woods, the Wendigo, and once the spirit knows youβre there, they will β¦come for you. Who will survive in a battle between the two most notorious monsters of the forest? (Read More)
Locations: | woodsforest |
Story: | horror filmcharacter developmentsound designbackgroundlearnfunmonsterssinister |
Megan Stewart, 14, and her best friend Amy Herman, 13, though opposites in personality, are best friends. Megan carries the front of being the most popular girl in school, but this masks a lifestyle of hard partying, drugs, alcohol and indiscriminate sex. Amy, unpopular and socially awkward, clings β¦to her relationship with Megan as a lifeline to social acceptance. Together, these two young girls forge a deep friendship based on their mutual needs. The two girls regularly communicate by web chat cameras or cell phone, and even meet boys online. As Megan seeks friends who are different from her usual posse of hanger-ons, she is introduced by a friend online to a 17 year-old boy named Josh in a chat room. Megan and Josh bond quickly, leaving Amy feeling a bit left out. One day, Megan goes to meet Josh in person, and she is never seen again. Amy launches into a concentrated effort to find her friend. As the media swirls around the story of Megan's disappearance, Amy discovers the horrifying truth about what happened to her friend. Based on research into seven actual cases of child abduction, MEGAN IS MISSING is an uncompromising, gut-wrenching view of the world children live in today. Harrowing in its realism, the film uses only fact-based incidences to depict the lives of ordinary kids walking in the midst of extraordinary evil. (Read More)
Themes: | death |
Locations: | woodsforest |
Story: | leavingyoungsocialwalkingmissinghouse |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
Mood: | nightmare |
Story: | youngsleepwalkingcouplehouse |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Themes: | death |
Mood: | nightmarerain |
Story: | creepysleepwalkingfairmadmanflashback |
True-crime writer Ellison Oswalt moves himself and his family into a house where a horrific crime took place earlier, but his family doesn't know. He begins researching the crime so that he can write a new book about it to help his flailing career. He uses some "snuff" film footage he finds in the h β¦ouse to help him in his research, but he soon finds more than he bargained for. There is a figure in each of the films but who or what is it? As a result, his family start to suffer (as does he) and things take a turn for the worse. Will they survive? (Read More)
Themes: | writingdeath |
Story: | sinistersleepwalkinghouse |
A hike alone in the woods ends tragically for Beth Slocum with a fatal snake bite. Her death leaves her parents and boyfriend Zach reeling. After the funeral, Zach tries to make friends with Mr. and Mrs. Slocum, but even they reject him, and he's determined to figure out why. Then he sees Beth. Her β¦parents are trying to keep her resurrection a secret, but zombie Beth provides Zach with the opportunity to do everything with her that he didn't get to do while she was still alive. But with Beth's increasingly erratic behavior and even more strange occurrences around town, life with the undead Beth proves to be particularly complicated for her still-living loved ones. (Read More)
Themes: | death |
Locations: | woods |
Story: | boyfriendcouplehouse |
Margaret and Ben take a weekend trip with longtime friends Ellie and Thomas and their two young children. Eventually, Ben begins to suspect something supernatural is occurring when the kids behave strangely after disappearing into the woods overnight.
Locations: | woods |
Story: | horror filmlearnplayingfuncreepyyoungmind |
Raised as a rigorous vegetarian, doe-eyed freshman Justine following in her parents' footsteps, she is sent off to the reputable Saint-Exupery Veterinary school where the black sheep of the family, her big sister Alexia, is already studying. There, young virginal Justine, leaving the familial shelte β¦r, will abruptly move into a mad new world of school traditions, vicious initiation tests and hard partying, utterly unprepared though for the rough year start only rush week's mandatory hazing can offer. As a result, with Alexia reluctantly showing her the ropes but only halfway, Justine during the long-established trial of raw offal-eating, she will be forced to chew over her devout herbivorous beliefs and swallow a fresh chunk of bright-red rabbit kidney, unknowingly descending deep into her uncharted animalistic tendencies. Before long, repulsion will be replaced with an unprecedented, equally unquenched and palpable craving for raw meat, transforming Justine into a monstrous carnivore ravenous for human flesh and a gluttonous meat junkie. Now that Justine's corporeal awakening is finally complete, is there a point denying her hunger? (Read More)
Story: | raw meatleavingyoungmeat |
A woman with early signs of Alzheimer's begins to have lucid dreams and nightmares that a living Punch puppet has moved in with her and her family. She uncovers something sinister is observing her every move.
Story: | old househorror filmcreepymindsinistermacabrehouse |
An anxious woman struggles to cope in isolation as a pandemic sweeps the world, forcing her to confront the monsters in her head.
Story: | horror filmcreditdreadmonstersyoungsinisterfaircrazynote |
Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try β¦ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)
Themes: | death |
Mood: | rain |
Locations: | woodsforest |
Story: | dronetensioncouplehouse |
While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro β¦ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)
Themes: | death |
Locations: | lakewoodsforest |
Story: | madmanhouse |