Please wait - finding best movies...
Ryan is a lion who wants to go to the wild, where his dad (Samson) once lived. When he gets himself shipped to Africa, his zoo friends (and Samson) work together to bring him back. When they get to Africa, however, the animals find themselves in a pile of danger. They have to fight an evil wildebees β¦t called Kazar. But Kazar's safe compared to the other danger on the island- a volcano that's on the edge of eruption. Can the animals find Ryan and get out of Africa before the volcano erupts in so little time? (Read More)
Subgenre: | cgi animationcomputer animationfish out of water |
Themes: | wildernessdeceptiondance |
Locations: | sewerjungleafricanew york city |
Characters: | father son relationship |
Story: | canada gooseanimal protagoniststuffed animaltalking animalcharacter's journey shown on mapfather searches missing sonstrange lovejourney shown on maproaringroarwildebeesttugboatsteamshipcurlingchameleon β¦flamingogeesekoalavolcanic eruptionstampedehippopotamusbeetlegoosevulturegiraffetimes square manhattan new york citykangaroogarbage truckstatue of liberty new york cityalligatorsquirrelpenguinsurprise after end creditsseparationpigeoncliffvolcanolionevacuationzoocrushed to deathtorchcircusflirtingscene during end creditsproduct placementanimalno opening creditssnakesurvivalmanhattan new york citylierescuetitle spoken by characterdogflashback (See All) |
The sequel to 2005's "Madagascar", in which New York Zoo animals, Alex the Lion, Marty the Zebra, Melman the Giraffe and Gloria the Hippo, still stranded on Madagascar, start to leave the island. All of a sudden, they land in the wilderness of Africa, where Alex meets the rest of his family, but has β¦ trouble communicating with them after spending so much time at the Central Park Zoo. (Read More)
Subgenre: | cgi animationcomputer animationslapstick comedy |
Themes: | wildernessdancefriendshipjealousyescape |
Locations: | jungleafricanew york cityairplane |
Characters: | father son relationshipwitch doctor |
Story: | talking animalhippopotamusgiraffepenguinvolcanolionzoosurvivalmanhattan new york citytitle spoken by characternumber in titlesequelpunctuation in titledigit in titlehorse β¦second partsubjective cameraambushkingold womanmistaken identitysacrificecountry name in titlefarcespiderblockbustersharkanimal attackhungerplanewisecrack humorduct tapeworld trade center manhattan new york citychallengelavapredatordamteamworkchimpanzeecarjackingintentionally misspelled titleanimated creditsnew yorkerpoacherbirthmarkstudio logo segues into filmostrichzebracratebickeringstar died before releasecgi filmnew york city skylinesequel with unusual numbermadagascarinterspecies romancetropicallemurimax versionwaterway (See All) |
Alex, Marty, Gloria and Melman are still trying to get back to the Big Apple and their beloved Central Park zoo, but first they need to find the penguins. When they travel to Monte Carlo, they attract the attention of Animal Control after gate crashing a party and are joined by the penguins, King Ju β¦lian and Co., and the monkeys. How do a lion, zebra, hippo, giraffe, four penguins, two monkeys, three lemurs travel through Europe without attracting attention and get back to New York? They join a traveling circus. Their attempts to get back to New York are consistently hampered by the Captain of Animal Control who wants to make Alex part of her collection. Once they make it back to New York Marty, Alex, Gloria and Melman realize that they want to be part of the traveling circus. (Read More)
Subgenre: | cgi animation |
Themes: | moneygambling |
Mood: | nightmare |
Locations: | africatrainmotorcyclelondon englandsinging on airplane |
Characters: | childrenlittle girllittle boylatino |
Story: | talking animalhippopotamusgiraffepenguinlionzoocircusanimalliedognumber in titlesequeldancingexplosionfire β¦digit in titlehorsenumbered sequelthird partattempted murderbearfireworkscountry name in titlerome italydynamitetigerknife throwingwilhelm screambullet timetrain ridepoacheratlantic oceanseal the animalzebranumber 3 in titlejaguarrussian accentafromonte carlocontinent in titleisland name in titletrapeze artisttightropeitalian accentlemursentimental (See All) |
Bolt, an American white shepherd, has lived his whole life on the set of his action TV show, where he believes he has superpowers. When separated from the studio by accident, he meets a female alley cat named Mittens and a hamster named Rhino. He's trying to find the way home, to the studio. Along t β¦he way, he learns that he doesn't have superpowers and that the show is not real. (Read More)
Subgenre: | cgi animationcomputer animationfish out of waterdisney |
Themes: | friendshipescapehollywoodcourage |
Locations: | junglenew york citytrainhelicopterdesertroad trip |
Characters: | actressbully |
Story: | animal protagonisttalking animaljourney shown on mappigeontorchno opening creditsrescuetitle spoken by characterdogcharacter name in titleone word titlechasefirecattelevision β¦new yorkmontagemapbirdvanpaintrainingelectrocutionfilm within a filmsadnesslas vegas nevadamissileslow motioncamplasermovie directoranthropomorphismguardhungermovie setbarbecuewilhelm screamexploding helicoptergatling guntimebombohiogerman shepherdbrooklyn bridgetrailer homebillboardhelicopter crashexploding trucktrailer parkhollywood signmovie studiolook aliketeamworkillinoisdisillusionmentgolden gate bridgedog moviehamstermissouristun gunsuperpoweranimal shelterpet shopstickdog poundpet owner relationshipgod complexfanboysimulated realitywhite doganimal control workerartificial realitymovie agentbarkanimal escapes poundstyrofoam (See All) |
This story follows a teenage rock hopper penguin named Cody Maverick from his hometown of Shiverpool, Antarctica, where all of the other penguins think he's nothing but a surfing fool, to the "Big Z Memorial Surf Off" on Pen Gu Island. Young Cody is determined to win the most important competition i β¦n the world of penguin surfing in honor of "Big Z," a deceased surfing legend whom he has idolized since childhood. But the waves in Pen Gu are different than in Shiverpool, and the competition is steep. The current champ, egotistical Tank Evans, isn't just about to let this little penguin knock him from first place without a fight. When Cody wipes out and encounters Geek, a recluse aging former surfer, living in the jungle, he learns some important lessons about life and surfing, and even teaches Geek a thing or two. (Read More)
Subgenre: | cgi animationcomputer animationmockumentaryfake documentary |
Themes: | friendshipsurrealismrivalry |
Mood: | breaking the fourth wall |
Locations: | junglebeachocean |
Characters: | family relationshipsmother son relationshipsingle mother |
Story: | animal protagonistpenguinsurprise after end creditsvolcanoscene during end creditstitle spoken by characterflashbackpunctuation in titleurinationsecretapostrophe in titleislandcompetitionbirdchicken β¦surfingtrophywhalesurfersurfboardlifeguardrescue from drowningscatological humorantarcticaukuleleotterigloosea urchinsportsmanshipinstant replaywipeout (See All) |
A megalomaniac C.E.O. sends his son into the dangerous African Congo on a quest for a source of diamonds large enough and pure enough to function as powerful laser communications transmitters (or is it laser weapons?). When contact is lost with his son and the team, his sometime daughter- in-law is β¦sent after them. She is a former CIA operative and, accompanied by gee-whiz gadgetry and a few eccentric characters (including a mercenary, a researcher with a talking gorilla, and a a nutty Indiana-Jones-type looking for King Solomon's Mines), sets out to rescue her former fiance. What they all discover is that often what we most want turns out to be the source of our downfall. (Read More)
Themes: | military |
Locations: | jungleafricaairplaneairportcavecampfire |
Characters: | soldierprofessoramerican abroadbabe scientist |
Period: | 1990s |
Story: | talking animalvolcanic eruptionhippopotamusgiraffevolcanolionanimalno opening creditssnakesurvivalrescuetitle spoken by characterbased on novelone word titleexplosion β¦pistolcorpseshot to deathmachine gunshotguncamerapaintinginterrogationscientistdecapitationambushmountainarmyexploding carsevered headritualcigar smokinglegendtentskeletonmercenaryak 47uzicaptaincountry name in titleheavy rainlifting someone into the airhuntertemplesevered handskulllaserrocket launcheranimal attackdiamondhit in the crotchairplane crashparachuterainstormtribecorporationsign languagetorso cut in halfsatellitetranslatorreference to elvis presleyexpeditioneyegolf clubterritory name in titlegorillaflarelavaexplorerhouston texashot air balloonapeairfieldcoughing bloodreference to john wayneguideflare gunanimal killingexploding airplanechantingskydivingcongogolf cartromanianstudio logo segues into filmtanzaniasafariloud shirtanimal human communicationjumping from an airplaneex cia agentsimian fictionswahilifortune hunterlost cityzoologylaser cutterwhite water raftingcentral africaancient templehuman versus animalelectronics expertthrown from an airplanecharacter says have a nice daytalking gorillareference to prometheusprimatologistrobot sentry (See All) |
One day, Horton the elephant hears a cry from help coming from a speck of dust. Even though he can't see anyone on the speck, he decides to help it. As it turns out, the speck of dust is home to the Whos, who live in their city of Whoville. Horton agrees to help protect the Whos and their home, but β¦this gives him nothing but torment from his neighbors, who refuse to believe that anything could survive on the speck. Still, Horton stands by the motto that, "After all, a person is a person, no matter how small." (Read More)
Subgenre: | cgi animationcomputer animationanime style |
Themes: | friendship |
Locations: | junglesnow |
Characters: | father son relationshipfamily relationshipsmother son relationshipfather daughter relationshipteachermayor |
Story: | talking animalvulturekangaroocliffanimalrescuedogcharacter name in titlechasevoice over narrationfalling from heightscientistswimmingmountainfantasy sequence β¦rabbitsplit screenflowerbearmonkeycageelephantmousedentistinventionpeer pressurebased on children's booklarge familydustobservatoryrope bridgeminiature personmammalcity councilmob scenenovocainedr seussgreen eggs and ham (See All) |
Manny the woolly mammoth, Sid the sloth, Diego the saber-toothed tiger, and the hapless prehistoric squirrel/rat known as Scrat are still together and enjoying the perks of their now melting world. Manny may be ready to start a family, but nobody has seen another mammoth for a long time; Manny think β¦s he may be the last one. That is, until he miraculously finds Ellie, the only female mammoth left in the world. Their only problems: They can't stand each other--and Ellie somehow thinks she's a possum! Ellie comes with some excess baggage in the form of her two possum "brothers"-- Crash and Eddie, a couple of daredevil pranksters and cocky, loud-mouthed troublemakers. Manny, Sid and Diego quickly learn that the warming climate has one major drawback: A huge glacial dam holding off oceans of water is about to break, threatening the entire valley. The only chance of survival lies at the other end of the valley. So our three heroes, along with Ellie, Crash and Eddie, form the most unlikely family--in any "Age"-- as they embark on a mission across an ever-changing, increasingly dangerous landscape towards their salvation. (Read More)
Subgenre: | cgi animationcomputer animationslapstick comedy |
Themes: | lovefriendshipnear death experiencechildhood traumafear of water |
Locations: | snowsea monstercave in |
Characters: | family relationshipsfriendbrother brother relationshipbrother sister relationship |
Story: | talking animalvulturesquirrelevacuationanimalno opening creditssurvivalrescueflashbacksequelfalling from heightsecond partsubjective cameraorphanbird β¦tongueunderwater sceneon the roadsacrificetwinsblockbusterflatulencefloodheavenmusical numbershadowturtletigerglobal warmingmigrationlavaprehistoric timesglacierphobiavalleyanimal that acts humanlogextinctiondeath of parentnestpiranhareference to noah's arkimitationpinatasequel to cult filmcgi filmfalling through iceice agewater slidegeyserherdmammothslothacornchild carechasmadopted brotherbird's nestadopted sisterflintextinct speciesmelting iceopossum (See All) |
When Scrat accidentally provokes a continental cataclysm with a storm, Manny is separated from Ellie and Peaches on an iceberg with Diego, Sid and Granny but he promises that he will find a way to return home. While crossing the ocean, they are captured by the cruel pirate Captain Gutt and his crew. β¦ However they escape and Manny plots a plan to steal Captain Gutt's ship and return to his homeland in a dangerous voyage through the sea. But the cruel pirates seek revenge against Manny and his family and friends. (Read More)
Subgenre: | cgi animationcomputer animationswashbucklerrevisionist history |
Themes: | falling in love |
Locations: | oceanstorm at sea |
Characters: | father daughter relationshipbest friendgrandmother grandson relationship |
Story: | talking animalgiraffekangaroosquirrelanimalno opening creditsrescuesequelbattleswordsword fightmapbirdunderwater scenerabbit β¦skeletongrandmothericepiratefourth partblockbustersharkdinosaurwhalemigrationfall from heightnatural disastercrabprehistoric timesrainbowapeavalancheanimal that acts humanpirate shipseal the animalatlantisicebergoverprotective fatherbeaverice agebadgerhot springherdmammothslothacorngiant wavesiren the creaturenorth americawoolly mammothgiant apepangeasabertooth tigernarwhalelephant sealmelting icesliding on icecontinental driftsabre toothed catland bridgemarmotsperm whale (See All) |
RJ, a raccoon who needs food, accidentally takes food from a hungry bear named Vincent and he wants his food to be found in exactly the same place in a week. He finally finds that an animal family, with a tortoise named Verne as their leader, could help him restore the food from the suburbia, the ga β¦teway to the good life. But little does RJ know, there is a woman who has recently hired an exterminator to try to hunt them down. (Read More)
Subgenre: | cgi animationcomputer animation |
Themes: | revenge |
Mood: | nightmarenight |
Locations: | foresttruckcavesuv |
Characters: | family relationshipsfather daughter relationshipfriendvillain |
Story: | animal protagonisttalking animalsquirrelsurprise after end creditsanimaltitle spoken by characterdogexplosioncell phonefoodcatwomanhousedream sequencetree β¦suburbtrapgardenbearbirthday cakestealinglaserturtlerefrigeratorbarbecuechainwilhelm screambullet timeconservationcookieconsumerismvending machineraccoonanimal that acts humanbased on comic striphumanwagonpretending to be deadexterminatorskunktalking catcgi filmbelchjunk foodstealing foodgarden gnomecoolerpotato chipporcupinerabieshibernationgirl scoutsgelatinbug zapperurban sprawlpersian cattalking bearpossumpet doorpool housetalking turtleanimal driving a carsqueeze toyhome owners association (See All) |
Back when the Earth was being overrun by glaciers, and animals were scurrying to save themselves from the upcoming Ice Age, a sloth named Sid, a woolly mammoth named Manny, and a saber-toothed tiger named Diego are forced to become unlikely heroes. The three reluctantly come together when they have β¦to return a human child to its father while braving the deadly elements of the impending Ice Age. (Read More)
Subgenre: | cgi animationcomputer animationcult film |
Themes: | murderdeathredemptionhuntingevolution |
Mood: | rain |
Locations: | snowvillagecavecave in |
Characters: | baby |
Story: | talking animalsquirrelcliffvolcanono opening creditsrescuetitle spoken by characterflashbackdogfightchasefirefalling from heightambushfish β¦spaceshipcreaturenecklaceon the roadlightningpursuitfirst partwaterfallsleepingicewolfspearslow motionmale bondingloss of wifeblockbusterjumping from heightcgicompassionanimal attackdinosaurearthquakeloss of sonice skatingskiingglobal warmingdefecationmigrationtaekwondopopcornlavapalm treesnowboardingpunpantomimeprehistoric timescavemanrescue from drowningavalancheflying saucerglacieranimal that acts humantropical islanddoomhumanextinctioncoconutinfantrhinocerossnowballdiaperstruck by lightningicebergcgi filmmelonice agestonehengeice sculpturemammalsaladicicleshortcutcave paintinggeyserherdmammothtug of warsinkholeslothneanderthalacorndandelioncave drawingmud bathstepping in shitwoolly mammothhailstick figureice floeice cavetar pitanimal tracksabertooth tigersurrogate uncleprimitive artcharacter shaped holedodo birdicemansarcasm taken literallypineconecharades the gamemelting iceslalomsliding on iceicecappawprintprehistoric paintingbaby's first steps (See All) |
After the events of "Ice Age: The Meltdown", life begins to change for Manny and his friends: Scrat is still on the hunt to hold onto his beloved acorn, while finding a possible romance in a female sabre-toothed squirrel named Scratte. Manny and Ellie, having since become an item, are expecting a ba β¦by, which leaves Manny anxious to ensure that everything is perfect for when his baby arrives. Diego is fed up with being treated like a house-cat and ponders the notion that he is becoming too laid-back. Sid begins to wish for a family of his own, and so steals some dinosaur eggs which leads to Sid ending up in a strange underground world where his herd must rescue him, while dodging dinosaurs and facing danger left and right, and meeting up with a one-eyed weasel known as Buck who hunts dinosaurs intently. (Read More)
Subgenre: | cgi animationcomputer animation |
Themes: | surrealismpregnancylonelinessinsanity |
Mood: | nightmare |
Locations: | junglesnow |
Characters: | family relationshipsbaby girl |
Story: | talking animalsquirrelno opening creditsrescueflashbacksequelsubjective camerabridgechild in perilthird parton the roadskeletonchildbirtheggbirth β¦dinosaurplayground3deye patchgiving birthlavaaltered version of studio logotyrannosaurus rexprehistoric timesanachronismanimal that acts humanexpectant motherexpectant fatherice ageextended familypterodactylmammothslothweaselacorndinosaur eggrescue team3d sequel to 2d filmlost worldice cavebaby dinosaurallosaurussabertooth tigerpregnant animalnext generation (See All) |
Abandoned after an accident, baby Mowgli is taken and raised by a family of wolves. As the boy grows older, the wise panther Bagheera realizes he must be returned to his own kind in the nearby man-village. Baloo the bear however thinks differently taking the young Mowgli under his wing and teaching β¦that living in the jungle is the best life there is. Bagheera realizes that Mowgli is in danger, particularly from Shere Khan the tiger who hates all people. When Baloo finally comes around, Mowgli runs off into the jungle where he survives a second encounter with Kaa the snake and finally, with Shere Khan. It's the sight of a pretty girl however that gets Mowgli to go the nearby man-village. (Read More)
Subgenre: | 2d animationdisneybuddy comedyhand drawn animationtraditional animation |
Themes: | friendshipsurrealismkidnappingabductionadoption |
Mood: | rainnight |
Locations: | junglevillageindiajungle book |
Characters: | friendsingerboygirlhuman animal relationshipbaby boy |
Period: | 19th century1890s |
Story: | talking animalroaringvultureanimalsnakerescuetitle spoken by characterdogbased on novelfightdancingsingingthree word titlefirevoice over narration β¦riverorphanstrangulationdisguisenarrationkingtreeactor playing multiple rolesfirst partwildlifebearcross dressingmonkeywolflifting someone into the airelephantblockbusterfaked deathcolonelanthropomorphismbarefootticklingchild protagonistanthropomorphic animalhypnosisthunderstormblack eyebananamusical numberdeertigerhappy endingrunning awayjazz musicfruitbare chested boyanthypnotismmale protagonistcactusfriends who live togetherfamous scoretitle same as book10 year oldanimal that acts humanyoung boyabandoned babysong and danceorangutanpantherwild animalcastle thundersurrogate familyorphan boycartoon bearwolf packtalking birdferal childlead singerblack pantherwild childcroonersinging animalancient ruinshuman animal friendshipbackup singerstorybook in opening shotcartoon wolfinterspecies friendshiptalking bearcartoon elephanthappy go luckywolf cubanimal licking someonecartoon monkeyspiraling eyescartoon tiger10 year old boyhuman bear relationshiptalking snaketalking wolf (See All) |
A happily domesticated grizzly bear named Boog, has his perfect world turned upside down after he meets Elliot, a scrawny, fast-talking one-horned wild mule deer. They both end up stranded together in the woods during hunting season and it's up to the duo to rally all the other forest animals and tu β¦rn the tables on the hunters. (Read More)
Subgenre: | cgi animationcomputer animation |
Themes: | friendshiphunting |
Locations: | forestsmall townlaketruck |
Characters: | bullynative americansheriff |
Story: | talking animalstampedesquirrelscene during end creditssurvivalrescuetitle spoken by characterdogf ratedexplosionfalling from heightriflebramountaintoilet β¦fishgunshottreerabbitfirst partunderwaterwaterfallbeargaragesupermarkethunterteddy beardeerduckdefecationhit by a truckscottish accentfrench accentsmall town sheriffskunktalking to an animalbeaverpark rangerrangerdog lovergrizzly beardachshundporcupine (See All) |
An imaginative Disney version of the Robin Hood legend. Fun and romance abound as the swashbuckling hero of Sherwood Forest and his valiant sidekick plot one daring adventure after another to outwit the greedy prince and his partner as they put the tax squeeze on the poor.
Subgenre: | 2d animationdisneyswashbuckler |
Themes: | friendshipmoneytortureweddingherorobberytheftexecutiongreed |
Mood: | rain |
Locations: | churchforestenglandcastle |
Characters: | priestthiefwarrioraction herovillainsheriffthief hero |
Story: | animal protagonisttalking animalhippopotamusvulturesquirrellionsnaketitle spoken by characterdogcharacter name in titlekisschasefireunderwearcat β¦swordjailcombatgood versus evilfoot chasesword fightaxedisguisefootballdisarming someonevoice overmissionrabbitpigchickenbearsleepingcross dressingarsonprincewolfbow and arrowballoonelephantmouseblockbusterrebelfaked deathtournamentfalse identityanthropomorphismguardimaginationanthropomorphic animalhypnosismedieval timesoutlawdungeonturtlearrowowlstick fightanimal name in titlevillain played by lead actorsidekickswordsmanpeasantrobberfoxcorporal punishmentcrocodilearcheryadventure herosleeptyrantfriends who live togetherroosterarcherbowmiddle agesblacksmithanachronismraccoonvillain arrestedgender disguiseburning buildingcarriagechildhood sweetheartjail breakaxe fightrhinocerospuppet showcollisionreference to walt disneyexecutionerfurrycastle thunderbadgerbased on legendtaxorphan boyplay fightanthropomorphic mousebadmintonbased on folk talewolf whistlelong sword12th centurystorkwooden swordends with a weddingthumb suckingminstrelfriartax collectoraleanthropomorphic dogends with weddinganthropomorphic catluteanthropomorphic birdnarrow escapeanthropomorphic bearanthropomorphic rabbitstorybook in opening shotregentswordsmanshipanimal villainspiraling eyesanthropomorphic turtlesherwood forestanthropomorphic elephantanthropomorphic foxanthropomorphic pigprince john (See All) |
In a town with no humans, just animals, a koala named Buster Moon realizes he will soon lose his theater if he cannot turn his luck around. He comes up with a plan to host a singing competition, where the winner will receive $100,000. Will this be enough to return his theater to glory?
Subgenre: | cgi animation |
Themes: | prisontheatreprison escape |
Locations: | helicoptercity |
Characters: | father son relationshipteenage girlmusicianself confidence |
Story: | talking animalkoalagiraffealligatorpenguintitle spoken by characterflashbackdogone word titlesingingcatpianoguitarnewspaperconcert β¦microphonerabbitbaseball batpigchickenbearcowmonkeystrong female characterpickup trucksupermarketelephantmousespiderfrogsheepgoatgrandfatheranthropomorphic animaldespairprison cellwilhelm screamplaying pianoconstruction workermoney problemspiano playinggorillaguitar playingcheering crowdcar washelectric guitarprison breakchimpanzeesnailtalking dogspeedorhinocerosbuilding collapsechestsquidtalent contestbeaversinging conteststage frighttalking catfather and songlass eyefurryiguanabullhornshrimpfather son hugwashing a caranthropomorphic mouseporcupinerubblecheating at cardsjukebox musicalsinging animalanthropomorphic doganthropomorphic catanthropomorphic bearanthropomorphic rabbittalking mousetelevision news reporttalking gorillapool houserabbit maskamateur musicianstuck in trafficanthropomorphic elephantanthropomorphic lizardanthropomorphic pignumber 6romantic betrayaltalking pig (See All) |
The man-cub Mowgli flees The jungle after a threat from the Tiger Shere Khan. Guided by Bagheera the panther and the bear Baloo, Mowgli embarks on a journey of self-discovery, though he also meets creatures who don't have his best interests at heart.
Subgenre: | disney |
Themes: | friendshipcourage |
Locations: | junglevillagecave |
Characters: | boyhuman animal relationship |
Story: | talking animalstampedevulturesquirreltorchno opening creditsflashbackbased on novelsingingfireremakerivergood versus evilorphanjourney β¦treemanipulationbearmonkeywolfburned aliveelephantmusical numberdeertigerbonfirebellbare chested boyfriends who live togetherclimbing a treenight timebuffalorhinoceroshoneyvineorangutanhowlingpantherstar died before releasegiant snakepythonwolf packbowingporcupineblack pantherwildfirewild childfighting backlive action remakegiant apewild pighoneycombanimal companiontalking bearbaby elephantingenuitywolf cubtreetophuman bear relationshipraised by animalstalking snaketalking wolf (See All) |
Storks deliver babies...or at least they used to. Now they deliver packages for global internet giant Cornerstore.com. Junior, the company's top delivery stork, is about to be promoted when he accidentally activates the Baby Making Machine, producing an adorable and wholly unauthorized baby girl. De β¦sperate to deliver this bundle of trouble before the boss gets wise, Junior and his friend Tulip, the only human on Stork Mountain, race to make their first-ever baby drop - in a wild and revealing journey that could make more than one family whole and restore the storks' true mission in the world. (Read More)
Subgenre: | cgi animation |
Themes: | revengeloneliness |
Locations: | helicopterboatjapansubmarine |
Characters: | father son relationshippolicemother son relationshipafrican americanteenage girlfemale protagonistpolice officerpolicemanbabythiefvillainbaby girlmysterious villainbaby cryingbaby daughter |
Period: | 2010s |
Story: | canada goosetalking animalflamingopenguinpigeonno opening creditsflashbackchasesurprise endingfirecryingsecretgood versus evilnew yorkdisguise β¦bridgetransformationfactorymanipulationglassestied upchickengolfwolfflyingbossimaginationanthropomorphic animalfalling to deathplanehearttitle at the endsaunanoteflightrocketstoregolf clubmachineno title at beginninghelicopter crashfallingglassafrican american womanmale protagonistforgeryrealtorpolar beartieceobaseball stadiumtragic villainworkaholicyoung boyexecutiveafrican american manfiredneglected childbaboonfalling downpelicantalking birdbaby bottlesuspension bridgestorkplaying golfpush buttonantagonistangry bossemuhoming pigeonrobinwarner brosanthropomorphic birdanthropomorphic bearanthropomorphic rabbitvillainymale antagonisttalking bearanimal villaintalking monkeytooth falling outview in sideview mirrorbaby powdercorner storeflying wingbabiesdelivery storknothing happenedtalking rabbittalking wolfuvula (See All) |
The candy recipes of the goody shops have been stolen by the Goody Bandit, and many animals are out of business. While the police are chasing the criminal, there is a mess at Granny's house involving Little Red Hiding Hood, The Wolf, The Woodsman and Granny, disturbing the peace in the forest. They β¦are all arrested by the impatient Chief Grizzly. Detective Nicky Flipper is in charge of the investigation, and each accused gives his/her own version of the incident. Flipper uses the information to disclose the identity of the evil Goody Bandit. (Read More)
Subgenre: | cgi animationcomputer animationindependent filmmartial artsfairy talefairy tale parody |
Mood: | spoof |
Locations: | forestcable carmine car |
Characters: | policefemale protagonistactorgrandmother granddaughter relationship |
Period: | 2000s |
Story: | talking animalsquirrelpenguinanimalsnaketitle spoken by characterflashbackexplosionsingingcamerarivercompetitioncriminalbound and gaggedaxe β¦mountaindisguisefalse accusationauditionrabbitpigbeargrandmotherwolfsurfingfrogsheepgoatanthropomorphismcrime scenereverse footageanthropomorphic animalskateboardingdynamitemusical numberskiingturtlesnowboardingin medias respolar bearavalancheextreme sportsrock climbingraccoonlumberjackskydivingcaterpillarmultiple perspectivessnowballskunkbeavercgi filmgrizzly bearred riding hoodhummingbirdporcupinebungee jumpingwoodpeckerwoodsmancontradictory accountsundercover reportermale antagonistpop up bookbarnstormingyodel (See All) |
A rat named Remy dreams of becoming a great French chef despite his family's wishes and the obvious problem of being a rat in a decidedly rodent-phobic profession. When fate places Remy in the sewers of Paris, he finds himself ideally situated beneath a restaurant made famous by his culinary hero, A β¦uguste Gusteau. Despite the apparent dangers of being an unlikely - and certainly unwanted - visitor in the kitchen of a fine French restaurant, Remy's passion for cooking soon sets into motion a hilarious and exciting rat race that turns the culinary world of Paris upside down. (Read More)
Subgenre: | cgi animationcomputer animationfish out of waterslapstick comedy |
Themes: | deathlovefriendshipghostjealousydrinkingdrunkennesstheftobsessiondeath of motherabductioninheritancestarvation |
Mood: | rain |
Locations: | sewerrestaurantmotorcycleparis franceboatbicyclekitchenfrancerooftoptunnelfrench restaurant |
Characters: | father son relationshippolicefriendbrother brother relationshipbrother sister relationshippolicemanlawyerthieffrenchuncle nephew relationship |
Story: | talking animalevacuationanimalrescuetitle spoken by characterflashbackdogviolenceone word titleinterviewkissknifechasetelephone callfire β¦voice over narrationfoodface slapshotgunwatching tvdrinkbookriflerunningcaferiverreporternewspapercookingwinewomaneatingpainterunderwater sceneroommateold womanconfessionpoisonstorytellinglightningratblindfoldsleepingwaitereggtold in flashbackcookblockbusterchefanimal attackstreet lifefood in titlegas maskanthropomorphismanthropomorphic animalhungerrainstormchildhood memorynew jobhairapparitionsuccesseiffel tower parislast will and testamentbreadfalling into waterimaginary friendsoupchandelierdnamushroomsense of smellbreaking a windowcheesegarbagetomatoheirpuppetryorchestral music scorepun in titleroller skatesin medias resmarketingmotor scooterovenrecipebitingtv show in filmstruck by lightningmotorcycle helmetshellmousetrapomenseine riversinkpesticideseparation from familyrat poisonbargedead ratgourmetla marseillaiseanthropomorphic mousecookbookfancy restaurantfood criticgastronomyomeletpantryspicehealth inspectorstarving artistsense of tastestepladdercleanlinesshaute cuisinesous cheffrench cuisinerotisseriechef's hatfood pornculinary schoolsnack foodculinary artistrat invasiongrowling stomachpots and panspulling someone's hairratatouille (See All) |
It's a jungle out there for Blu, Jewel and their three kids after they're hurtled Rio de Janeiro to the wilds of the Amazon. As Blu tries to fit in, he goes beak-to-beak with the vengeful Nigel, and meets the most fearsome adversary of all: his father-in-law.
Subgenre: | cgi animation |
Locations: | junglebrazil |
Characters: | father daughter relationship |
Story: | animal protagonisttalking animalanimalno opening creditssequelsecond partbirdmonkeyfrog3 dimensionalparrotexplorationamazonaltered version of studio logoromantic rivalry β¦deforestationrainforestfather in lawcanarytalking birdcockatoowoodpeckertoucansinging animalillegal loggingfanny packanteatertalent auditionsinging bird (See All) |
Following his parents' death in Africa, John Clayton has been be raised by an ape, was known by the name Tarzan, but eventually left Africa and for his parents' home in England, along with the woman he fell in love with and married, Jane Porter. He is asked by Belgian King Leopold to go to Africa to β¦ see what he has done there to help the country. Initially, he refuses. But an American, George Washington Williams, wants him to accept so he can accompany him. He says that Leopold might be committing all sorts of atrocities to achieve his goal, like slavery. Clayton agrees and his wife insists that she accompany him because she misses Africa. When they arrive, a man named Rom, who works for Leopold, attacks their village and captures Tarzan and Jane. With Washington's help he escapes and sets out to rescue Jane by going across the jungle. Washington joins him despite being told that he might not make it. (Read More)
Subgenre: | martial artsblack comedyswashbucklerrevenge plot |
Themes: | deceptionmurderdeathfriendshiprevengekidnappingbetrayalpoliticsescapecorruptiondeath of fatherbrutalitydeath of motherredemptionexploitation β¦greeddeath of wifewealthcourageself sacrificehuntingnear death experience (See All) |
Locations: | jungleafricatrainboatlondon englandvillageshipcavecampfire |
Characters: | father son relationshiphusband wife relationshipafrican americansoldierbabyhostagetough guywarrioraction heromaidsniperamerican abroadengineeramerican in the uk |
Period: | 19th century1880s |
Story: | wildebeeststeamshipstampedehippopotamusliontorchno opening creditssurvivalrescuetitle spoken by characterflashbackcharacter name in titlebased on novelviolenceone word title β¦bare chested malekissfightphotographexplosionknifechasesurprise endingfirevoice over narrationshootoutbeatingcorpseshot to deathfistfightmachine gunshot in the chestslow motion scenepunched in the facebattlegunfightbrawlfalling from heightlettershowdownrifleheld at gunpointbeerhand to hand combatinterrogationhandcuffsrevolverrivercombatshot in the backsubjective cameragood versus evilorphanambushstrangulationmassacremountainwomanmontagearmymixed martial artsmapnonlinear timelineanti herodisarming someoneone man armyassassinationchild in perildouble crossunderwater scenekingracial slurflash forwardattempted murderone against manytreebinocularsbeaten to deathdangerprologueumbrellacharacter's point of view camera shotrace against timetentevil mankicked in the facetough girllightningopening action scenebraceletdiarymanipulationscardeath of sonloss of fathersuspiciontied upthreatened with a knifemercenarywaterfallflowerloss of mothernewspaper headlinesubtitled scenemonkeybattlefieldstylized violencecouplecaptainsabotagefireplacegrenadebow and arrowkilling an animalrevelationhead buttspearheavy rainquestslaveryelephanthunterloss of loved onekicked in the stomachblockbusterdesperationservantjumping from heightskullanimal attackinterracial friendshipsocial commentaryslaveeaten alivepresumed deadfemale warriordamsel in distressadventurershielddiamondfloodbraverydual wieldloss of sonmercilessness3 dimensionalgash in the facerowboatescape attemptpunched in the chestaerial shotfograinstormcapturetribepierpassionate kissdeath of loved onegatling gunhogtiedclose up of eyesprime ministerenglishman abroadmale objectificationyellinghistorical fictionexpeditionfinal showdownspit in the facecrocodilegun held to headcomic reliefshot with an arrowgorillayoung version of characteradventure herocheering crowdfilm starts with textstretcherrailroadreluctant heroadopted sonantcolonialismswimming underwaterbankruptcyhumorfight the systemfinal battleheirwet t shirtaperighteous ragetreehousedeath of familyloss of familyportdiplomatanimal killingbilingualismhide and seekextreme close upgas explosionrainforestknife held to throatrepeating rifleasphyxiationexploding boatrosarymultiple time framesslow motion action scenehorse drawn carriagebegins with textcongowoman punches a manlordrescue attemptcoming out of retirementleopardostrichmanor housevinecollapsing buildingcaught in the raincaged humancaught in a netslave laborjungle warfareamerican womanbelgiankissing in publiccheetahlocked in a cageanimal bitesteamboattarzantelescopic riflecivil war veterangeopoliticssavannahreboot of seriesmineralriver boatshackleddislocated shouldertribal chiefbegins with historical notesrolling down a hillstitching a woundledgerjumping from a boatpebbletrampledear shot offenvoyjumping off cliffskiffpaddlewheel boatprecipicetribal leaderwhite paintfording a river (See All) |
Woody, Buzz and the whole gang are back. As their owner Andy prepares to depart for college, his loyal toys find themselves in daycare where untamed tots with their sticky little fingers do not play nice. So, it's all for one and one for all as they join Barbie's counterpart Ken, a thespian hedgehog β¦ named Mr. Pricklepants and a pink, strawberry-scented teddy bear called Lots-o'-Huggin' Bear to plan their great escape. (Read More)
Subgenre: | cgi animationcomputer animationblack comedysuspensedark comedy |
Themes: | deceptionfriendshipbetrayalprisonescapepsychopathgamblingbullyingpanicnear death experienceprison escape |
Characters: | mother son relationshipbrother sister relationshipteenage boyhostagelittle girlsecurity guardterror |
Period: | 2010s |
Story: | garbage truckflirtingscene during end creditsno opening creditssurvivalrescueflashbackdognumber in titleviolencesequelcryingdigit in titlecollegenumbered sequel β¦video cameraprisonertied to a chairapologychildthird partsuburbfantasy sequencecowboydollcollege studentmanipulationthreatisolationsadnessstrong female characterhenchmanmaniacsociopathlifting someone into the airgroup of friendscowboy hatcaptivetoyblockbusterlosspart of trilogyteddy bearanthropomorphismwoman in jeopardytensiontrappedsurveillance cameranostalgiaspanishlove at first sightescape attemptboxgay stereotypegrowing upwilhelm screamholding handsvideo surveillanceohioeyeabandonmentdegradationlavafemale heroheld captivetestleaderfriends who live togethergarbagenazismprison breakclothingmenacefemale to male foot in crotchlocked in a roomstupid victimcat and mouse555 phone numberreturning character with different actorcomeuppancetauntingdeeply disturbed persontragic villaintoddlersexual arousalsecurity systemmagnetthird in trilogychange of heartmale tied upcalling someone an idiotgarbage dumpperiltoy comes to lifebarbie dolldeus ex machinagoing homepersonality changeerased memorypatroldoor lockballadeercaught on tapelocked in a cageescape planmoney bagexploding bridgeturning the tables3d sequel to 2d filmstruggle for survivalgarbage dumpsterday carecowboy bootdeformedmislaid trustmr potato headsneakingtoy bearanthropomorphic toyday care centerfemale dressed as maleincinerationken dollmultiple villainsguardsanimated dogemotional shockloss of eyethrowing money into the airtroll dollspanish musictortillamoney bag with dollar signslinky dogtwo faced personjust dessertsplaytimesaved from a firespace rangerevil teddy bearfacing deathfemale emasculating a male (See All) |
Volcanologist Harry Dalton and mayor Rachel Wando of Dante's Peak try to convince the city council and the other volcanologists that the volcano right above Dante's peak is indeed dangerous. People's safety is being set against economical interests.
Subgenre: | suspensetragedydisaster film |
Themes: | deathdrunkennessescaperedemptiondeath of wifeapocalypse |
Mood: | high school |
Locations: | barforesthelicoptersmall townwoodslakemotelgas station |
Characters: | family relationshipsmother son relationshipmother daughter relationshipbrother sister relationshipsingle mothersheriffmayorgrandmother grandson relationshipgrandmother granddaughter relationship |
Period: | 1990s |
Story: | volcanic eruptionsquirrelvolcanoevacuationproduct placementsurvivalrescuetitle spoken by characterdogtwo word titleexplosionsurprise endingpunctuation in titlecorpsemirror β¦computerapostrophe in titlescientistflashlightmountainbridgechild in perilcoffeeskinny dippingprologuewidowerspeechtragic eventsuspicioncabinsingle parentdisasteranswering machineoverallsearthquakewhiskeyecologychaosmillionaireconvenience storeco workerrowboatminewilhelm screamexploding helicopterparking lottracking devicemagic trickhead woundacidpush upslavakittenhelicopter crashdammother in lawmarching bandbody bagnatural disastermaggotdeath of grandmotherdead wifecatastrophewine drinkingtalismanpacific northwestabandoned minegeologistnational guardbridge collapsebell towerhot springdominoescomputer nerdexploding gasoline stationtransmittercounty fairashhair brushacid burningcappuccinocontaminated watertrailer narrated by hal douglasshockwavefemale mayornarrow escapefalling rockactive volcanocomputer technologyvolcanic ashpyroclastic flowboiling alivedust cloudseismologistcascadescollapsing towerrescue partyseismographtrapped in a mineseismologylava streamvolcanologist (See All) |
Carl Denham needs to finish his movie and has the perfect location; Skull Island. But he still needs to find a leading lady. This 'soon-to-be-unfortunate' soul is Ann Darrow. No one knows what they will encounter on this island and why it is so mysterious, but once they reach it, they will soon find β¦ out. Living on this hidden island is a giant gorilla and this beast now has Ann is its grasps. Carl and Ann's new love, Jack Driscoll must travel through the jungle looking for Kong and Ann, whilst avoiding all sorts of creatures and beasts. But Carl has another plan in mind. (Read More)
Subgenre: | martial artsmelodramaepicmonster movie |
Themes: | murderdeathkidnappingescapemonsterfilmmakingwrestlingpanicunemployment |
Locations: | junglenew york citytaxirooftopairplane accidentcanyonstorm at sea |
Characters: | policeactoractressfilm directorhuman animal relationship |
Period: | 1930s |
Story: | steamshipstampedetimes square manhattan new york citycliffcrushed to deathno opening creditsmanhattan new york cityrescuecharacter name in titletwo word titlekissdancingchaseshot to deathmachine gun β¦car accidentshot in the chestremakefalling from heightislandstabbingdeath of friendwomanbridgearmyimpalementdinermapjourneyscreamskeletonfilm within a filmshot in the armtypewritereavesdroppingspearslow motionlifting someone into the aircookmovie starblockbusterladderanimal attackeaten aliverampagedamsel in distressshopliftingbackstagerowboatfogfilm producerrainstormpierplaywilhelm screamchloroformanimal name in titleexpeditiontributegatecentral park manhattan new york cityhuman sacrificegorillaskyscrapertrue lovewallplaywrightcameramanfalling into watergreat depressionfilm studiobroadway manhattan new york citycowardtyrannosaurus rexair raiddeath of title charactertommy gunbiplanecaverngiant animalstarvingacrobaticslogprohibitionfootprintchecklifting female in airgiant spiderjugglingimpossible lovegiant insectkaijufrozen lakebarefoot womanvineempire state building manhattan new york cityalliterative titlevaudevillelifting an adult into the airtriceratopssea captainanimal deathremake of cult filmtroubled youthnative tribescreening roomfalling over a cliffking kongcartwheelsimian fictiondrawbridgeseamanravinecentral parkchasmindian oceanlibrary bookbroken jawlost worldmonster as victimremake of remakecolor remake of black and white filmspear through chestbrontosaurusdisaster in new yorkdirector actor relationshipgiant apegiant batlifting a woman into the airrescue partygas bomb (See All) |
The story is about a team of trained secret agent flies and a mole that takes on a mission for the US government. A specially trained squad of not guinea pigs is dispatched to stop a diabolical billionaire, who plans to taking over the world with household appliances.
Subgenre: | cgi animationcomputer animation3d animation |
Mood: | car chase |
Locations: | suv |
Story: | talking animalgarbage truckno opening creditssnaketitle spoken by characterdogpunctuation in titlecatspysecret agentfireworkshyphen in titlemouseskateboardpart animation β¦anthropomorphic animal3dlaptop computersatellitegiant robotcockroachtrampolinerecreational vehicleblack catmicrowave ovenkiller robothamsterclothes linepet shopspecial agentpep talkarmored vehiclewoman wearing glassesanimal human communicationpet storeguinea pigrvpart computer animatedradio controlled toymassive explosionpizza boxhouse flytalking mousetire swinganimal villainfbi directorkitchen appliancehigh speed chaseanimal ally (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
Subgenre: | live action and animation |
Themes: | dancedeathfearmagicmilitaryangerpanic |
Locations: | junglebeachmotorcyclesmall townlondon englandbicyclevillageenglandcastlemuseumtrain stationsubmarine |
Characters: | childrensingerbrother brother relationshipboysoldierdancermusicianpriestlittle girllittle boywitchgermanhuman animal relationship |
Period: | world war two1940syear 1940 |
Story: | roarvulturegiraffekangarooalligatorpigeonclifflionevacuationfightdancingexplosionsingingknifepistol β¦firecryingbased on booksongmachine gunmirrorpunched in the facebattleswordletterbookriflebombrunningbedbritishislandcompetitioncombatorphansoccerflashlightcandleold manfishchilddream sequencefishingkingcigar smokingnecklacetransformationgunshotlibrarybinocularsuniformfantasy sequencetentrabbitscreampianistpursuitcountrysideunderwaterbearmonkeyapplauseropewaitercaptainentertainmentgrenadebow and arrowathleteflyingspearperformancelifting someone into the airrageelephantmagiciancaptivemousetoyenemywitchcraftfraudaudiencepart animationparadecolonelfull moonanthropomorphismshieldexplosiveinvasionanthropomorphic animaldrummerballcon artistlaughterarmorraidsailortrophycrowdmusic bandposterrefereeplaying cardsimprisonmentspellauntmagic tricknotebookchoreographystreet marketbicyclingperformergorillatween girlwhistlecrowndrummedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiometamorphosisunsubtitled foreign languagepotionpalm treetrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentapprenticeliquidpet catanimal that acts humanlockballroomhookmarchstreet vendorbroomretreatscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerleopardlongingostrichvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelinehyenaincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingcalypsochorinegoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All) |
Super spy teams aren't born...they're hatched. Discover the secrets of the greatest and most hilarious covert birds in the global espionage biz: Skipper, Kowalski, Rico and Private. These elitists of the elite are joining forces with a chic undercover organization, The North Wind. Led by handsome an β¦d husky Agent Classified (we could tell you his name, but then...you know). Together, they must stop the villainous Dr. Octavius Brine, from destroying the world as we know it. (Read More)
Subgenre: | cgi animationrevenge plot |
Themes: | revengepanic |
Locations: | helicopterdesertsubmarineairplane cockpit |
Characters: | little girlrevenge seeker |
Period: | 2010s |
Story: | talking animalpenguinzoocircusscene during end creditsrescuesequelcatspynew yorkdisguiseweaponparkpilotbaseball bat β¦fireworkshenchmanwolfmutantspin offchefsheeptrappedsuper villaincartoonparachutecaptureowlbreak inbird in titleoctopuspolar bearvending machinestatue of libertyshanghaiice cream truckcricketseal the animalsnowglobecorporalserumtranquilizer dartgondolacardboard boxpineappleremote islandmaster of disguiseslow motion sequencetrue identity revealeddead endheadquartersisland name in titlefuturistic aircraftpest controlvenicejetpackjet aircraftwhite catpaper cliplife raftabacuselite teamworld mapexo suitpassenger jetmassive explosionsequel to tv seriesbouncy castlemermaid costumemilitary salutetalking beartelevision news reportdisguised as humanfood cartattempted revengeview through binocularsglass ballleopard sealdoomsday weaponfunny facehover tanktalking penguintalking wolf (See All) |
After the defeat of their old arch nemesis, The Shredder, the Turtles are needed more than ever, but Raphael, Donatello, and Michelangelo have become lost and direction less. Leonardo has gone to Central America, on the orders of the martial arts master and father figure Master Splinter, for trainin β¦g. Donatello and Michelangelo have started small businesses in Leonardo's absence. Meanwhile, strange things are happening in New York City. An army of ancient creatures threatens to take over the world and the Turtles must unite again to save it. (Read More)
Subgenre: | cgi animationcomputer animationmartial artssuperhero |
Themes: | monsterherodating |
Locations: | sewerjunglenew york cityairplanerooftopmuseumrooftop fight |
Characters: | teenagerbrother brother relationshipwarrioraction hero |
Story: | talking animalrescueflashbackviolencekissfightfistfightbattlebrawlmaskshowdownhand to hand combatfightingcombatkung fu β¦sword fightbased on comic bookterroristdinerdisarming someoneacronym in titlenarrationdouble crossbirthday partyninjaopening action sceneratunderwatervigilantepizzamartial arts masterheroinemacheteskateboardaction heroinechop sockyconstruction sitekatana swordanthropomorphic animalimmortalitymentorsibling rivalryknife fightturtlesword duelstick fightkung fu fightingtelevision newsskyscraperninjitsucartoon violencefemale villainentire title is capitalized acronymwarlordbo staffgroup name in titlenunchucksvortextranquilizer dartremake of cult filmteenage mutant ninja turtlesninja armysaihang gliderliving statuewarner broscosmic zoomancient cursehalfpipetech supportcaged monster (See All) |
Set in Scotland in a rugged and mythical time, "Brave" features Merida, an aspiring archer and impetuous daughter of royalty. Merida makes a reckless choice that unleashes unintended peril and forces her to spring into action to set things right.
Subgenre: | cgi animationcomputer animationcoming of ageslapstick comedy |
Themes: | deceptionrevengemarriageghostescapemagicredemption |
Locations: | forestsnowboatvillagewoodsshipcastle |
Characters: | father son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipbrother brother relationshipbrother sister relationshipteenage girlfemale protagonistgirltough guywarriormaid β¦witchhunting party (See All) |
Story: | stuffed animaltorchno opening creditsrescuetitle spoken by characterflashbackdogfemale nudityf ratedone word titlemale rear nuditydancingknifechasesurprise ending β¦voice over narrationtitle directed by femaleshot to deathhorseshot in the chestslow motion scenepunched in the faceswordbare buttshowdownbirthdayriverswimminggood versus evilfoot chasesword fightambushaxemontagefishkingprincessnecklacetransformationon the runtrainingflash forwardlegendcursecharacter repeating someone else's dialogueprologuescreamingkeyrace against timetough girllightningprankcontestfeminismchickenwaterfallshot in the armbearqueenprincestrong female characterchessdestinyfalling down stairsspiritfireplaceteen angstbow and arrowspearheavy rainlooking at oneself in a mirrorcakebuttocksrebelsheepstrong female leadfateanimal attackapplefemale warriorshieldtarget practicebraveryscotland3 dimensionalrowboatscene after end creditspunched in the chestmedieval timesprideaerial shotshadowrainstormknife throwingkingdomwisharrowblack magicsign languagecrowhorseback ridingtriple f ratedhit in the facebirthday presentstrongmanshot with an arrowyoung version of characterarcherycrowndomineering motherfemale heromooningmacguffinstablefight the systemheirarcherbechdel test passedbowbagpipesanimal killingbanquetrock climbingmagic spellteenage herothronehide and seekmedievalsuitorscottish accentbroomscotclothes rippinghuman becoming an animallordharptrackerrebellious daughterruinwood carvinginvisiblespit takeclanspear throwingteenage rebellionmatriarchytrackingone legged manrider horse relationshipwooden legmusic lessontug of warscottish highlandstripletscauldrongirl horse relationshipaxe throwingthrown from a horsebareback ridingredheaded girlcubriding bareback10th centuryirish wolfhoundtapestrypeg legceltdisney princessevil spelllutefemale horse riderfemale archerbetrothalplaying bagpipesbullseyehaggisanimal becomes humangirl riding a horsewill o' the wispfiery redheadwork horsedrumstickrefusing to believehighland gamesmenhir (See All) |
Mumble the penguin has a problem: his son Erik, who is reluctant to dance, encounters The Mighty Sven, a penguin who can fly! Things get worse for Mumble when the world is shaken by powerful forces, causing him to brings together the penguin nations and their allies to set things right.
Subgenre: | cgi animationcomputer animation |
Themes: | dance |
Locations: | ship |
Story: | animal protagonistpenguinnumber in titlesequeldigit in titlesecond partnumbered sequelfishtrappedson3 dimensional3dglacier3d in titleantarctica β¦snowstormseal the animal3d sequel to 2d filmwarner brospuffinelephant sealkrillbrad pitt (See All) |
Fievel is a young Russian mouse separated from his parents on the way to America, a land they think is without cats. When he arrives alone in the New World, he keeps up hope, searching for his family, making new friends, and running and dodging the cats he thought he'd be rid off.
Themes: | murderescapeheroangermafia |
Mood: | rain |
Locations: | sewernew york citystormsea monster |
Characters: | father son relationshipfamily relationshipsmother daughter relationshipboyfriend girlfriend relationshipsingerbrother sister relationshipbabyjewishbullyjewrussianmayorrussian jewkiller cat |
Period: | 19th century1880s |
Story: | talking animalroaringseparationpigeonsurvivalkissthree word titlefirecryingcatpianocriminalgood versus evilorphanband β¦gangdisguisebathcigar smokingimmigrationpop musicreunionratfirst partrecord playerhenchmancard gamepokercophong kongmouseloss of loved onebeardfraudclassical musicirishviolinappleanthropomorphismwhiskeyanti semitismfloodimaginationinvasionsoapnostalgiaitalian americanimpostoranthropomorphic animallove at first sightdespairdrummerlostthunderstormcon artistoutlawmustachesmokecoinaccountantstreet gangcockroachaccordionalarmseagullbubble bathrazorcheeserallyteethslingshotknittingscoldingstatue of libertygang leaderbarrelberetnoisetop hatticketduetbird cageangryshakespearean quotationwavesgoonnosechorusconfidenceclarinettenorcastle thunderspeech impedimentsopranoseasicknesssweatshopgrandmahanukkahbad tempergrandparenthalf dressed cartoon animalsecret revealedmaster of disguiseballadeerbowler hatanthropomorphic mouseroller skatetrue identity revealedgrandpagrowlingsobbingtubacat versus mousebarefoot cartoon animalpogrombubblescossackhiccupmockingevil catright hand manirish immigrantpoker chipanger issuesearsfake nosereference to shakespeare's twelfth nightboat dockcat attackscally capbaritoneloss of family membergang bossanger anonymousbabushkafake earsknit capamerican tailpurring (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Subgenre: | fairy taledisneybiblical |
Themes: | surrealismjealousyfearartmagicnatureangertheftunrequited lovehopeunemploymentfreedombook of magic |
Mood: | rainarchive footagepoetic justice |
Locations: | sewernew york citytrainswimming poolforesthotelcarsnowboatnightclubdesertbicyclewatertaxielevator β¦woodsapartmentlakeshiptruckrooftopcaveoceanforest fire (See All) |
Characters: | father daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteacherpolice officerdancermusicianactorartistlittle girlbullywaitresscomedianfisherman |
Period: | 1930swinter |
Story: | flamingovolcanic eruptionhippopotamusgiraffekangarooalligatorcliffvolcanolionsnakerescuedognumber in titlesequelkiss β¦dancingknifechasefirecryinghorsemirrorremakecatfalling from heightbooktearsrunningcafepianoriversubjective cameranewspaperaxemountainsubwayfishdream sequencedrawingfishingsearchanthologycoffeepaintreeportraitumbrelladragondollrabbitlightningscreampianistsadnessratunderwaterbearnewspaper headlinemonkeyjazzicewolffireplacedestructionfaintingperformanceelephantmagicianmousetoyoverallsclassical musicfrogtennisrailway stationpart animationviolinmilkorchestragoatclockembarrassmentapplepresumed deadanthropomorphismfloodtrappedthunderhypocrisymisunderstandingpet doganthropomorphic animalrejectionhungerdespairdrummerballlaughterbutterflyice skatingdaydreamshadowspyingdeerturtleduckboxhorse and carriageflightweathercoinbatjoycamelspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainwhalefoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatorwoodtemptationbeeperformerpopcornfalling into waterseagulllavaquitting a jobjacketsorcerercloudhostgreat depressionballerinadisappointmentimmaturityeagleasheshammockcrabmeteorpart computer animationrainbowhonestymistakeapepart live actiondrillpolar bearclumsinessconductorgymnasticswindowmiseryspringabstractcourtshipdoormanapprenticelocketnoiseblanketdoverebirthunicornrevolving doordance lessonregenerationstreet vendorice rinkbroombaldnesspaperdance classfaunacity parkconformityflorasheet musicsignextinctionnetsubway trainbucketbubblecoatphonograph recordvasehornrhinoceroswheelbarrowabstract artmovementfloatingostrichchestzebrajazz clubfigure skatinghard hatleashcartcollisionnoseorganisticebergskunksunlightcarrying someoneimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonpet storeelkiciclemarqueenoah's arkmilkmanfatiguehopscotchmusic lessonscubalife jacketramppuddlestooltripping and fallingashcauldronjazz combotubewhirlpoolarkcentral parkdizzinesssupernovaspellcastingbillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathsleeping in a chairbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionflower petalhenpecked husbandpantaloonwalnutlinebranchteardropflipperglowing eyestepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirdflooded roomtrampleddog bonetimingfruit cartlily padmagical hatseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All) |
When Po's long-lost panda father suddenly reappears, the reunited duo travels to a secret panda paradise to meet scores of hilarious new panda characters. But when the supernatural villain Kai begins to sweep across China defeating all the kung fu masters, Po must do the impossible-learn to train a β¦village full of his fun-loving, clumsy brethren to become the ultimate band of Kung Fu Pandas. (Read More)
Subgenre: | cgi animationcomputer animationmartial artswuxia |
Themes: | supernatural power |
Locations: | villagechina |
Characters: | father son relationshipteacher |
Story: | animal protagonisttalking animalno opening creditsflashbacksequelvoice over narrationtitle directed by femalefistfightslow motion sceneanimal in titlekung futhird parttrainingcharacter repeating someone else's dialoguedragon β¦split screenpigreunionchickenmonkeyfreeze framespiritmind controlanthropomorphismhit in the crotchanthropomorphic animalkicked in the crotchtigeryoung version of characterhugbullaltered version of studio logofather son reunionpandanunchuckscranefurryancient chinafalling down a hillyin and yangpraying mantisviperchitigressfurry fandomgiant panda (See All) |
The stork delivers a baby elephant to Mrs. Jumbo, veteran of the circus, but the newborn is ridiculed because of his truly enormous ears and dubbed "Dumbo". After being separated from his mother, Dumbo is relegated to the circus' clown acts; it is up to his only friend, a mouse, to assist Dumbo to a β¦chieve his full potential. (Read More)
Subgenre: | 2d animation |
Themes: | surrealismdrunkennessgreedprejudice |
Mood: | rainnightmarenightaffection |
Locations: | train |
Characters: | family relationshipsmother son relationshipbully |
Period: | 1940s |
Story: | hippopotamusgiraffekangaroolioncircusanimaltitle spoken by charactercharacter name in titleone word titlesingingfiredreambedhallucinationspanking β¦clownfantasy sequencechampagnebearflyinglifting someone into the airelephantmousegossipfloridaparadeanthropomorphismsufferingwhipanthropomorphic animalmiracletitle appears in writingmentorthunderstormparachutetigercrowcameloutcastmisfitteasingfriends who live togetherfablefeetracial stereotypestudio logo segues into filmzebralifting an adult into the airhalf dressed cartoon animalballadeeranthropomorphic mousestorkbarefoot cartoon animalblack stereotypebubblespeanutringmasteranimal feettalking mousebaby elephantcharacter shaped holebig earscartoon tigerdumbowalking on a clouddelivery stork (See All) |
In a Manhattan apartment building, Max's life as a favorite pet is turned upside-down, when his owner brings home sloppy mongrel Duke. They must put their quarrels aside when they learn that adorable white bunny Snowball is building an army of lost pets determined to wreak revenge.
Subgenre: | cgi animation |
Locations: | sewernew york city |
Story: | talking animalanimalsnakeflashbackdogpartycatfishbirdunderwater scenefantasy sequencerabbitpigflyingcake β¦frogremote controlanthropomorphic animalrefrigeratorwilhelm screampetlizardgoldfishdog moviehawksausagepoodleclothes linechihuahuaguinea pigdachshundrodentparakeetpugterriersiamese catpomeranian doganimal controlpersian catturkey as foodmongrellost animalparty animal (See All) |
Benjamin has lost his wife. In a bid to start his life over, he purchases a large house that has a zoo. This is welcome news for his daughter, but his son is not happy about it. The zoo is in need of renovation and Benjamin sets about the work with the head keeper, Kelly, and the rest of the zoo sta β¦ff. But, the zoo soon runs into financial trouble. The staff must get the zoo back to its former glory, pass a zoo inspection, and get it back open to the public. (Read More)
Themes: | courage |
Characters: | father son relationshipfamily relationshipsfather daughter relationshipbrother sister relationshipteenage girlteenage boylittle girlbabe scientist |
Period: | 2010s |
Story: | stuffed animallionzoosnaketitle spoken by characterbased on true storywomandinerbearmonkeyclaim in titleoverallslove at first sighttigeraccountant β¦tween girlbereavementinspectorpeacockdartsanimal deathschool expulsioninspectionzookeeperwidowed father (See All) |
"The Croods" are an eccentric family of cavemen, who survive the harsh terrain by living accordingly to a strict set of rules. But when their home is destroyed in the wake of an impending disaster known as "The End", they are forced to leave their home of shelter and security, and into the wildernes β¦s of the unknown to find a new home. (Read More)
Subgenre: | cgi animationcomputer animationslapstick comedy3d animationteen romance |
Themes: | wildernesshomelessnesshunting |
Mood: | night |
Locations: | cave |
Characters: | father son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipteenage girlteenage boyfemale protagonistgrandmother grandson relationshipgrandmother granddaughter relationshiphuman animal relationship |
Story: | volcanic eruptiontorchsurvivalcharacter name in titletwo word titlebare chested malechasefirevoice over narrationpunched in the facefalling from heightswimmingmountaindisguisebird β¦journeyold womanpuppetperson on fireumbrellaskeletontrapflowerfireworksgrandmothermonkeystrong female characterdestructioneggcaptiveblockbusterstrong female leadteenage protagonistdinosaurearthquakeshoesscene after end creditssuntigersmokenarrated by characterpetsidekickwhalepopcornlavashoehand over mouthmother in lawsunrisebeltprehistoric timescavemanrock climbingcornlogstory tellinglabyrinthfurboy girl relationshipcuriositycloudshornfireworkrunning for your lifejumping off a cliffprehistorywalking stickfamily in dangerbouldershellboy meets girldisobeying ordersoverprotective fathertradition versus modernityteenage rebellionhuman preycountingstarfishcave paintinganimal costumesloththe endstarting a firestrict fathertarteen rebelcave womanhandprintwreckagecomplainingflock of birdsburnedprehistoric manbig catflintcarnivorous plantanimal skeletondimwitcarnivoredeath of neighboranimal skincavegirlnyctophobiacrevice (See All) |
From the largest elephant to the smallest shrew, the city of Zootopia is a mammal metropolis where various animals live and thrive. When Judy Hopps becomes the first rabbit to join the police force, she quickly learns how tough it is to enforce the law. Determined to prove herself, Judy jumps at the β¦ opportunity to solve a mysterious case. Unfortunately, that means working with Nick Wilde, a wily fox who makes her job even harder. (Read More)
Subgenre: | cgi animationconspiracyallegorydisney |
Themes: | dancerevengeweddingbullyingprejudiceforgiveness |
Mood: | neo noirsavage |
Locations: | trainlaboratorytrain stationwedding partylaboratory accident |
Characters: | policefemale protagonistthiefbullysniperpregnantmysterious villain |
Story: | animal protagonistgiraffelionproduct placementno opening creditsf ratedone word titleexplosionchasecryinginterrogationtelephonenewspaperbridgeapology β¦poisonrabbitpigflowerbearstrong female charactericetv newshuggingwolfheroineice creamelephantvillainessvictimsheepfaked deathstrong female leadanthropomorphismguardyogareconciliationanthropomorphic animalcon artistdiscriminationwedding dresstigerinjusticehysteriafoxstereotypedvdidealismpolice interrogationfemale herotrain ridefemale villainnewscastdisillusionmentiphonepolar bearcarrotignorancevillain arrestednudistangry mobbuffaloantidoteleopardipodchemistjaguaraudio recordingparking ticketfurryfiredbadgersecret laboratoryscratchmammalsecret revealedonionanthropomorphic mousearmadillootterslothweaselcon gamerhinopolice womanmass hysteriahipponaturistracial relationsdonutsdepartment of motor vehiclesevil geniussocial exclusionblueberrymeter maidpoison ivyanthropomorphic bearanthropomorphic rabbitphone videovillainydistrictgazelleyakface scratchanthropomorphic elephantanthropomorphic foxelephant in the room (See All) |
A half-wolf, half-husky named Balto gets a chance to become a hero when an outbreak of diphtheria threatens the children of Nome, Alaska in the winter of 1925. He leads a dog team on a 600-mile trip across the Alaskan wilderness to get medical supplies. The film is based on a true story which inspir β¦ed the Iditarod dog sled race. (Read More)
Subgenre: | cult film2d animation |
Themes: | wildernesssurrealismprejudicecourage |
Locations: | hospitaltrainforestsnowboatwoodscavestormalaska |
Characters: | boyfriend girlfriend relationshipdoctorchildrengirlbullyself esteemself identity |
Period: | 1920s |
Story: | talking animalgooselierescuedogcharacter name in titleone word titlebased on true storyfalling from heightpianochildcoffindrowningtreepop music β¦first of seriesactor playing multiple rolesrace against timeknocked outcheerleaderthreatsadnessracingrockwolfmedicineracediseaseclassical musicpart animationpresumed deadsunfalllightlyingarroganceanimal name in titlesidekickoutcastnarratorcartoon dogoutsiderhot dogunconsciousnessblizzardglasssense of smellfriends who live togetherpart live actionpolar bearrescue from drowningavalanchecolddog moviebiplanetreesbroken bottleanimal that acts humanstrengthfootprinttauntingbandanasnowstormfalling off a clifffrozen lakeserumboulderpneumoniacold weatherchorushowlingdog sledboiler roomspider webtenorpart animatedaudio flashbackfurnaceunconsciousbear attackhalf breedicicleballadeernorthern lightsfalling over a clifftelegraphspiderwebhusky dogdog racedog racingsled doghowlsinger offscreenyear 1925mockingright hand manfootprintsill childknocked unconciouswhite wolfcartoon wolfdiptheriaiditarodilluminationwolf dogfootprint in the snownome alaskapawprint (See All) |
Nim Rusoe is a girl who joins her father, a scientist, when he does research on marine life on an island. It's just the two of them but she spends her time making friends with all the animals she encounters, chatting on the computer and reading the adventure books of Alex Rover. When her father goes β¦ to do some research but when a storm strikes the island he doesn't come back, she gets worried and frightened. She then e-mails Alex Rover hoping that he will come but what she doesn't know is that Alex Rover is a woman who is agoraphobic and germaphobic. But her creation comes to life and eggs her to go. Unfortunately she has never gone anywhere before and is denied her necessities like her sanitary gel by the customs officer at the airport. In the meantime, Nim tries to be strong while waiting for Alex to arrive. (Read More)
Subgenre: | fish out of watercoming of ageabsurdismslapstick comedy |
Themes: | surrealismfearescapeheromemorytravelparanoiapaniccouragenear death experienceobsessive compulsive disorder |
Mood: | rainnightmare |
Locations: | junglebeachforesthelicopterairplaneboatbathtubdesertwatertaxiairportwoodsseashiprooftop β¦oceantaxi drivercampfirestormsan francisco californiastorm at seaboat accident (See All) |
Characters: | father son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboygirldancerwritersecurity guardaustralianamerican abroadsingle fatherhuman animal relationship β¦ship captain (See All) |
Story: | volcanic eruptioncliffvolcanoevacuationtorchproduct placementsurvivalrescueflashbackf ratedcharacter name in titlebased on novelfightdancingphotograph β¦chasesurprise endingtelephone callfirevoice over narrationcryingcell phonefoodslow motion scenecomputercamerafalling from heightletterbookvomitingtearsbedhallucinationislandtelephonescientistsubjective cameraswimmingsoccerflashlightcookingmountainvideo cameramontageeatinginternetmapfishradiofishingchild in perilbathunderwater scenetreeauthordangerelectrocutionfantasy sequencecharacter's point of view camera shotactor playing multiple rolesstorytellingrace against timesuitcasemissing personreadinglightningisolationloss of mothersingle parentpirateanswering machinefarceheavy raineggmachetequesttouristsurvivorlifting someone into the aircaptivespiderflatulencesharkhome moviepresumed deadfull moonpassportreverse footagefloodtelescopechild's point of viewbraveryinvasionfanmisunderstandinganimated sequenceobesitypower outagenovelistrowboatlostaerial shote mailrainstormcaptureturtlesailorbarbecuelanterndead motherbonfirenewspaper clippingfast motion scenecamelexplorationnovelwhaleshipwrecklizardeditorsailboattween girlsailingfish tankimaginary friendseagullhurricanelavawormsouppalm treemotorboatcruise shipclimbing a treesurrogate mothermicroscopewet t shirtmetal detectortreehousegame playingrescue from drowninganimated creditsgolden gate bridgereclusemountain climbingrock climbingtreadmillagoraphobialeg injuryfemale writertropical islandscottish accenthelicopter pilotcoconutseal the animalrole modelcatapultpinatatidal wavealternate worldlifeboatqueenslandbelchingsatellite dishcratersouth pacificwet jeansspyglasswater pumpstarfishlost at seapelicansea lionsolar powertug of warclosing credits sequencetoolswindsurfingsea turtleashwading in watertropicssinking boatcalling parent by first nameport a pottymarine biologistarachnophobiaanimated scenecall for helpmonsoonhomeschoolinghiding in a treeman versus naturespear fishingnational geographic magazineroasted pigsatellite phonecan openerdesolate islandplanktonsecurity checkpointalonenessboatmanbuccaneerhula danceroverboardoceanographerair hostessamerican expatriatesextantflossing one's teethtropical stormfear of spidershand sanitizersatellite telephonewoman girl relationship (See All) |
A modern day retelling of the classic story The Frog Prince. The Princess and the Frog finds the lives of arrogant, carefree Prince Naveen and hardworking waitress Tiana crossing paths. Prince Naveen is transformed into a frog by a conniving voodoo magician and Tiana, following suit, upon kissing th β¦e amphibian royalty. With the help of a trumpet-playing alligator, a Cajun firefly, and an old blind lady who lives in a boat in a tree, Naveen and Tiana must race to break the spell and fulfill their dreams. (Read More)
Subgenre: | based on fairy tale |
Themes: | dancedeathweddingpoverty |
Locations: | restaurant |
Characters: | father daughter relationshipmother daughter relationshipafrican americanwaitressvillainyounger version of characterwitch doctor |
Period: | 1920s |
Story: | talking animalalligatorno opening creditssnakedogbased on novelbloodkissdreamcatanimal in titlesubjective cameradeath of friendtongueold woman β¦princessfive word titleloss of fathersacrificeprincejazzrace relationscookhunterworking classfrogparadeinterracial friendshipstarnew orleans louisianaswampfirst kissbased on storycapturevoodoospelllouisianaevil spiritjazz musiccostume partyfriendship between girlsblind womantrumpettitle in titleamuletreciperich manworkaholicnethuman becoming an animaltalismanbayouspiritsfireflyspoiled childcajunjazz combosavingsamphibianstorybookpet snakedisney princessukelelehard workerwishing on a startalking froggumbotalking insectfrog princemucusanthropomorphic frogtabasco sauce (See All) |
At an annual pace, a huge colony of ants is forced to collect every piece of food that grows on their island for a group of menacing grasshoppers. But that all changes when a misfit inventor ant named Flik accidentally knocks over the offering pile thus forcing the grasshoppers' devious leader Hoppe β¦r to force the ants to redo their gathering of food. Despite the fact that his friends don't believe him and desperate to help save the colony, Flik volunteers to go out into the world and search for a group of 'warrior' bugs. Instead, what he got was a talented group of circus performers. But when the grasshoppers return and take control of the island, Flik must prove himself a true hero before it's too late. (Read More)
Subgenre: | cgi animationcomputer animationmartial arts |
Themes: | deceptionfriendshiprevengefearangerredemptionexploitationfalling in love |
Mood: | rain |
Locations: | restaurantdesertwatercitytexas |
Characters: | frienddoctorvillain |
Story: | animal protagonistbeetlecircusfightpartychasethree word titlefirecryingbattlefalling from heightapostrophe in titlesubjective cameraprincesstree β¦dangerkaratemassagegiftthreatqueenrockflyinginjuryspiderblockbustereaten alivethugcynicismmisunderstandingconfrontationinventorexilebutterflycrowdkarate kickbanditbloopers during creditstributemetaphorinventionmisfitlanguage barrierelectric shockantmushroomcactusfableteamworkmatchmaggotgrassclumsinesshungarianstreamharvestcaterpillarjugglinghorninsect in titlemosquitofireworkwalking stickleafmothimitationlimbograpepleadingblown coversombreroindividualismladybugclubhousegraingrasshoppersparrowspiderwebfleapraying mantisdandelionmeerkatoverhearingbug zapperhouseflyanthillanthropomorphic insectflypaperassertiveness (See All) |
Carl Denham needs to finish his movie and has the perfect location; Skull Island. But he still needs to find a leading lady. This 'soon-to-be-unfortunate' soul is Ann Darrow. No one knows what they will encounter on this island and why it is so mysterious, but once they reach it, they will soon find β¦ out. Living on this hidden island is a giant gorilla and this beast now has Ann in it's grasps. Carl and Ann's new love, Jack Driscoll must travel through the jungle looking for Kong and Ann, whilst avoiding all sorts of creatures and beasts. (Read More)
Subgenre: | cult filmstop motion animationcreature featuremonster movie |
Themes: | dancedeathlovekidnappingmoneyfearescapemonsterfilmmakingpovertyabductiontheatreexploitationgreedpanic β¦dyingunemployment (See All) |
Locations: | junglenew york citybeachtrainhotelmotorcycleairplaneboatvillagelakeshiprooftopcavecampfireairplane accident β¦sea monstertrain driver (See All) |
Characters: | policepolicemandanceractorphotographerbabyhostageactressfilm directorchinesefiance fiancee relationshipship captaindeath of herowitch doctor |
Period: | 1930s |
Story: | steamshipvulturecliffcrushed to deathtorchsnakemanhattan new york cityrescuecharacter name in titlebased on novelbloodviolencetwo word titlegunkiss β¦fightdancingexplosionknifechasetelephone callshot to deathmachine guncar accidentblondecameraundressingfalling from heightriflebombrunningbedhandcuffsislandrevolverreportersubjective cameraswimmingstrangulationmountainstabbingwomanbridgedinermapbirdradioritualunderwater scenekingsearchjourneypilotbinocularsscreamingcharacter's point of view camera shotmissionscreamflowerspursuitneck breakingsadnesstied upsacrificemonkeydisasterspearwoundfaintingfamelifting someone into the aircookblockbustergiantbrideladderfemale tied uppart animationanimal attackappleeaten aliverampagedamsel in distressshopliftinghungerfalling to deathtitle appears in writingtheatre audienceswampfogtribesailortuxedorescue missionpipe smokinganimal name in titledrumsceremonyexpeditiongatecanoemovie producergiant monsterhuman sacrificegorillaplane crashwallraftfalling into waterbeastfilm cameratheatre productionhand over mouthgreat depressionwhistlingmeat cleaversense of smellclimbing a treetitle in titlebroadway manhattan new york citymarriage engagementtyrannosaurus rexprehistoric timesorchestral music scoreapeair raiddeath of title charactermotorcycle copradio newsaltarchainsanimal killingbiplanefamous linegiant animalstarvingflash camerafleeinglogwoman in dangerchrysler building manhattan new york cityfootprintlifting female in airgiant spiderretreatshacklesscreaming in fearel trainkaijulong island new yorkair strikevineempire state building manhattan new york cityalliterative titlesoutheast asiagiant creaturelifting an adult into the airremadetriceratopstheatrical agentnew york city skylineends with deathscreen testtrain wreckanimal deathsource musicdestruction of propertylarge format cameranative tribepterodactylfalling treesitting in a treegongking kongsimian fictionravinechasmman eating monsterexotic localetrain derailmentwoman as objectfilm extralost civilizationbegins with a quotestegosaurustheatre marqueebogbroken jawcontemporary settinglost worldmonster as victimsymphonic music scorebrontosaurusdisaster in new yorkfeathersanimal fightdirector actor relationshipgiant apeclimbing up a buildingwater canteengiant crabescaped animalstomped to deathleitmotifship's crewbleeding mouthpeeling potatoesmortal woundmouth forced openreference to beauty and the beastbitten to deathbomb throwinggorilla costumeoutrigger canoegrass skirtfruit vendorgas bombpartially lost film (See All) |
A growing nation of genetically evolved apes led by Caesar is threatened by a band of human survivors of the devastating virus unleashed a decade earlier. They reach a fragile peace, but it proves short-lived, as both sides are brought to the brink of a war that will determine who will emerge as Ear β¦th's dominant species. (Read More)
Subgenre: | suspensepost apocalypsedystopiaepic |
Themes: | deceptionmurderdeathrevengesuicidebetrayalprisonpregnancyparanoiaforgivenesshunting |
Locations: | sewerbeachforestelevatorvillagewoodsgas stationcampfiresan francisco californiatunnelprison bus |
Characters: | father son relationshipfamily relationshipshusband wife relationshipmother son relationshipbabysniperpregnantengineerpregnant wifestepmother stepson relationship |
Period: | 2020s |
Story: | talking animalcrushed to deathtorchno opening creditssurvivalrescuebloodviolencesequelgunfightexplosionknifepistolfire β¦cryingshootoutbeatingshot to deathfistfightmachine gunhorseshot in the chestshotgunslow motion scenepunched in the facebattlegunfightbrawlfalling from heightshowdownrifleheld at gunpointsecond partrevolvercombatshot in the backcaliforniavideo cameradeath of friendimpalementstabbed to deathsubwayexploding carradiopart of seriesdrawingfictional wargunshotcharacter repeating someone else's dialoguebeaten to deathstabbed in the backtenttankopening action sceneshot in the shoulderlong takescarchildbirthexploding bodyhorse ridingcharacter says i love youhandgunbearsubtitled scenetrustmonkeybattlefieldpowerloyaltyspearassassination attemptcageblockbusterbirthrocket launchercompassionanimal attacktarget practiceexplosivefight to the deathdual wield3 dimensionalbroken glassframe upassault rifledeerdisfigurementgunfiresign languageclose up of eyesabandoned buildinggiving birthelectricityreturning character killed offtowerabandoned housegorilladamleaderchimpanzeeopen endedapefacial scartreehousedistrustgolden gate bridgecoup d'etatanimal killingcolonyarmoryexpectant motherextreme close upreturning character with different actorcity hallhidden gunmercyleadershipexpectant fatherc4 explosivesbuilding collapseorangutanthrown from heightblue eyessketchbooksimian fictionamateur radiohydroelectric powerplanet of the apesreactionarypregnant animalsequel to a reboothydroelectric damhydroelectric power station (See All) |
Retired madame Adelaide Bonfamille enjoys the good life in her Paris villa with even classier cat Duchess and three kittens: pianist Berlioz, painter Toulouse and sanctimonious Marie. When loyal butler Edgar overhears her will leaves everything to the cats until their death, he drugs and kidnaps the β¦m. However retired army dogs make his sidecar capsize on the country. Crafty stray cat Thomas O'Malley takes them under his wing back to Paris. Edgar tries to cover his tracks and catch them at return, but more animals turn on him, from the cart horse Frou-Frou to the tame mouse Roquefort and O'Malley's jazz friends. (Read More)
Subgenre: | 2d animationdisney |
Themes: | dancesurrealismkidnappingjealousygreed |
Mood: | night |
Locations: | trainmotorcycleparis francefrancetruck |
Characters: | singerdancerartistsingle mother |
Period: | 1910s |
Story: | animal protagonisttalking animalgooserescuetitle spoken by characterdogfightdancingsingingsonghorsecatpianorivergood versus evil β¦newspaperwomandinnerbirdumbrellapianistdisappearancerecord playerjazzeavesdroppinghatmousefrogmilkanthropomorphismanthropomorphic animalfather figurebutlerthunderstormfallhorse and carriagedrumseiffel tower parispaintaccordionfalling into watergramophonerailroadfriends who live togethertrumpetwindmillacoustic guitarpitchforksymboltrunktalking dogmotorcycle with a sidecarcarriagesleeping pillchopstickshayharptalking catskylinecastle thunderbassistballadeerbowler hatmilkmantalking birdfishing polelead singertalking horsecroonertrumpetersinging animalanthropomorphic catdouble bassharpistexpression taken literallytalking mouseaccordionistbass voicebaritone voicespiraling eyesalto voicelead guitarist (See All) |
Cody, a boy from Mugwomp Flats responds to a distress call about a trapped giant Golden Eagle called Marahute. Freeing her, he gains a close friendship with the bird. However, Cody is soon abducted by the murderous poacher, Percival McLeach, who is after that bird which is of a highly endangered spe β¦cies and therefore an extremely profitable quarry. In a panic, a mouse Cody freed from one of McLeach's traps sends a desperate call for help to the Rescue Aid Society in New York City who assigns their top agents, Miss Bianca and Bernard, to the task. With transportation provided by the goofy albatross, Wilbur, the agents arrive in Australia and link up with the RAS' local field operative, Jake the Kangaroo Rat. Together, the trio must race against time to find Cody, stop McLeach, and save Marahute. (Read More)
Subgenre: | cult film2d animationdisney |
Themes: | kidnappinghopegreedcourage |
Locations: | hospitalrestaurantairplaneaustraliatruckaustralian outbackaustralian bush |
Characters: | boyfemale protagonistsingle motherpoaching |
Period: | 1990s |
Story: | animal protagonisttalking animalkoalakangaroocliffsnakerescuesequeldancingchaseshotgunfalling from heightsecond partmapradio β¦marriage proposaldangerkeytrapwaterfallgaragechainsawrockropeeggcagelistening to musicmousepresumed deadanthropomorphismstupiditycynicismbackpackanthropomorphic animalenvironmentalescape attemptcaneboxlightpajamasengagement ringunited nationslizardcrocodileintelligencefalling into watershoemilitary basemale protagonisteaglefriends who live togetherromantic rivalryfeatherpitlognew york city new yorkpoacherbad luckclothes linenestpocket knifetireabandoned minefireflyimitationanimal loverwild boardiamond ringcheckerspicking a lockdisney animated sequelhalf dressed cartoon animalballadeeranthropomorphic mousefalling over a cliffcomfortboardalbatrossshoelacetree stumpsalamanderhouseflymonitor lizardfeeling coldhorse whisperingmarshall islandsplatypusrejected loversevered spinevisewombatechidnaeagle's featherpower of redemption (See All) |
Rango is a pet chameleon always on the lookout for action and adventure, except the fake kind, where he directs it and acts in it. After a car accident, he winds up in an old western town called Dirt. What this town needs the most is water, but they also need a hero and a sheriff. The thirsty Rango β¦instantly takes on the role of both and selfishly agrees to take on the case of their missing water. (Read More)
Subgenre: | cgi animationspaghetti western |
Themes: | revengerobbery |
Mood: | nightmareparodybreaking the fourth wall |
Locations: | desertwaterwheelchair |
Characters: | sheriffmayor |
Story: | chameleontorchsnakeliecharacter name in titleone word titlechasepistolshotgungunfightjailbound and gaggedfishduelliar β¦cowboybankbank robberylas vegas nevadagolfcowboy hatanthropomorphismfloodconstruction siteanthropomorphic animalcard playingoutlawturtleranchowlgatling gunpetrobberbottlelizardundertakergunslingersalooncactusdisillusionmentnevadarattlesnakemolehawkman with no namedroughtidentity crisiswagongolf cartwestern townrancherpossebank managerwater towerhawaiian shirttortoisewater bottlelynch mobsombreroburpingarmadillomake believewater shortagecovered wagonmariachibreathing firechewing tobaccodigging a holereference to kim novakmystical questterrariumprairie dog (See All) |
In Rio de Janeiro, baby macaw, Blu, is captured by dealers and smuggled to the USA. While driving through Moose Lake, Minnesota, the truck that is transporting Blu accidentally drops Blu's box on the road. A girl, Linda, finds the bird and raises him with love. Fifteen years later, Blu is a domestic β¦ated and intelligent bird that does not fly and lives a comfortable life with bookshop owner Linda. Out of the blue, clumsy Brazilian ornithologist, Tulio, visits Linda and explains that Blu is the last male of his species, and he has a female called Jewel in Rio de Janeiro. He invites Linda to bring Blu to Rio so that he and Jewel can save their species. Linda travels with Blu and Tulio to Rio de Janeiro and they leave Blu and Jewel in a large cage in the institute where Tulio works. While they are having dinner, smugglers break into the institute and steal Blu and Jewel to sell them. Linda and Tulio look everywhere for Blu, who is chained to Jewel and hidden in a slum. Meanwhile, Jewel and Blu escape from their captors and befriend a group of birds that help them to get rid of the chains. It is Carnival and the smugglers and mean cockatoo, Nigel, do not intend to give up Blu and Jewel, and chase the birds through the crowded streets. (Read More)
Subgenre: | cgi animation |
Themes: | kidnappingescape |
Locations: | beachairportbrazil |
Characters: | poaching |
Story: | canada gooseanimal protagonisttalking animalgooseno opening creditsdogone word titlechasebattlekissingplace name in titletelevisionbirdcity name in titlefirst part β¦nerdparadetvbookstoreparachutechainparrotpetplane crashrio de janeiro brazilsouth americachainedminnesotabraziliancity in titlesmartphonebulldogpoacherbird cageendangered speciesbeach volleyballfavelasambacanarytalking birdhang glidingcockatoowoodpeckerparade floattoucancarnavalsinging animalspecies extinctionmacawornithologyornithologistanimal sanctuaryanimal smugglingbottle capfinchnature preservebird nestchrist the redeemer rio de janeiroelizabethan collarsinging birdtropical forest (See All) |
It is the story of one Mr. Fox and his wild-ways of hen heckling, turkey taking and cider sipping, nocturnal, instinctive adventures. He has to put his wild days behind him and do what fathers do best: be responsible. He is too rebellious. He is too wild. He is going to try "just one more raid" on t β¦he three nastiest, meanest farmers that are Boggis, Bunce and Bean. It is a tale of crossing the line of family responsibilities and midnight adventure and the friendships and awakenings of this country life that is inhabited by Fantastic Mr. Fox and his friends. (Read More)
Subgenre: | martial artsstop motionstop motion animationpuppet animationcaper comedy |
Themes: | kidnappingpregnancytheftredemption |
Locations: | sewertrainschoolhelicopterairplanerural settingfarm |
Characters: | father son relationshiphusband wife relationshipmother son relationshipsingerstudentmusicianwriterlawyerthiefartistsecurity guardcousin cousin relationshipuncle nephew relationshipaunt nephew relationship |
Story: | animal protagonisttalking animalrescuetitle spoken by charactercharacter name in titlebased on noveldancingexplosionsingingknifefirebased on bookwatching tvbattlemask β¦paintingbombkung fureporterbound and gaggedambushprisonermappaintergunshottreebinocularsmicrophonefarmerpianisttrapratcoachundergroundsupermarketwolfathletebreaking and enteringtape recordercaptiveanthropomorphismtrappedanthropomorphic animalheadphonesmeditationtitle at the endvegetariantrophyfiremanfoxalarmtrailer homewhistletape recordingcredit cardnewspaper articlebased on children's bookx rayed skeletonbanjoturkey the birdtalebadgerelectric fencefoaming at the mouthmanholebeagle dogchicken coopacornfarm lifevixenwhimsicalciderchemistry classtrain setrabid dogstorybook in opening shotroald dahlsteam shovelbased on cult bookstealing a chicken (See All) |