Please wait - finding best movies...
Lawrence Talbot's childhood ended the night his mother died. His father sent him from the sleepy Victorian hamlet of Blackmoor to an insane asylum, then he goes to America. When his brother's fiancee, Gwen Conliffe, tracks him down to help find her missing love, Talbot returns to his father's estate … to learn that his brother's mauled body has been found. Reunited with his estranged father, Lawrence sets out to find his brother's killer... and discovers a horrifying destiny for himself. Someone or something with brute strength and insatiable blood lust has been killing the villagers, and a suspicious Scotland Yard inspector named Aberline comes to investigate. (Read More)
| Subgenre: | gothic horrorcult film |
| Themes: | murder of a police officerevilinsanitydeath of motherfuneraltorturesuicidedeathmurder |
| Mood: | horror movie remakenightmareraingore |
| Locations: | running in the forestrooftoplakewheelchairlondon england |
| Characters: | evil fathervillainpriestactordoctorfather son relationship |
| Period: | 1890s |
| Story: | antique shopstraight razorgypsy campnewspaper headlinestage actormonster in mirrorbreaking a mirrorfuneral processionlooking at oneself in a mirrorhouse on fireperson on fireattempted suicidereference to shakespeare's richard iiiescape from a mental institutionskipping stones on water …reference to the prodigal sonscotland yard inspectorchased in the woodsfather versus sonupward camera shotskipping stonetower bridgerunning across a roofstone bridgereference to danielhorse drawn wagonfather murders sonromantic subplotyear 1891dark forestlondon bridgetopiaryice bathfalling off a horsetower bridge londonloading a gunreflection in eyestabbed through the chinlycanthropefinger bitten offhowlreference to shakespeare's macbethsilver bulletdrink thrown into someone's facereference to jack the rippersplit lipson murders fatherromeo and julietlycanthropygrand pianosanitariumextreme closeupelectroshock therapybody torn apartomenwalking stickpassenger trainhowlinghuman becoming an animalhorse drawn carriagebegins with textvicarthroat rippingarm ripped offknocked out with a gun buttstagecoachmedallionhead ripped offhusband murders wifepreachingbreaking through a doorcandlelightsikhglowing eyescryptreference to shakespeare's hamletimmolationantiquepsychotherapybitten in the neckstrait jacketcarnagehearserazordouble barreled shotguntavernpiano playinghindusubtitlesmental patientvictorian eratorso cut in halfsevered legpassionate kissasylumlanterncanejumping through a windowthrown through a windowdelusiongash in the facebutchercrushed to deathtelescopemental institutiongypsyfull moonrampageanimal attackstrong female leadart gallerytorchservantloss of loved oneburned alivefireplacesyringestrong female characterwerewolfsubtitled scenereference to william shakespearesevered armbeardeath of brotherwaterfallhorse ridingtrapshot in the shoulderinjectiondisappearancescarmissing persontentstatuecharacter repeating someone else's dialogueelectrocutioncursetransformationchild in perilcoffindream sequenceno opening creditssevered headtied to a chairthroat slittingimpalementmansionnewspaperfoot chasedecapitationhallucinationanimal in titleheld at gunpointrifleletterremakeshot in the chestmirrorblood splattercorpsefirepistolsurprise endingtwo word titledogflashbackblood (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar …es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
| Subgenre: | cult filmblack comedysuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie |
| Themes: | murder of a police officersuicidedeathmurderfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalitysupernatural powerparanoia …panichomelessnessmurder of family (See All) |
| Mood: | nightmaregoresatiremurder of a boy |
| Locations: | london englandhospitaltrainforestcemeterybustaxivillagewoodsrural settingapartmentpolice carenglandtrucktaxi driver …laboratorysex in shower (See All) |
| Characters: | doctorpolicezombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant …jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
| Period: | 1980s |
| Story: | newspaper headlinemonster in mirrorlooking at oneself in a mirrorattempted suicidetower bridge londonlycanthropehowllycanthropyhuman becoming an animalhead ripped offglowing eyesbitten in the necktavernpassionate kissgash in the face …full moonrampageanimal attackwerewolfscarstatuecursetransformationdream sequencesevered headthroat slittingdecapitationanimal in titlerifleshot in the chestblood splattercorpsesurprise endingblooddogsexfemale nuditynuditymale nudityviolencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nuditycigarette smokingknifechaseshowertopless female nuditydreamshot to deathmachine guncar accidenturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttplace name in titlebedcar crashvoyeurtelephonef wordsubjective cameracleavagegay slurambulancedeath of friendmontagesuicide attemptsubwayjokescantily clad femalehit by a carvannews reportfive word titleracial slurpublic nuditylegenddangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takehairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubundeadmonkeychessuziundergroundsupermarketwolfno pantiesballoongothicheavy raincomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikerhitchhikingrealityindianeaten alivebarefootmercilessnesszooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a cardead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girlkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windownurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of lovergiraffeinnocent person killed555 phone numberbitebloody body of a childloss of memorynurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicideseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatwo friendsquestioned by policereanimated corpseporno theaterreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
A war has been raging between the Vampires and Lycan for centuries, Selene (Beckinsale) is a death dealer, assigned to hunt down and eradicate the last of the Lycan. When she comes across Michael Corvin (Speedman) who holds the key to end the war she must decide where her allegiances will lie.
| Subgenre: | cult film |
| Themes: | deathmurderlovekidnappingbetrayaldeceptionmemorysupernatural powerrivalryphotography |
| Mood: | raingorenight |
| Locations: | hospitaltrain |
| Characters: | female protagonistvampirewarriortalking to oneself in a mirror |
| Story: | looking at oneself in a mirrorsilver bulletlycanthropybitten in the necktorso cut in halfjumping through a windowgash in the facefull moonstrong female leadburned alivesyringestrong female characterwerewolfshot in the shouldertransformation …impalementmansionfoot chasedecapitationheld at gunpointrifleshot in the chestblood splattercorpsepistolsurprise endingbloodflashbackbare chested malecigarette smokingexplosionpartyknifevoice over narrationshot to deathmachine gunface slapshotgunslow motion scenepunched in the facecamerabattleswordfalling from heightcar crashshot in the backsubjective cameraambushsubwayhit by a carunderwater sceneshot in the foreheadbeaten to deathfirst of seriesevil manexploding bodyneck breakingcharacter says i love youfirst partshot in the armwhippingdismembermenttraitorundergroundgrenadehypodermic needlegothicladderforbidden loveaction heroinebroken legapartment buildingslavefemale warriortarget practicewhipimmortalityfeudstabbed in the leglatexhealingbroken armmutationlaptop computertombneedleshot in the necksubway stationstabbed in the armfemale vampireman punching a womanmedical studentstabbed in the shoulderstar crossed loversopen endedbladein medias resshot through a doorfemale gunfighterkicking in a doorregenerationcamera focus on female buttvampire slayerfalling through the floorsubway trainwoman punching a manthrowing stararsenalbudapest hungarydark heroineshurikenlifted by the throatshot through a wallfangsawakeningdowntownhybridvampire bitecovenhead cut in halfchased by a dogmurder of a pregnant womanvampire human lovethrown through a wallclimbing over a fencebreaking through a wallcamera shot from inside human bodyultraviolet lightdeath of pregnant womaneyes different colorsexy female vampirelatex catsuiturban gothicskin torn offtrain depotwerewolf bitedeath of expectant mothermedical internnocturnalvampire versus werewolffather murders daughterhuman allyripped necksubway chaseancient vampirepass out from blood lossvampire driving car (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d …ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
| Subgenre: | martial artspost apocalypsedystopiacyberpunkchrist allegory |
| Themes: | death of motherfuneraltorturemurderdeathrevengekidnappingreligionbetrayalmonsterherodeceptiondeath of fatherredemptionhome invasion …justiceself sacrificeghost town (See All) |
| Mood: | nightmaregorenightdarknesspoetic justice |
| Locations: | bartrainchurchmotorcyclecemeterysmall towndesertelevatorcitycavetownbar brawlmotorcycle chasetrain explosionwalled city |
| Characters: | villainpriesthusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshiphostagetough guychristianvampirewarrioraction herobible …sheriffuncle niece relationshipex soldierhuman versus monsterfacial tattoo (See All) |
| Period: | future |
| Story: | person on firepassenger trainbitten in the necktorso cut in halfsevered leglanternjumping through a windowgash in the facecrushed to deathfull moonanimal attackstrong female charactersevered armdeath of brotherscar …statuecharacter repeating someone else's dialogueelectrocutiontransformationcoffinno opening creditssevered headthroat slittingimpalementdecapitationheld at gunpointshot in the chestblood splattercorpsefiresurprise endingflashbackbloodcharacter name in titlebased on novelviolenceone word titlebare chested malegunfightcigarette smokingphotographtitle spoken by characterexplosionknifechasevoice over narrationshootoutbeatingfistfightmachine gunshotgunrescuepunched in the facebattlebrawlfalling from heightbased on comicshowdownhand to hand combatinterrogationcombatkung fugood versus evilsurvivalflashlightbased on comic bookambushmassacremountainstabbed to deathstabbed in the chestweaponanti heroone man armyfictional warcreatureon the runconfessionone against manybeaten to deathstabbed in the backprologuespiritualityattackbased on mangamissionrace against timedollkicked in the facetough girllightningfarmercrossexploding bodyneck breakingthreatened with a knifecabinmercenarychickenvigilantestylized violencebulletkilling an animalrevelationhead buttheavy rainmachetemutantcowboy hatjail cellcrucifixkicked in the stomachnosebleedasian womanjumping from heightcovered in bloodskullhonoraction heroinesocial commentarybar fighteaten alivepresumed deadfemale warriorguarddamsel in distresstarget practiceveteransandcrossbowteamanimated sequence3 dimensionalstabbed in the leg3dpunched in the chestdark herodynamitedisembowelmentblood on shirtfascismboyfriendknife throwingdark pastmutationgadgetcellardaggertracking devicefemale soldierprayingcrucifixionruinsvigilantismparkourworld dominationconfessionalshot with an arrowmegalomaniacflask18 year oldflarequitting a jobgramophonepocket watchvigilante justicebased on graphic novelmeat cleaveracrobatstabbed in the shoulderfight the systembladerepeated linesuperhuman strengthtragic pastsubterraneancut into piecestrapdoornight timemass gravevampire hunterone woman armypsychotronic filmanti heroinegogglesman with no nameacrobaticssome scenes animatedvampire slayerstarts with narrationhit by a trainwire fubritish actor playing american charactertrain conductorcoming out of retirementmotorcycle stuntnieceoil lampexploding motorcyclecouncilinsubordinationoutpostalternate worldtrain wreckclergytrackinggeiger countertotalitarianknife in chestsuperhuman speedtrain derailmentexploding trainhit by a motorcyclefight on train roofhuntressmonolithsolar panelblack hathiveriding motorcyclehuman versus vampireopening credits18 year old girldisobeyfall through floorvampire queengiant statuelong haired womanwoman with long hairfemale vampire hunter (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
| Subgenre: | cult filmmartial artscoming of ageblack comedysuspensesupernaturalheist |
| Themes: | evilsuicidemurderdeathfriendshiprevengesurrealismkidnappingbetrayalfearescapedeceptionseductionrobberydeath of father …supernatural powerparanoiasurveillancehome invasionpanic (See All) |
| Mood: | nightmaregore |
| Locations: | rooftoplondon englandschoolchurchcemeteryairplanetaxiairportpolice stationshipcatholic church |
| Characters: | priestdoctorfather daughter relationshiphostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest |
| Period: | 2000s |
| Story: | person on firesilver bulletglowing eyesbitten in the neckjumping through a windowrampageburned alivewerewolfsevered arminjectioncursetransformationcoffinsevered headthroat slitting …impalementfoot chasedecapitationhallucinationheld at gunpointshot in the chestmirrorblood splattercorpsepistolsurprise endingbloodflashbacksexcharacter name in titlenumber in titleviolencebare chested malegunfightphotographexplosionpartyknifelesbian kisschasedreamshot to deathfistfightshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingshowdownhand to hand combatbedinterrogationhandcuffsreference to jesus christshot in the backf wordgood versus evilsurvivalbedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapdouble crosspolice officer killedsearchfemme fatalenews reportracial slurflash forwardattempted murderlibrarypilotstabbed in the backkeyproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationcrossneck breakingpremarital sexthreatened with a knifedirectorial debutundeadstylized violenceropetraitordestinywolfrevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowsunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790sbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi …kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)
| Subgenre: | gothic horrorindependent filmb moviesword and sorcerysword and fantasychrist allegory |
| Themes: | funeraltorturedeathmurderrevengekidnappingreligionbetrayaldrunkennessmonsterdeceptionmagicredemptionfaithabduction …cannibalismdevilmurder of familycooking over a campfire (See All) |
| Locations: | churchforestsnowcemeteryvillagewoodsenglandshipcastlecavecampfire |
| Characters: | priestfather son relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierhostagewarriorbiblewitchself mutilation …ex soldiership captain (See All) |
| Period: | winter16th century1600s |
| Story: | person on firehorse drawn carriageimmolationtavernsevered legjumping through a windowgash in the facetorchsevered armdeath of brotherhorse ridingtrapscartentstatue …cursetransformationchild in perilno opening creditssevered headthroat slittingimpalementdecapitationshot in the chestmirrorblood splattercorpsefiresurprise endingtwo word titlebloodflashbackcharacter name in titleviolencebare chested maleguntitle spoken by characterexplosionknifechasehorseshot in the headrescueslow motion scenebattleswordfalling from heightmaskbased on comicshowdowninterrogationdemonbritishprayerrivershot in the backgood versus evilsword fightambushaxemassacredisguisearmystabbed to deathstabbed in the chestanti herodouble crosskingjourneyshot in the foreheadstabbed in the backprologueknocked outdeath of childdeath of sonneck breakingthreatened with a knifemercenaryundeadprincerevelationheavy rainhatslaverycaptivecrucifixtreasurewitchcraftaccidental deathjumping from heightmind controlmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatstabbed in the legsibling rivalrydark herodead childdungeonmurder of a childsoulhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionblack magicburned to deathwilhelm screamdaggerteleportationcrowmudblood on camera lensillusioncrucifixiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortresssorcerershot in the eyemercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlockslocketpitdeal with the devilfratricidescottish accentlong haired malehorse chaseknife in the chestflintlock pistoljumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All) |
This version of Dracula is closely based on Bram Stoker's classic novel of the same name. A young lawyer (Jonathan Harker) is assigned to a gloomy village in the mists of eastern Europe. He is captured and imprisoned by the undead vampire Dracula, who travels to London, inspired by a photograph of H …arker's betrothed, Mina Murray. In Britain, Dracula begins a reign of seduction and terror, draining the life from Mina's closest friend, Lucy Westenra. Lucy's friends gather together to try to drive Dracula away. (Read More)
| Subgenre: | gothic horrorcult filmdark comedycult classic |
| Themes: | evilinsanitysuicidedeathlovefriendshiprevengemarriagerapeadulteryescapeweddingmonsterseductionsupernatural power …madnesscampingreligious conflict (See All) |
| Mood: | horror movie remakeraingoreavant garde |
| Locations: | london englandtrainchurchcemeteryshipcastlestorm |
| Characters: | priestdoctorvampirewarriorbest friendreference to godpsychiatristfiance fiancee relationshipamerican in england |
| Period: | 1890s19th century15th century |
| Story: | straight razornewspaper headlinereference to shakespeare's hamletbitten in the neckvictorian eraasylumgypsyloss of loved onewerewolfcursecoffinno opening creditssevered headthroat slittingimpalement …decapitationrifleletterremakeshot in the chestmirrorblood splatterpistolbloodfemale nuditycharacter name in titlebased on novelnudityone word titlebare breastssex scenetitle spoken by characterpartyknifelesbian kisschasepantiesvoice over narrationshotgunbattleswordfalling from heightbookbedreference to jesus christorgygood versus evilbisexualcandleprisonerstabbed in the chestnunsearchjourneyvanvirginstabbed in the backportraitprologueactor playing multiple rolesevil manringdiarysensualityratmurderergardentypewriterundeadbralessprincetopless womandestinyshavingwolflgbtdesirenipples visible through clothinggothiccaught having sexcaptivecrucifixhunterspiderblockbusterknightreverse footagediamondreincarnationwindzooinsectmentorsexy womanshadowwedding dressarmordeath of loved oneexorcismaristocrattelepathybattombactress playing multiple rolesvillain played by lead actorsexual awakeningbeheadingwedding ceremonydraculamazedual rolefemale vampireconventbroken mirrorfalling into waterredheaded womanbeastinsane asylumbestialitystar crossed loverswakefatal attractionshape shifterdeath of title characterdead wifetuberculosisvampire hunterpsychotronic filmottoman empiresleepwalkingblasphemymysterious strangerproposalreference to the devilsuitorbitevampire slayerlabyrinthtragic villainsexual innuendomisttransylvaniadrinking bloodfalling asleepblood transfusiondead babymaster servant relationshipcorrespondenceabsinthevampire biteturkvomiting bloodvampire human loveabbeyrejuvenationvampire batvampire sexorigin storyvictrolasabrebouncing breastsbowie knifepadded cellcult favoritefalling into a riverbiting someonevan helsingvictorian englandvampire human relationshipvictim invited to dinnermonster as victimlicking nipplelicking someonenipple lickingsexy female vampiresupernatural huntermaster vampirelicking someone's nipplesreal estate deallicking nippleswhite wolfcostume horrorhuman versus vampireopening creditssprayed with a hosebisexual vampireeating an insectglass coffinhedge mazereference to marie curiesucking bloodyouth restoredauthor name in titlereference to the arabian nightsrunning down stairssigning a contractyear 1897biting someone's neckbreakup lettermirror above bedsee throughsleeping in a coffindefying gravitysex horrorwatching a silent movieengaged to be marriedsupernatural ability (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | cult filmindependent filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
| Themes: | evilinsanitydeath of mothertorturesuicidemurderdeathrevengekidnappingghostfeardrunkennesspsychopathdeath of fatherbrutality …supernatural powerabductiontraumafear of water (See All) |
| Mood: | nightmareraingorehigh schoolslasherbreaking the fourth wallblood and gore |
| Locations: | lakeforestcemeterysmall townpolice stationschool nurse |
| Characters: | villainfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillersheriffterrorslasher killermysterious villain …serial murderer (See All) |
| Period: | 2000s |
| Story: | person on firearm ripped offbreaking through a doortorso cut in halfbutchercrushed to deathrampageburned alivesevered armdeath of brothercharacter repeating someone else's dialogueelectrocutionchild in perildream sequencesevered head …impalementfoot chasedecapitationblood splattercorpsefirepistolsurprise endingflashbackbloodcharacter name in titleviolencesequelphotographexplosionpartyshowervoice over narrationdreamslow motion scenebrawlfalling from heightmaskcar crashdemonstabbingunderwater scenevandrowningskinny dippinglibraryvirginprologuecharacter's point of view camera shotcover upevil mandeath of childhigh school studentstalkingneck breakingpremarital sexmurderercabindismembermentkillingundeadsplatterchild murdermaniacheroinemass murdermachetelifting someone into the aircomaragemutilationpsychosevered handvictimgoatmasked mansevered fingernew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killerblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmmurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovechild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji …mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)
| Subgenre: | cult filmindependent filmblack comedysuspenseabsurdismcreature featureteen movieteen horrormonster movielgbt horror |
| Themes: | murderdeathrevengesurrealismjealousyfeardrunkennessescapemonsterseductionsupernatural powerparanoiawrestlingrivalryhome invasion |
| Mood: | nightmaresatirehigh school |
| Locations: | barlos angeles californianightclubelevatorpolice carofficemuseumfire truck |
| Characters: | homosexualpoliceteenagerboyfriend girlfriend relationshiptattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature |
| Period: | 2000s |
| Story: | looking at oneself in a mirrorlycanthropelycanthropyhowlinghuman becoming an animalglowing eyescanethrown through a windowgash in the facefull moonrampageanimal attackwerewolfshot in the shoulderscar …electrocutioncursetransformationsevered headfoot chasedecapitationshot in the chestcorpsepistolsurprise endingdogbloodnuditymale nudityviolenceone word titlemale rear nuditybare chested malekissfemale rear nudityfightphotographtitle spoken by characterpartyknifechasecell phonebeatingshot to deathfistfightcar accidentshot in the headshotgunrescueslow motion scenepunched in the faceswordbrawlbare buttfalling from heightshowdowncar crashdead bodybathroomgay slurorphanambushcaliforniamassacreambulancestabbed to deathdinerstabbed in the chestinternethit by a carcreaturenews reportshot in the foreheadpublic nuditylimousinecoming outattackproduct placementknocked outkicked in the facegymhigh school studentcheerleaderbasementcharacter says i love youobscene finger gesturecult directorgaragepizzaactor playing himselfwolfscene during opening creditscatfightcomic bookhollywood californiakicked in the stomachvillainessnosebleedclubparking garagecarnivaleaten alivecameoblood on facestabbed in the throatpower outageevacuationco workerescape attemptpunched in the chestbody landing on a carpierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signsense of smellwoman kills a manjockhead cut offhit with a shovelwoman fights a manshapeshiftingcut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airexhibitiontv stationwomen's bathroomtalk show hostcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalawoman hits a mangay jokesilvertroubled productiongay athletepublicistpalm readingcuckoo clockwolfmanfemale werewolfraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All) |
When the Vatican observatory priest sees the appearance of a comet, the Church is sure that it confirms the eve of the Armageddon. Meanwhile, the USA President's godson Robert Thorn is informed in the maternity in Rome by Father Spiletto that his wife Katherine has just lost her baby and she had tro …ubles with her uterus and would not have another pregnancy. Spiletto suggests Robert that another just born child that lost his mother could be the substituted for his son, and Robert accepts the child and gives the name of Damien. Robert is promoted to ambassador in London after a tragic accident. When Damien's nanny commits suicide in his birthday party, a substitute, Mrs. Baylock, comes to work and live with the family. Along the years, Katherine realizes that Damien is evil, while Robert is contacted by Father Brennan, who tells him that Damien is the son of devil. When the priest dies in a bizarre accident, the photographer Keith Jennings shows evidences to Robert that the boy is the Antichrist. They travel to the town of Megiddo to learn how the boy can be stopped. (Read More)
| Subgenre: | paranormal phenomenachristian horror |
| Themes: | evilfuneralsuicidemurderdeathreligionfearparanoiacancerapocalypsewritingthe devil |
| Mood: | horror movie remakenightmareraingore |
| Locations: | rooftoplondon englandhospitalnew york citychurchcemeterybathtub |
| Characters: | priestfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipchildrenboysoldiernursephotographerpsychiatristterroramerican abroadcatholic priestsuicide by hanging |
| Period: | 2010s |
| Story: | newspaper headlinemonster in mirrorperson on fireomengash in the facefull moonanimal attackloss of loved onefireplacesyringechild in perilsevered headimpalementdecapitationremake …blood splattercorpsefirepistolsurprise endingtwo word titledogbloodcigarette smokingphotographexplosionknifecell phoneshot to deathslow motion scenesecretfalling from heightdemonmanhattan new york cityreporterorphancandleexploding carnunhit by a carbirthday partygraveyardattempted murderlimousinegravepoisonpossessionchristmas treelightningu.s. presidentscreamskeletonhangingmanipulationamerican flagtragic eventcrossloss of mothermonkeybirthday cakekilling an animalballoonheavy rainrome italylifting someone into the aircrucifixloss of wifetherapistswat teamjumping from heightfatemonkfloodplaygroundloss of sonzooprophecyscissorsreference to satanbible quotethunderstormfoghandheld camerae mailmurder of a childdisfigurementswingbody landing on a cardemonic possessiondead woman with eyes openlasersightworld trade center manhattan new york citydaggernannytombpopemonasteryfemale psychopathgorillascootersatanismtraffic jamburnt facecatholicismshoeambassadorloss of childbreaking a windowwarningnoosekicked in the headmoving inkiller childdarkroomdisfigured facetabloidmagnifying glasstsunamicheckpointmerry go roundpentagramsledgehammerdog attackburn victimbouquetcometantichristhide and seekhurricane katrinastrawberryred winecutting hairevil childchurch belltantrumbirthmarkarmageddonconcussionskepticismbig ben londoncardinal the priestexhumationmob of reporterstricycledead babyshaky camwoman kills womanobservatoryhelium balloondevil worshipfreak accident666biblical quotehanged by the neckpleadingremake of cult filmnun's habitu.s. embassyvatican citydriftinganimal biteblowing bubblesdisbelieving adultmilitary funeralmilitary dress uniformreference to the new testamentlightning strikenikon camerablowing out a candlered balloontelephoto lensevil dogisraeli flagmanhole covergasoline truck21 gun salutejackalmark of the devilrazor scooterremake of british filmupside down crossmotorcycle escortpunch and judy (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
| Subgenre: | independent filmmartial artsblack comedymelodramadystopiaalternate historyzombie apocalypse |
| Themes: | deathmurderfriendshiprevengekidnappingmarriagebetrayalfeardrunkennessescapedanceweddingdeceptionincestmilitary …travelbrutalityparanoiaredemptionillnessunrequited lovehopeapocalypsecannibalismprejudicewealthcouragenear death experience (See All) |
| Mood: | raingoreominous ending |
| Locations: | rooftoplondon englandforestcemeteryvillagewoodsenglandwalled city |
| Characters: | priestfamily relationshipsfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipfemale protagonistzombiesoldierhostagesister sister relationshiptough guylove trianglewarrioraction hero …cousin cousin relationshipaunt niece relationshipaunt nephew relationship (See All) |
| Period: | 19th century |
| Story: | looking at oneself in a mirrorhorse drawn carriagecrushed to deathstrong female leadservantburned alivestrong female charactersubtitled scenesevered armscartenttransformationsevered headthroat slittingimpalement …mansiondecapitationhallucinationheld at gunpointrifleletterblood splattercorpsefirepistolsurprise endingflashbackblooddogbased on novelviolencegunkissfightdancingexplosionpartyknifechasevoice over narrationbeatingfistfighthorserescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightpaintingshowdownhand to hand combatbritishcombatkung fusubjective cameragood versus evilsurvivalsword fightambushaxemassacrebridgestabbed to deathmixed martial artsstabbed in the chestanti herodisarming someoneone man armyfictional wardouble crossmarriage proposaltraininglibrarydangerstabbed in the backprologueattackcharacter's point of view camera shotrace against timeknocked outtough girllightningscene during end creditslong takebodyguardexploding bodypigthreatened with a knifeclass differencesdismembermentbattlefieldstylized violenceeavesdroppingtraitorcaptaincard gamemartial arts mastergrenaderevelationspearheavy raindiseaseroyaltyjail cellrebelsevered handforbidden loveviolinaction heroinecolonelcannonfemale warriorguarddamsel in distressexplosivecorsetbraverydual wieldstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the necklove at first sightballexploding headpunched in the chestdark herosuperstitioninfectionprideaerial shotrainstormdisfigurementknife throwingdark pasteye patchlieutenantmutationsword dueltragic herocellarmoral dilemmaroundhouse kickblood on camera lensswordsmanface maskfemale fighterhead blown offepidemicphysicianquick drawmilitiaplagueflypocket watchbritish armywoman kills a manbritainstabbed in the shoulderfight the systemheirbritish soldieropen endedtragic pastwoman fights a manarm cut offaristocracycourtshiparmy basefade to blackanti heroinegrindhouse filmbilingualismthroneoutbreakhigh societygold diggersuitorelopementrich manslow motion action scenesurprise during end creditswoman punches a manlordaxe in the headman fights a womansecret passagewaycountry estatemanor houseshaolinladywoman hits a manstory continued during end creditscliffhanger endingrich womansisterhoodswordswomanblood on mouthabandoned churchenglish countrysidegolddiggercavalry chargehordeman murders a womanfire pokergeorgian eraexploding bridgepeace treatyjourney shown on maprogue soldierends with weddingburning bodymashupregency periodparsoncollapsing bridgehouse flyrace warreference to the four horsemen of the apocalypsetotal warwoman wearing an eye patch (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
| Subgenre: | cult filmindependent filmdark comedyslasher flickcreature featuresadistic horror |
| Themes: | murder of a police officerinsanityfuneraltorturedeathmurdersurrealismkidnappingrapejealousyfearmonsterseductiontheftdeath of father …mental illnesssadismtheatrecannibalismmadness (See All) |
| Mood: | nightmareraingoreslasher |
| Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
| Characters: | father son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor |
| Period: | 1970syear 1977 |
| Story: | person on firebreaking through a doorcandlelighttorso cut in halflanterngash in the facecrushed to deathdisappearancemissing personcharacter repeating someone else's dialoguecoffinsevered headtied to a chairhallucinationheld at gunpoint …rifleblood splattercorpsefirepistolsurprise endingflashbackbloodnumber in titleviolencebare chested maledancingphotographknifechasebeatingdreamdigit in titleshot to deathcar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesthousemapman with glassesritualgraveyardshot in the foreheadgravecharacter's point of view camera shotactor playing multiple rolesevil manlightningskeletonhanginghalloween costumelong takecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikermasked mangas maskduct tape over mouthnicknameface paintshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerdead woman with eyes openpsychoticmannequinhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john wayneburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravityliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
In New York, the former NYPD detective Ben Carson is hired to work as night watch of the remains of the Mayflower Department Store that was partially destroyed by fire many years ago. Ben became alcoholic and was retired from the police force after killing a man in a shooting. His marriage was also …destroyed and now he is living in the apartment of his younger sister Angie. However he has not been drinking for three months and sees the employment as a chance to rebuild his life. When he goes to the rounds in his first night, he finds that the mirrors are impeccably clean and his colleague explains that the former night watch was obsessed with the mirrors. After a couple of nights, Ben sees weird images in the mirrors, but due to the lack of credibility of his past, his ex-wife Amy believes he has hallucinations as a side effect of his medication. When Angie is found brutally murdered in her bathtub, Ben discovers that there is an evil force in the mirror that is chasing him and jeopardizing his family. (Read More)
| Subgenre: | supernatural horror |
| Themes: | murder of a police officerevilinsanitysuicidedeathmarriageghostfearangersupernatural powerguiltgriefalcoholism |
| Mood: | horror movie remakegore |
| Locations: | hospitalnew york citybarbathtubrural settingpolice carpennsylvania |
| Characters: | father son relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipgirlpolice officerlittle girlsecurity guardpsychiatristtalking to oneself in a mirrorghost in a mirror |
| Story: | newspaper headlinebreaking a mirrorlooking at oneself in a mirrorperson on fireimmolationgash in the facecrushed to deathmental institutionburned alivechild in periltied to a chairthroat slittingimpalementhallucinationheld at gunpoint …remakemirrorblood splattercorpsefirepistolsurprise endingflashbackbloodfemale nudityone word titlefemale rear nudityphotographtitle spoken by characterexplosionknifechasecar accidentwatching tvcameravomitingbirthdaydemonprayerflashlightmassacreambulancesubwayapologynundrowningbartenderlocker roompossessionbasementratgraffiticopmutilationtied to a bedmorguebuttockshomecrying manschizophreniawhiskeypillsmental hospitalscissorsmedicationdeath of protagonistbathingautopsydeath of sisteralternate realitymarital separationdemonic possessionalarm clocksirennewspaper clippingnannyman cryingdoppelgangerabandoned buildingclosetex cophiding in a closetmonasterybandagesubway stationremorsephysicianconventbroken mirrorburnt faceinterracial marriageglassscene of the crimepsychiatric hospitalvideo footageinterracial coupledeath of familystatue of libertycut handmurder of a nude womanpool hallhousemaidcityscapenypdnight watchmanbreaking down a doorblond hairexposed breastcprfire enginevideo recordingdummyscreaming in painstartledestranged coupleinterracial loveestranged wifeevil forcethrown through a wallsprinkler systemglass shardmirror does not reflect realityfather child relationshipreflection in waterjaw ripped offremote controlled toy carfaucetestranged husbandhandprintspurting bloodpaint on glasssliced bodychild drowningtrapped underwatermirror as portalpsychiatric treatmentburned out buildingmalevolent entityantisepticpleading for helpremake of korean filmartistic imagery (See All) |
During Grant's presidency, Jonah Hex is a remorseless bounty hunter. In the Civil War, he was a rebel whose honor put him afoul of a Confederate general, Quentin Turnbull, who murdered Jonah's family while Jonah watched. As a result of the ordeal, Jonah's face is disfigured and he can talk with the …dead. After staging his own death, Turnbull, with a group of rebel stalwarts, hatches a plan to bring the Union to its knees. Grant wants Hex to stop it. While the nation readies to celebrate Independence Day, Hex and an unlikely ally have little time to stop Turnbull and his weapon of mass destruction. (Read More)
| Subgenre: | superherosteampunkchrist allegory |
| Themes: | murder of a police officertorturemurderdeathrevengesurrealismkidnappingdrunkennessmilitaryrobberypsychopathsupernatural powerterrorismblackmailexecution …death of wifemurder of family (See All) |
| Mood: | raintrain robbery |
| Locations: | lakebartrainchurchcemeterysmall towndesertwoodsshipcampfirebrotheltrain explosionhotel fireship explosion |
| Characters: | tattooprostitutesoldierhostageaction heronative americansheriffmayorself mutilationex soldiermilitary officer |
| Period: | 1800s1870s |
| Story: | newspaper headlinehouse on fireperson on fireextreme closeuppassenger trainknocked out with a gun buttimmolationcanethrown through a windowgash in the faceanimal attacktorchburned alivetentelectrocution …coffinno opening creditssevered headtied to a chairheld at gunpointrifleshot in the chestcorpsefirepistoldogflashbackcharacter name in titleviolencebare chested malefighttitle spoken by characterexplosionknifevoice over narrationshootoutbeatingshot to deathfistfighthorseface slapshot in the headrescuepunched in the facebrawldead bodyinterrogationrevolvershot in the backbased on comic bookterroriststrangulationaxemassacrestabbed to deathstabbed in the chestmapanti heroone man armystabbed in the backprologuefantasy sequencecowboyumbrellarace against timeu.s. presidentattempted rapeamerican flagexploding bodydeath of sontied upthreatened with a knifegeneralhandgunsecret agentchild murderwashington d.c.henchmancivil warcard gamehead buttgothiccowboy hatexploding buildingsevered handirishwhite housecolonelback from the deadcannonpresumed deadcelebrationveteranu.s. armycrossbowfight to the deathanimated sequencepunched in the stomachresurrectionkicked in the crotchdark herodynamitebounty hunterhealingdisfigurementtribelonerlieutenantaxe murderdc comicsflamethrowerburned to deathstick fightgatling gunhorseback ridingharborhistorical fictiongun held to headmegalomaniacgunslingermegaphoneelectric shockcrashing through a windowamerican civil warcorrupt politicianvirginiabadgeravenfacial scardeath of familyoverhead camera shotexploding shipfourth of julyfiring squadcavalryclose up of eyedragging a bodywanted posterbarbershopforthatchetknife held to throatsome scenes animatedrewardchurch bellsouth carolinadecomposing bodybrandingset on fireorigin of heroarsenalartilleryorbcaged humanscarred facehitting a womanstabbed in the bellytalking to the deadconfederate flagmortartomahawkman carrying a womandragging a dead bodybell towerpicking a lockdollar billindependence dayconfederateburn scarpillow talkelectrocutedsummary executiontelegraphcannonballbuilding explosioninfiltratorkilled by a propelleraxe in the chestcivil war veteranderringeraxe throwingmilitary campplaying pokersuper weaponhuman brandingweapons dealerface burnconfederate soldierexploding trainflock of birdsexplosive vestgettysburgbranding ironcamera shot of a woman's legsgas lampsuspended by armscharleston south carolinarefracting telescopetied to a crossunion armycrow indiandragged along the groundputting on stockingsgeorgia usatied to a stakethrowing knifebased on cult comic bookweapons testingfighting arenaartillery fireburning a houseriding at a gallopcoins on eyesmasked gunmantroop train (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
| Subgenre: | black comedy |
| Themes: | deathmurderfriendshipbetrayaldrunkennessguilt |
| Mood: | horror movie remakegoreslasher |
| Locations: | kitchenfire truck |
| Characters: | father son relationshipboyfriend girlfriend relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend |
| Story: | looking at oneself in a mirrorhouse on fireperson on firestabbed through the chindrink thrown into someone's facecanegash in the faceburned alivecharacter repeating someone else's dialoguethroat slittingimpalementhallucinationheld at gunpointremakeshot in the chest …mirrorblood splattercorpsefiresurprise endingbloodfemale nudityviolencefemale frontal nuditymale rear nuditybare chested malefemale rear nuditypartyknifechasepantiesshowercell phoneblondeshotgunslow motion scenepunched in the facebare buttsecretvomitinglingeriecollegehandcuffsvoyeuralcoholcleavageflashlightstrangulationaxeambulancedeath of friendstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiesmini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love yousociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardystabbed in the throatironystabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingerred pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunmurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprtire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsebeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
An advertising executive is kidnapped and held hostage for 20 years in solitary confinement. When he is inexplicably released, he embarks on an obsessive mission to discover who orchestrated his punishment, only to find he is still trapped in a web of conspiracy and torment.
| Subgenre: | conspiracy |
| Themes: | torturesuicidedeathmurderrevengekidnappingrapedrunkennessescapeinvestigationdeceptionincestangerdysfunctional familysurveillance …home invasionexploitationfather daughter incest (See All) |
| Mood: | raingoreneo noirmurder suicide |
| Locations: | new york citybarswimming poolmotelchinese restaurantcar bicycle chase |
| Characters: | doctorfather son relationshipfather daughter relationshiptattoonursehostageactresssecurity guardbibleex husband ex wife relationshipyounger version of characterchinese food |
| Period: | year 2001year 1997year 2000year 1993year 2005year 2013year 2003 |
| Story: | straight razornewspaper headlinebreaking a mirrorhusband murders wifeshot in the shoulderscarcharacter repeating someone else's dialoguetied to a chairthroat slittingmansionfoot chasehallucinationheld at gunpointletterremake …shot in the chestblood splattercorpsepistolsurprise endingtwo word titlebloodflashbackfemale nuditymale nudityviolencemale rear nuditybare chested malesex scenefemale rear nuditycigarette smokingknifeshowercell phonebeatingshot to deathfistfighturinationface slapshotgunrescuepunched in the facewatching tvswordbrawlvomitinghand to hand combatinterrogationvoyeurf wordstrangulationmontagestabbed to deathstabbed in the chestinternetanti heroone man armynews reportcoffeebartenderracial slurskinny dippingbeaten to deathstabbed in the backbased on mangaumbrellarace against timeknocked outkicked in the faceattempted rapelong takelaptopstylized violencehenchmaneavesdroppingrevelationaddictionmousecrucifixvideotapedesperationpresumed deaddiamondmale masturbationstabbed in the throatitalian americaniraq warkicked in the crotchescape attemptstabbed in the headstabbed in the legpunched in the chestlooking at self in mirrorframed for murderimprisonmenthit with a baseball batvodkafemale assassinvideo surveillancestabbed in the handhead blown offwebsitebillionaireretirement homepush upsgreenhousewrist slittingcelloheld captivejockaudio cassettegasshot through the mouthtv studiofilmed killingstabbed in the facepsychological torturehit with a hammerstrangled to deathdelivery boysolitary confinementwoman punching a manhundred dollar billpenthousesnorricamtied to a tablepreparatory schoolfilicideincestuous sexsevered tonguebusiness executiveenglish accentkilled in an elevatoroutnumberedfootball fieldyearbookhenchwomanremake of cult filmmillenniumbellhopwoman wearing a thongbroken anklechinatown manhattan new york citybox cutterplaying celloburning a letterdumplingluxembourgabandoned schoolcctv camerafather son incesthit with a crowbarknockout gaspet mouseworkout videoreference to the count of monte cristodouble barrel shotgunreference to hurricane katrinaremake of korean filmretired teacher (See All) |
For a factory worker named Douglas Quaid, even though he's got a beautiful wife who he loves, the mind-trip sounds like the perfect vacation from his frustrating life - real memories of life as a super-spy might be just what he needs. But when the procedure goes horribly wrong, Quaid becomes a hunte …d man as he finds himself on the run from the police. (Read More)
| Subgenre: | post apocalypsedystopiacyberpunk |
| Themes: | murder of a police officertorturemurderdeathbetrayaldrunkennessescapedeceptionsurveillanceamnesiaartificial intelligence |
| Mood: | nightmareraincar chase |
| Locations: | barhotelhelicopterelevatorapartmenttrain explosion |
| Characters: | husband wife relationshippoliceprostitutetough guyaction herosecurity guardpolice shootoutpolice chaseself mutilationex soldier |
| Period: | future |
| Story: | grand pianohusband murders wifepiano playingtorso cut in halfjumping through a windowstrong female leadstrong female charactersevered armshot in the shoulderinjectionscarcharacter repeating someone else's dialoguedream sequenceno opening creditstied to a chair …foot chaseheld at gunpointremakeshot in the chestpistolsurprise endingtwo word titleflashbackviolenceinterviewbare chested maletitle spoken by characterexplosionknifecell phoneshootoutshot to deathfistfightmachine gunshot in the headslow motion scenepunched in the facebrawlfalling from heighthand to hand combatbombcar crashinterrogationrobotpianoshot in the backspyassassindisguiseambulancearmymixed martial artssubwayanti heroone man armydouble crossnews reportshot in the foreheadon the runbased on short storyfactoryfugitivetough girlopening action scenebankmanipulationexploding bodycharacter says i love youshot in the armsecret agentstylized violencegrenadecatfightstabbed in the stomachvillainessswat teamphone boothjumping from heightrebellionrailway stationaction heroinegas maskresistanceknife fighthologramundercover agentbulletproof vestlens flarelasersightgovernment agentpolitical corruptiongatling gunreference to barack obamamedia coveragefemale assassindesert eagleabandoned buildingoppressionstabbed in the handtaserworld dominationmegalomaniacfemale spyfilm starts with textreluctant herofactory workershot in the handfight the systemcorrupt officialresistance fighterelevator shaftvillain not really dead clichedouble agenttotalitarianismkiller robotmegacorporationlassowoman punches a manstun gunremake of american filmbig ben londonzero gravityflying carrepressed memorysafe deposit boxbody armorman punches a womanfake idfalse memoryremake of cult filmflash grenadesurvivinghit in the throatfalling through a rooftop windowimplanted memorychancellorfuturistic trainbritish colonialismrobot soldierbody scannerpeace symbolreference to ian flemingfacial reconstructionbrain scannerthree breasted womantotal recall (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | cult filmindependent filmslasher flickteen horroramerican horror |
| Themes: | murder of a police officerevilmurderdeathrevengefeardeceptionpsychopathsurveillance |
| Mood: | goresatireslasher |
| Locations: | rooftopwheelchairforestwoodskitchenfire truck |
| Characters: | villainteenage girlteenage boyserial killernursekillersecurity guardpsychiatristslasher killercoroner |
| Period: | 2000s |
| Story: | breaking a mirrorbreaking through a doormental institutionrampageloss of loved onesevered armdisappearanceelectrocutionsevered headthroat slittingimpalementfoot chasedecapitationmirrorblood splatter …corpsefiresurprise endingtwo word titlebloodflashbackfemale nudityviolencesequelfightknifechasecell phonefistfightwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameragood versus evilhalloweenflashlightstrangulationaxeambulancemontagestabbed to deathstabbed in the chestinternetpolice officer killednews reportstabbed in the backcharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletonneck breakingmurdererthreatened with a knifeobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airsecurity cameramorgueskullfatebroken legmasked manstabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roompeep holestupid victimx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
| Subgenre: | martial artsconspiracypost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsepost apocalypticcorporate conspiracy |
| Themes: | insanitydeathmurderrevengekidnappingbetrayalfearescapemonsterdeceptionangerbrutalityparanoiaredemptionillness …surveillancehopepanicself sacrificeartificial intelligence (See All) |
| Mood: | nightmaregore |
| Locations: | rooftopwheelchairmotorcyclelaboratorytunnelsewerhumveecable car |
| Characters: | doctorfather daughter relationshipboyfriend girlfriend relationshipfemale protagonistzombiesoldierhostagesecurity guardbibleprofessorengineer |
| Period: | zip lineseeing the future |
| Story: | person on firebitten in the necktorso cut in halfsevered leganimal attackstrong female leadtorchburned alivefireplacesevered armwaterfallshot in the shoulderscarelectrocutionno opening credits …severed headthroat slittingimpalementdecapitationheld at gunpointshot in the chestblood splattercorpsefirepistolsurprise endingdogflashbackbloodviolencesequelfightexplosionknifechasevoice over narrationshootoutbeatingshot to deathfistfightmachine guncar accidentshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordgunfightbrawlfalling from heightshowdownhand to hand combatsunglassesbombrunningcar crashinterrogationcombatkung fuscientistshot in the backsubjective cameragood versus evilsurvivalflashlightambushstrangulationmassacrearmystabbed to deathmixed martial artsstabbed in the chestexploding cardisarming someonefictional wardouble crossunderwater scenecreaturevoice overshot in the legnecklaceshot in the foreheadone against manybinocularsbeaten to deathdangerstabbed in the backprologuelocker roomfired from the jobcharacter's point of view camera shotmissionactor playing multiple rolesrace against timecover upevil manknocked outkicked in the facetough girltankopening action sceneexploding bodythreatened with a knifemercenaryshot in the armobscene finger gestureundeadbattlefieldwashington d.c.stylized violencehenchmanak 47missileropetraitoruzihand grenadesabotagedestructionrevelationhead buttelectronic music scoreheroinehypodermic needlemachetesociopathdiseasevirussecurity camerawalkie talkiecrucifixmad scientistkicked in the stomachwristwatchdesperationjumping from heightsevered handlasergenociderocket launcherend of the worldaction heroinemexican standoffwhite housegun fusocial commentaryeaten alivefemale warriorcyborgmechanicstealing a carsevered fingerfight to the deathresistancedual wieldstabbed in the throathatredbased on video gamehit in the crotchmercilessnesspower outagechaosshot in the facebroken glassevacuationcigarette lighterstabbed in the legpunched in the chestairplane crashinfectionbooby trapaerial shothologrambody landing on a carknife throwingraised middle fingergasolinestabbed in the eyeburned to deathsirenclonegatling gunfast motion scenebullet timerocketenglishman abroadsatellitedesert eaglefemale soldierabandoned buildingbarbed wireliving deadfinal showdownreturning character killed offfemale fighterarmored carsuper strengthgiant monsterworld dominationmegalomaniacyoung version of characterbunkerinformantstabbed in the armcommanderflarehanging upside downhelicopter crashsawed off shotgungenetic engineeringfemale herowoman kills a manfight the systemfinal battleshot through the mouthsole black character dies clicheshot in the footcountdownopen endedcurejumping into watersixth partwoman fights a mandistrustsubterraneancloningcut into piecesone woman armyresistance fighterspray paintchainsanimal killingsevered footanti heroinearmoryhummerfirecrackersurveillance footageevil corporationoutbreakmad doctorlandminelast standslow motion action scenechild with a gundeoxyribonucleic acidmegacorporationantidotecorporate crimedetonatornail gunstabbed in the footchild soldierbarricadereference to noah's arkflash drivegiant creaturepandemicsuper computerbusiness partnerlast of seriescubespikehockey stickcontact lensimplantsecret laboratorycraterbackflipice picknight vision binocularshanged bodykilled by a propellersiren the alarmhorderesident evilabandoned citylaser cutterfemale mechanicreference to genesishivewinged creaturecomputer controlraccoon cityunderground complexfemale engineer (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
| Subgenre: | martial artsblack comedysupernaturalparanormal phenomenadark fantasymonster movie |
| Themes: | evilmurderdeathfriendshiprevengesurrealismkidnappingbetrayalghostfearescapemonsterdeceptionmagicmilitary …seductionangersupernatural powerparanoiaredemptionsurveillancepaniccourageself sacrificenear death experiencemurder of familyunlikely heroegyptian mythology (See All) |
| Mood: | horror movie remakedarkness |
| Locations: | rooftoplondon englandtrainchurchforesthelicoptercemeteryairplanebusdesertwoodspolice carmuseumlaboratorytunnel |
| Characters: | priestdoctorpolicetattoozombiesoldierpolice officerhostagethieftough guywarrioraction herosecurity guardprofessoramerican abroad …self mutilationbabe scientistamerican in the uk (See All) |
| Period: | 2010s |
| Story: | cryptbitten in the neckrampagetorchsubtitled sceneinjectionscarstatuecharacter repeating someone else's dialogueelectrocutioncursetransformationcoffinno opening creditsthroat slitting …foot chasehallucinationheld at gunpointremakeshot in the chestblood splattercorpsefirepistolsurprise endingdogbloodflashbackviolencebare chested malefemale rear nudityfightexplosionknifechaseshootoutbeatingdreamshot to deathfistfightmachine gunhorsecar accidentface slapshotgunrescueslow motion scenepunched in the facebattlegunfightbrawlbare buttshowdownbeerhand to hand combatsunglassescar crashcombatscientistshot in the backsubjective cameragood versus evilflashlightambushstrangulationaxemassacreambulancedeath of friendarmystabbed to deathmixed martial artsstabbed in the chestsubwayman with glassesanti herodisarming someoneone man armyassassinationdouble crossritualunderwater scenekingpolice officer killedfemme fatalenews reportshot in the legprincessdrowningflash forwardattempted murderpilotbinocularsbeaten to deathdangerprologuescreamingattackfantasy sequencecharacter's point of view camera shotproduct placementrace against timecover upknocked outlightningopening action sceneskeletonmanipulationlaptopratthreatened with a knifemercenarypubundeadbattlefieldpowerak 47pickup truckmissiledestinyhand grenadegrenadedestructionassassination attempthypodermic needlegothictape recordersecurity camerawalkie talkiemad scientisttreasuremorguesergeantkicked in the stomachspidervillainesspoolskullknightmind controlfateburialcolonelback from the deadiraqgun battleguardcrime scenereverse footagemiddle eastvisiontarget practicebraveryu.s. armyconstruction sitefight to the deathpartnermercilessnesspower outageegyptstabbed in the neckresurrectionevacuationimmortalityescape attemptspecial forcesstabbed in the legpunched in the chestairplane crashaerial shotparachutewisecrack humorcapturebulletproof vestdemonic possessionblack magictelekinesisdaggerstick fightmoral dilemmamedia coveragetelepathycrowclose up of eyestombsidekickliving deadalleyfinal showdownburied alivetasermummyconstruction workerpistol whiphuman monsterarmored carhuman sacrificeworld dominationdronecomic reliefsecret societymegalomaniacold flamesplit personalityfilm starts with textartifactpatricideman kills a womanoffscreen killingmacguffinwoman kills a manaltered version of studio logoheirchainedarcheologistopen endedalter egowoman fights a manimmortalmatricidesubterraneangodwoman slaps a manjewelcockney accentmind readingimprovised weaponcar rolloverancient egyptarmy basechosen onestupid victimrelicbilingualismdeal with the devilthronemad doctorsecret roomfratricideinfanticideregenerationtragic villainwomen's bathroomarchaeologistdecomposing bodyenglishwoman abroadsecret organizationbig ben londonzero gravityman fights a womanair strikecorporalcollapsing buildingserumpharaohharpoonsandstormrebootfragments of glassmultiple personality disordertreasure hunterexcavationpharoahhit with a car doorburied treasuresecret laboratoryexplosive decompressionarcheological digevil godjekyll and hydelondon undergroundjackhammerrubyinsurgentflipping caryin and yanglondon eyeairplane pilotcargo planecatacombcrusaderlovecraftianreanimated corpsereboot of seriessoldier of fortunebookshelfgemstonesarcophagusmercurycontemporary settingrogue soldierfaustianhieroglyphicsegyptian godsecret lairlondon busheir to thronemilitary operationliterary charactersecret chamber1190sburial sitefemale archeologistdark universemonster hunter (See All) |
Doctor Channard is sent a new patient, a girl warning of the terrible creatures that have destroyed her family, Cenobites who offer the most intense sensations of pleasure and pain. But Channard has been searching for the doorway to Hell for years, and Kirsty must follow him to save her father and w …itness the power struggles among the newly damned. (Read More)
| Subgenre: | cult filmindependent film |
| Themes: | insanitymurderbetrayaladulteryseduction |
| Mood: | gore |
| Characters: | doctorbabyself mutilationevil doctor |
| Story: | breaking a mirrorperson on firebody torn apartarm ripped offhead ripped offstrait jacketmental patienttorso cut in halfgash in the facemental institutiontransformationsevered headthroat slittingimpalementblood splatter …corpsepistolsurprise endingbloodsexbased on novelsequelbare chested malefemale rear nuditycigarette smokingshowerdemongood versus evilstabbed in the chestfemme fatalepainprologueclownknocked outskeletonloss of fatherthreatened with a knifeloss of mothercheating wifedesiregothicsevered handcovered in bloodcarnivalpuzzleswitchbladeeye gougingchainkilling spreenewspaper clippingblood on camera lensreturning character killed offmazedripping bloodrazor bladeburnt bodypsychiatric hospitalbritish soldierextreme violencemaggotgropingstabbed in the facehit with a hammerheart ripped outmattressheart in handlabyrinthreanimationbrain surgeryface ripped offskinsevered facestabbed in the foreheadexposed braindrill in the headmute childring of firemouth sewn shuthand through headfunhousehuman anatomypinheadnail in the headpuzzle boxscratching facewearing human skinsexual imagery (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | cult filmindependent filmblack comedypsycho thrillersadistic horror |
| Themes: | murder of a police officerevilinsanitydeath of mothertorturesuicidedeathmurderfriendshiprevengekidnappingrapebetrayalfearescape …deceptionseductionangerpsychopathdeath of fatherbrutalityparanoiahumiliationsadismexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessnear death experiencemurder of family (See All) |
| Mood: | nightmaregoreambiguous ending |
| Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
| Characters: | villainfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officerserial killer …nursehostagetough guymaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
| Period: | 1970syear 1978 |
| Story: | looking at oneself in a mirrorhouse on firereference to jack the rippersevered legjumping through a windowthrown through a windowbutcherrampagedeath of brothershot in the shoulderelectrocutionchild in perildream sequencetied to a chairthroat slitting …impalementfoot chaseheld at gunpointrifleshot in the chestblood splattercorpsefirepistoldogbloodflashbackviolencesequelmale rear nuditybare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionknifechasepantiesshowershootoutwoman on topbeatingdreamshot to deathmachine gunhorseface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalgay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealercocainestabbed to deathstabbed in the chestfemale pubic hairwhite pantiescultanti herodouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmermanipulationsplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortingmurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillsevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
| Subgenre: | tragedychrist allegory |
| Themes: | death of mothersuicidemurderdeathloverevengesurrealismkidnappingbetrayalfeardeceptionbrutalitysupernatural powerhopedeath of wife …self sacrificemythologynear death experience (See All) |
| Locations: | london englandchurchforestwoodscastlecave |
| Characters: | father son relationshiphusband wife relationshipmother son relationshipsoldierhostagetough guyvampirewarrioraction heroself mutilationex soldierself healingblood lust |
| Period: | 15th century |
| Story: | person on firehorse drawn carriageglowing eyesbitten in the neckanimal attacktorchburned alivesubtitled scenesevered armshot in the shoulderscartentcursetransformationchild in peril …no opening creditsthroat slittingimpalementblood splattercorpsefiresurprise endingflashbackbloodcharacter name in titleviolencebare chested maleexplosionknifechasevoice over narrationbeatinghorserescueslow motion scenepunched in the facebattleswordfalling from heightshowdownhand to hand combatrunningdemonrivercombatsubjective cameragood versus evilcandlesword fightambushaxemassacremountainarmystabbed to deathstabbed in the chestmapanti heroone man armyon the runflash forwardattempted murderone against manylegendstabbed in the backscreamingcharacter's point of view camera shotevil manlightningskeletoncrossthreatened with a knifedirectorial debutgeneralbare chested male bondagerefugeebattlefieldfreeze frameprincestylized violencemaniacdestinywolfbow and arrowhead buttspeargothicheavy rainhelmetcrucifixloss of wifespiderskullmonkburialback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heighteastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy basearmorydeal with the devilthronex rayed skeletonregenerationscrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
Arkin escapes with his life from the vicious grips of "The Collector" during an entrapment party where he adds beautiful Elena to his "Collection." Instead of recovering from the trauma, Arkin is suddenly abducted from the hospital by mercenaries hired by Elena's wealthy father. Arkin is blackmailed … to team up with the mercenaries and track down The Collector's booby trapped warehouse and save Elena. (Read More)
| Subgenre: | martial artssurvival horrorsadistic horrorhorror b movie |
| Themes: | torturedeathmurderrevengekidnappingescapetrauma |
| Mood: | gore |
| Locations: | hospitalnightclub |
| Characters: | husband wife relationshipfather daughter relationshipbrother sister relationshipserial killerfatherself mutilationyounger version of charactermysterious villainserial murdererkiller dog |
| Story: | person on firestabbed through the chintorso cut in halfsevered legthrown through a windowgash in the facecrushed to deathburned alivesyringesevered armtrapcharacter repeating someone else's dialoguechild in perilsevered headthroat slitting …impalementshot in the chestblood splattercorpsepistolsurprise endingtwo word titleflashbackbloodfemale nudityviolencesequelbare chested maledancingtitle spoken by characterexplosionpartyknifelesbian kisschaseshot to deathfistfightshotgunslow motion scenepunched in the facecar crashsubjective cameramassacredeath of friendstabbed to deathstabbed in the chestanti heronews reportstabbed in the backcharacter's point of view camera shotkicked in the faceskeletonexploding bodycharacter says i love youmercenaryex convictobscene finger gesturedismembermentgrenadekilling an animalwarehousemass murdertied to a bedstabbed in the stomachspiderswat teamskullmexican standoffbroken legmasked mancamera shot of feetswitchbladetrappedsevered fingerteamjunkietitle appears in writingexploding headassault riflebooby trapknife fighttitle at the endslaughterbody landing on a carraised middle fingerlens flarebroken armrescue missionmasked killerfirefighterimpersonating a police officerserial murdercrucifixionstabbed in the handbrainwashingmazekilling a doggerman shepherdstandoffstabbed in the armhanging upside downbody in a trunkcrashing through a windowheld captiverazor bladecrushed headravestabbed in the shouldergraphic violencecheating boyfriendstabbed in the facehomeless personcut into piecesclose up of eyegrindhouse filmcaptivityreturning character with different actorcoercionbear traphung upside downflickering lightwoman punches a manswattied to a tablecadavercircular sawbreaking a car windowsevered tonguegiallo esquehearing aidstrapped to a bombpeepholearm casthuman skeletonlocked in a cageteam uptrip wireabandoned hotelhung from a hookiron maidenrube goldberg machinebuilding firefusepleading for helpclimbing down a ropenailed to a wall (See All) |
The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum …mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)
| Subgenre: | martial artsblack comedysupernaturalfairy talesword and sorcerysteampunkdark fantasy |
| Themes: | death of mothermurderdeathsurrealismkidnappingbetrayalescapemagicdeath of fathersupernatural powerabductionfalling in lovemissing child |
| Mood: | gore |
| Locations: | forestsmall towndesertvillagewoodscity |
| Characters: | villainpolicebrother sister relationshiphostagetough guyaction herosniperwitchsheriffmayorsniper rifleself inflicted gunshot woundevil witch |
| Story: | person on firebody torn apartimmolationdouble barreled shotguntavernpassionate kisslanternthrown through a windowcrushed to deathfull moonburned alivesevered armwaterfalltrapshot in the shoulder …injectioncharacter repeating someone else's dialoguecursechild in perilsevered headimpalementdecapitationheld at gunpointrifleshot in the chestblood splatterfirepistolbloodflashbackfemale nuditycharacter name in titlenudityviolencebare chested malegunfemale rear nudityfightphotographexplosionknifechasevoice over narrationpunctuation in titlebeatingshot to deathfistfightmachine gunshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationcombatshot in the backf wordgood versus evilcleavageorphanassassinsword fightambushaxemassacrestabbingstabbed to deathcolon in titlestabbed in the chestanti heroritualpolice officer killedshot in the legfive word titleskinny dippingstabbed in the backmissionrace against timeknocked outtough girlopening action sceneattempted rapefarmerexploding bodyshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowflyinghead buttgothicslow motioncatfightstabbed in the stomachwitchcraftbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killerhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headdungeonwisecrack humortitle at the endbounty hunterhealingdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armredheaded womanhanging upside downdeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All) |
Five twenty-something friends become holed up in a remote cabin. When they discover a Book of the Dead, they unwittingly summon up dormant demons living in the nearby woods, which possess the youngsters in succession until only one is left intact to fight for survival.
| Subgenre: | supernatural |
| Themes: | evilsuiciderapesupernatural rape |
| Mood: | horror movie remakeraingore |
| Locations: | forest |
| Characters: | father daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipself mutilation |
| Story: | person on fireimmolationdouble barreled shotgungash in the facesyringesubtitled scenesevered armshot in the shoulderinjectioncharacter repeating someone else's dialogueno opening creditsimpalementremakeshot in the chestblood splatter …firetwo word titlebloodflashbackviolencephotographlesbian kissshowershotguncar crashdemonf worddeath of friendstabbed in the chestdrawingshot in the legnecklacedrowningshot in the foreheaddrug addictbeaten to deathcharacter's point of view camera shotknocked outcharacter says i love youshot in the armchainsawkilling an animalmachetegroup of friendssevered handcovered in bloodrape victimclockpromisestabbed in the neckshot in the facestabbed in the legscene after end creditstitle at the endh.p. lovecraftdemonic possessionchaincharacters killed one by onecellarfemale in showersurprise after end creditsdead dogblood on camera lensstabbed in the handburied alivebag over headhead blown offstabbed in the armwellbroken mirrorburnt facehead bashed incabin in the woodsdripping bloodshot in the handstabbed in the shouldersole black character dies clicheextreme violencestabbed in the facecrowbardead cathit with a hammersole survivorarm cut offtrapdoorhouse firesevered footzippo lightergrave diggingtrail of bloodalternate versionstabbed in the mouthnail guncrushed by a carremake of american filmbitten handbroken handfilicidedrug withdrawaldefibrillationhit with a rifle butthead cut in halfvomiting blooddriving in the rainremake of cult filmsplit headglass shardincantationbox cutterchainsaw murderboiling waterstabbed with glassanimate treemultiple versionsslip and fallbook of the deadremake of cult favoriterecovering drug addicttwitchingbloody knifehit with a crowbaroldsmobileattacked by a plantelectric knifegroup of fivelocked in a cellarstabbed with a needledemonic undeadshower with clothes onroast beefbreaking mirrorraped by treesregistered nursechained to a treeunrated version available (See All) |
A young girl (Baby Doll) is locked away in a mental asylum by her abusive stepfather where she will undergo a lobotomy in five days' time. Faced with unimaginable odds, she retreats to a fantastical world in her imagination where she and four other female inmates at the asylum, plot to escape the fa …cility. The lines between reality and fantasy blur as Baby Doll and her four companions, as well as a mysterious guide, fight to retrieve the five items they need that will allow them to break free from their captors before it's too late... (Read More)
| Subgenre: | cult filmmartial artstragedysteampunkcaper |
| Themes: | funeralmurderdeathsurrealismbetrayalescapedancegangstersurveillanceself sacrificesamurai |
| Mood: | satire |
| Locations: | trainhelicoptersnowbuskitchencastlestrip clubbrothelbus driverbus stationtrain explosion |
| Characters: | priestdoctorpoliceprostitutefemale protagonistzombiesoldierpolice officerdancerhostagesister sister relationshipwarriorsecurity guardteacher student relationship …snipermayorsniper riflepimp (See All) |
| Story: | extreme closeupbody torn apartknocked out with a gun butttorso cut in halfsevered legasylumgash in the facemental institutionanimal attackshot in the shouldercoffinno opening creditssevered headthroat slittingfoot chase …decapitationhallucinationheld at gunpointrifleshot in the chestblood splattercorpsefirepistolsurprise endingtwo word titleflashbackbloodf ratedviolencegundancingexplosionknifechasevoice over narrationshootoutdreamshot to deathmachine gunface slapshot in the headshotgunrescueslow motion scenepunched in the facebattleswordarrestfalling from heighthand to hand combatbombbathroomrobotdemonprostitutionhandcuffscombatshot in the backflashlightcandlesword fightdeath of friendstabbed to deathstabbed in the chestmapnonlinear timelinechild abuseradiocreaturecigar smokingshot in the legshot in the foreheadstabbed in the backprologuekeymini skirtmissiondragonrace against timeevil mankicked in the faceattempted rapeexploding bodyworld war onethreatened with a knifesilencerbattlefieldmissilebow and arrowkilling an animalheavy rainsexual abusecooksecurity cameratemplekicked in the stomachtherapistplanetgiantlaserrocket launcherrapistback from the deadfemale warriorgas maskcyborgdiamondimaginationexplosivecrossbowkatana swordstabbed in the neckresurrectionshot in the facemental hospitalstabbed in the headthunderstormstabbed in the legpunched in the chestschool uniformsexploitationdynamiteaccidental killingdeath of sisterblack eyehologramalternate realityschoolgirl uniformstabbed in the eyedressing roomgatling gunlaser gunbullet timecrowclose up of eyesfemale assassingiant robotkatanafire extinguisherswastikamolotov cocktailtimebombspit in the facefemale bondingpistol whipsuper strengthalarmmini dresslighterstepfatherplane crashflareinsane asylumshot in the eyeblackboardshort skirtshot point blankguardiantop secretbomberforgeryfighter planebiplaneexploding airplaneclimbing out a windowalice in wonderlandtrenchstarts with narrationdojosexual predatorvermontcovert operationfemale pilotdark heroinefemale empowermentminiskirtpunched in the crotchexploding planefire breathing dragonlobotomyeye candylooking through a keyholeblimpkicked in the ballsstomach ripped openinside the mindescapeegirl gangescape plantelescopic rifleexploding trainflying dragonaerial bombardmentdream sequence within a dream sequenceknocked out with gun buttdesk bellhit with a gun butthit on the head with a riflehuman versus dragonbody landing on carmaster keythigh high sockstriplanesliding down a drain pipe (See All) |
Sherlock Holmes ('Robert Downey Jr.' (qv)) and his longtime trusted associate, Doctor Watson ('Jude Law' (qv)), take on their arch-nemesis, Professor Moriarty ('Jared Harris (I)' (qv)), with the help of Holmes' older brother Mycroft Holmes ('Stephen Fry (I)' (qv)) and a gypsy named Simza ('Noomi Rap …ace' (qv)). (Read More)
| Subgenre: | martial artsbuddy comedy |
| Themes: | torturefriendshippoliticsdrunkennessweddinginvestigationterrorism |
| Locations: | london englandrestauranttrainforesthotelsnowparis francewoodscastlegermany |
| Characters: | husband wife relationshipbrother brother relationshipsnipersniper rifleex soldiersuicide by pistol |
| Period: | 1890s19th century |
| Story: | gypsy campnewspaper headlineyear 1891loading a gunpassenger trainhorse drawn carriagevictorian erathrown through a windowgypsysubtitled scenewaterfallshot in the shoulderinjectionscartent …no opening creditsimpalementfoot chaseshot in the chestsurprise endingflashbackcharacter name in titlesequelmale rear nuditybare chested maledancingexplosionvoice over narrationshootoutshot to deathfistfightmachine gunshot in the headslow motion scenepunched in the facebrawlfalling from heighthand to hand combatbombsecond partrevolvershot in the backgood versus eviloperaassassinname in titlemountaindisguisemixed martial artsnonlinear timelineshot in the foreheadfactorycover uptough girlthreatmercenaryshot in the armsilencertypewritercross dressinghenchmanchessprivate detectivemissileassassination attempttold in flashbackexploding buildingsheeprailway stationcannonseriesshot in the faceevacuationpunched in the chestdynamiteknife fightknife throwingkarate choplens flareswitzerlandpolice inspectorfortune tellerchloroformdaggernewspaper clippingstick fightgatling gunpipe smokingauctionbullet timedrugged drinkprime ministerlighthouseshot through a windowreturning character killed offplastic surgerytimebombsecond in serieseiffel tower parisarms dealerworld dominationmegalomaniacno title at beginningbullet balletpocket watchlandladyambassadorwhistlingstabbed in the shoulderanarchistcluepart of a seriestelegramcamouflagebachelor partybagpipessherlock holmesanarchismballroom dancingtarot cardslow motion action scenesecret doorbook signinguniversity professorcriminal mastermindsecret passagewaywaltzoxygen maskman punches a womanfake beardman dancing with manman dressed as a womanoutnumberedmortartypingswitchadrenalinespyglassmarksmanknife in chestpoison dartbattle of witshung from a hooksteam enginethrown from a trainreference to franz schubertsarcophagusartificial respirationcossackthrown off a balcony50 calibre machine gunfalling to one's deathlighting a cigarmen's clubstop actiontrafalgar square londonmauserslow motion violencefake mustachestrasbourg francearmouryextremist groupmen dancing togetherplaying bagpipeswhite mouseenglish bulldogfeeding pigeonsmauser c96 pistolsearch for brothercoffee beanmauser pistolcold openencoded messageretired doctorcurareformal ballriding a freight train (See All) |
Attack the Block follows an unlucky young woman and and a gang of tough inner-city kids who make an unlikely alliance to try to defend their turf against an invasion of savage alien creatures, turning a South London apartment complex into a war-zone.
| Subgenre: | cult filmindependent filmcreature feature |
| Themes: | deathmurderfriendshiprevengeescapemonsterrobberyunlikely hero |
| Mood: | goreone night |
| Locations: | london englandhelicoptermotorcyclebicycleelevatorurban settingapartmentwater gun |
| Characters: | policeteenagerteenage boynursealienbiologist |
| Story: | person on firestabbed through the chinthroat rippingjumping through a windowthrown through a windowgash in the faceanimal attackburned alivesevered armcharacter repeating someone else's dialoguechild in perilsevered headfoot chasedecapitationheld at gunpoint …blood splattercorpsefirepistolblooddogviolenceexplosionknifechasethree word titlecell phonebeatingshot to deathmachine gunslow motion scenewritten by directorswordarrestfalling from heightshowdowncar crashmarijuanahandcuffsrevolverf wordsurvivalgangambushaxedeath of frienddrug dealerstabbed to deathstabbed in the chestexploding caranti herohit by a carcreaturepolice officer killedlimousinedrug addictbinocularsbeaten to deathstabbed in the backcharacter's point of view camera shotdeath of childbaseball batexploding bodydie hard scenariocharacter says i love youthreatened with a knifeprofanityfireworkschild murdercrime bossfalling down stairskilling an animalmacheteswat teamjumping from heightcovered in bloodparking garageeaten alivealien invasionstealing a carplaygroundkatana swordstabbed in the headcigarette lighterone daylens flareburned to deathlocation in titlehit with a baseball batmarijuana jointgang wargateimperative in titlestreet gangparkourstonerflarehit by a truckcrashing through a windowbloody body of childmuggingmeteortoy gungang membergang leaderanimal killingsocial decaymopedteenage herofirecrackergas explosionhuman versus alienset on firehousing projectkilled in an elevatoroutrunning explosionskylineslanggreen bloodlondon undergroundstolen police carentomologistzoologistyouth gangreference to ebayultraviolet lightbitten on the legsevered noseman eaten by monsterviolent youthpheromonestower blockalien hunthiding in a dumpsterreference to simon cowellmeteor crashbonfire night (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
| Subgenre: | martial artsconspiracydystopiafish out of watercyberpunkdark fantasy |
| Themes: | murderdeathrevengekidnappingescapemonsterinvestigationsupernatural powersurveillancehome invasionpolice brutality |
| Mood: | goredarknesspoetic justice |
| Locations: | rooftophelicopterelevatorpolice stationsewer |
| Characters: | doctorfather son relationshippolicemother daughter relationshipfemale protagonistdetectivehostagevampirewarriorlittle girlsecurity guardpolice detectivedaughterself mutilation |
| Period: | future2010s |
| Story: | throat rippingbitten in the necktorso cut in halfjumping through a windowthrown through a windowcrushed to deathanimal attackwerewolfsevered armshot in the shoulderinjectioncharacter repeating someone else's dialoguetransformationchild in perilno opening credits …severed headthroat slittingimpalementdecapitationheld at gunpointshot in the chestblood splattercorpsefirepistolsurprise endingtwo word titlebloodviolencesequelbare chested malephotographexplosionknifechaseshootoutbeatingshot to deathfistfightmachine guncar accidentshot in the headshotgunrescuepunched in the facebattleswordgunfightbrawlfalling from heightshowdownhand to hand combatbombcar crashhandcuffsrevolvercombatkung fuscientistshot in the backsubjective cameragood versus evilsurvivalflashlightstrangulationaxemassacrestabbed to deathcolon in titlemixed martial artsstabbed in the chestanti herohit by a carfictional warunderwater scenecreaturesearchnews reportshot in the legshot in the foreheadone against manybeaten to deathstabbed in the backlocker roomattackcharacter's point of view camera shotcover upkicked in the facetough girlexploding bodyneck breakingmercenaryshot in the armhenchmanexperimenthand grenadekilling an animalhypodermic needlegothicsecurity camerakicked in the stomachfourth partgiantjumping from heightparking garageaction heroinegun fusocial commentaryback from the deadfemale warriorstealing a carexplosivestabbed in the throatwhippartner3 dimensionalresurrectionshot in the facestabbed in the headstabbed in the leg3dpunched in the chestbody landing on a carknife throwingstabbed in the eyemutationflamethrowertelepathydesert eaglesuper strengthstabbed in the armshot in the eyescalpelgenetic engineeringdamman kills a womanscene of the crimeepiloguestabbed in the shouldershot in the throatopen endedcurestabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouthantidotewoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All) |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
| Subgenre: | martial artssuspensesurvival horror |
| Themes: | insanitysuicidedeathmurderrevengekidnappingbetrayalfearescapemonsterdeceptionpsychopathbrutalityparanoiaredemption …panicself sacrificehuntingalien abduction (See All) |
| Mood: | gore |
| Locations: | forestwoodsouter spacejunglespace ship |
| Characters: | doctortattoosoldierserial killeralienhostagetough guywarrioraction herohitmankillerjapanesesniperrussiansniper rifle …ex soldierevil doctoralien monster (See All) |
| Story: | stabbed through the chinhead ripped offtorso cut in halfsevered leganimal attackstrong female charactersubtitled scenesevered armwaterfalltrapshot in the shouldercharacter repeating someone else's dialogueelectrocutionno opening creditssevered head …impalementfoot chasedecapitationheld at gunpointshot in the chestblood splattercorpsefirepistolsurprise endingbloodviolenceone word titlesequelbare chested malephotographtitle spoken by characterexplosionknifechaseshootoutshot to deathmachine gunshot in the headshotgunrescueslow motion scenepunched in the facebattleswordgunfightfalling from heightvomitingcriminalcombatshot in the backf wordsubjective camerasurvivalassassinsword fightambushstabbed to deathman with glassesanti heroone man armydouble crossspaceshipcreaturethird partdangerpoisoncharacter's point of view camera shotevil mankicked in the facetough girlskeletonexploding bodythreatened with a knifemercenarytrustbattlefieldak 47africanuzihand grenadekilling an animalhead buttmachetecagesurvivorlifting someone into the airhunterspacecraftnosebleedplanetskulllaseraction heroinefemale warriorswitchbladesevered fingerfight to the deathdual wieldstabbed in the throatmercilessnesspunched in the stomachshot in the facefalling to deathensemble castspecial forcesdark herobooby trapparachuteconvictyakuzaminedark pastfieldtragic herocharacters killed one by onelasersightmoral dilemmagatling gunprequelfemale assassinfemale soldierinvisibilityextraterrestrialkatanaparalysiswhistlefalling into waterimaginary friendflarehanging upside downhuntscalpelcrash landingpredatorstabbed in the shoulderteamworkopen endedtragic pastalien planetmasked villainexploding shipone woman armyflare gundragging a bodydreadlocksanti heroinealien creaturemad doctoralien racetalking to oneselfbear trapwoman punching a manfalling off a cliffhuman versus alienmost dangerous gamereference to ernest hemingwaybody armorhand through chestblack opsbaitgame of deathskinned aliveenforcerjungle warfaregreen bloodhuman preycontemplating suicideinfra redstabbed through the chestfalling down a hillminigunfilm with ambiguous titlecovered in mudelectro magnetic pulsefree fallhole in chestwarrior racemonster versus monstertoxinvoice imitationgrabbed by the throatleg blown offalien hunterinfrared visioninvisibility cloakshivfemale sniperdeath row inmateinvisible monsterstabbed through backhunting peopletied to a stakealien predatoralien weaponalien versus alienpoisonous plantprequel to sequelspine rippingfalling into a pithuman hunted down for sporthunted peoplesnare trapaircraft explosion (See All) |
With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends …up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)
| Subgenre: | cult filmindependent filmblack comedysuspensesupernaturalparanormal phenomena |
| Themes: | evilinsanitysuicidedeathmurdersurrealismfearescapemonsterinvestigationdeceptionparanoiaapocalypseself sacrificepolice brutality …ghost townend of mankind (See All) |
| Mood: | nightmareneo noir |
| Locations: | new york citybarchurchhotelcarsmall townbusbicycleelevatormoteltunneltownnew england |
| Characters: | doctorpolicepolice officerwriterlawyerpsychiatristsecretaryhomeless manself referentialinsurance agentevil monster |
| Period: | 1990s |
| Story: | looking at oneself in a mirrorstrait jacketdouble barreled shotgunasylummental institutionanimal attacktorchfireplacesevered armdisappearancemissing personcharacter repeating someone else's dialoguefoot chasehallucinationrifle …shot in the chestblood splattercorpsesurprise endingdogflashbackbloodviolenceguncigarette smokingtitle spoken by characterchasebeatingshot to deathcar accidentshot in the headshotgunarrestpaintingbookcar crashbathroomdemonhandcuffsreference to jesus christrevolvermanhattan new york citysubjective cameragood versus evilaxeambulancebridgedinerweaponnonlinear timelineanti herodrawinghit by a carcreaturenews reportattempted murdersmokingauthorbeaten to deathpay phonecharacter's point of view camera shotlightningcrossfilm within a filmbasementsuspicionmurderercinemacult directortypewriterdismembermentkillingriotpickup truckrevelationelectronic music scoregothicheavy rainmutantragetold in flashbackcrucifixmovie theaternosebleedfraudend of the worldschizophreniascamhitchhikingmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormdisfigurementh.p. lovecraftaxe murdermutationriding a bicycleshot multiple timesmedia coverageposteralleytributenovelhomagepublisherportaleditorconfessionalinsane asylumcornfieldreceptionistfantasy worldsleeping in a carmanuscriptchapeldisfigured facepitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesmanic laughterblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgegoing in circleshorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All) |
Britain, A.D. 117. Quintus Dias, the sole survivor of a Pictish raid on a Roman frontier fort, marches north with General Virilus' legendary Ninth Legion, under orders to wipe the Picts from the face of the Earth and destroy their leader, Gorlacon.
| Themes: | funeraltorturemurderrevengekidnappingbetrayaldrunkennessescapedeceptionself sacrificehunting |
| Mood: | nightmaregore |
| Locations: | forestsnowvillagewoodscavecampfire |
| Characters: | father son relationshiptattoosoldierhostagewarriorwitchself mutilation |
| Story: | begins with texttavernsevered leggash in the facefull moonanimal attacktorchfireplacesubtitled scenewaterfallhorse ridingtrapshot in the shoulderscartent …child in perilsevered headthroat slittingimpalementdecapitationshot in the chestblood splattercorpsefiresurprise endingblooddogviolenceone word titlebare chested malefighttitle spoken by characterknifechasevoice over narrationshot to deathhorseurinationshot in the headslow motion scenepunched in the facebattleswordbrawlfalling from heightshowdownhand to hand combatrunningrivercombatshot in the backf wordsurvivalwinesword fightambushstrangulationaxemassacremountainstabbingdeath of friendarmystabbed to deathstabbed in the chestfishnonlinear timelinefalse accusationanti herodouble crosskingfemme fataleshot in the legon the runattempted murderdangerstabbed in the backprologuescreamingattackfugitivepoisonkicked in the facedeath of childlightningdeath of songeneralchild murdertraitorwolfbow and arrowkilling an animalwhat happened to epiloguehead buttspearassassination attempthelmetrome italylifting someone into the aircookstabbed in the stomachhunterhidingnosebleedcampjumping from heightsevered handcovered in bloodhonorbar fightbroken legeaten alivefemale warriorreverse footageshieldface paintteamfight to the deathresistancestabbed in the throatscotlandmanhuntstabbed in the neckmuteshot in the facestabbed in the headstabbed in the legexploding headdisembowelmentbooby trapeye gougingdeerarmorclifftribestabbed in the eyebody countaxe murderrescue missioncharacters killed one by onearrowburned to deathsuffocationnarrated by characterstabbed in the handset upgreekcremationshot in the neckfemale fighterfireballtombstoneshot with an arrowgovernorstabbed in the armslashingemperorcommandershot in the eyefilm starts with textbehind enemy linesblizzardman kills a womanoffscreen killingmushroombritainsword and sandalhead cut offslingshotstabbed in the shoulderbleeding to deathshot through the mouthsole black character dies clicheshot in the throattreacheryarcherbladecamouflagerepeated lineancient romefacial scarstabbed in the facearm wrestlingsole survivorcoughing bloodarmy basevalleygreat britainfortthroat cutscottish accentstarts with narrationstrong mandutch anglescrollstabbed in the mouthhuthands tiedbattle axefalling off a cliffaxe in the headroman empiredrinking bloodflaming arrowmessengerrescue attemptstabbed in the sidemale camaraderiemass killingromanguerilla warfarebodily dismembermentpunched in the crotchdefectorfuneral pyreromatrackerscoutwood carvingsurprise attackscreaming in painshot in the kneestabbed in the crotchman huntoutpostdeath by impalemententrailsriver rapidstrackinglegionwar woundstabbed through the cheststomach ripped openroman soldierwar paintsword and shieldarrow in chestcarvinghead held underwaterleg cut offguerrilla warfarevengencewarrior raceashaxe in the chesthead on a stakepoisoned drinkaxe throwinghead split in halftunicbound in chainsstabbed with a speartooth knocked outyorkface paintingbegins with historical notescenturionmute womanflipping a coinroman legioncliff divingjumping into a riverrunning into a treewoman warriorstabbed through the mouthanimal carcassprimal screamgolden eagle2nd centuryjumping off clifftauntroman armyhiding under floorboardsstabbed through the backtreating a woundcatching fish by handchild with a knifearmy on the marchhadrian's wallimpaled on a spearthrowing an axe (See All) |
After finally catching serial killer and occult "sorcerer" Lord Blackwood, legendary sleuth Sherlock Holmes and his assistant Dr. Watson can close yet another successful case. But when Blackwood mysteriously returns from the grave and resumes his killing spree, Holmes must take up the hunt once agai …n. Contending with his partner's new fiancee and the dimwitted head of Scotland Yard, the dauntless detective must unravel the clues that will lead him into a twisted web of murder, deceit, and black magic - and the deadly embrace of temptress Irene Adler. (Read More)
| Subgenre: | cult filmmartial artsconspiracy |
| Themes: | murder of a police officermurderfriendshipprisondrunkennessdeceptionrobberydeath of fatherbrutalitygamblingexecutionmurder of father |
| Mood: | nightmarerain |
| Locations: | london englandhospitalrestauranttrainhotelbathtubshiplaboratorysewerabandoned factory |
| Characters: | father son relationshipboyfriend girlfriend relationshipserial killerthieflove trianglewarrioraction heroamateur detectivemysterious villain |
| Period: | 1890s19th century |
| Story: | newspaper headlineperson on firescotland yard inspectortower bridge londondrink thrown into someone's faceson murders fathervictorian erajumping through a windowburned alivesubtitled sceneshot in the shouldercoffinno opening creditsnewspaperfoot chase …hallucinationheld at gunpointmirrorcorpsefiretwo word titleflashbackcharacter name in titlebare chested maletitle spoken by characterexplosionchaseshootoutfistfightshot in the headshotgunslow motion scenepunched in the faceswordundressinggunfightbrawlfalling from heighthand to hand combathandcuffssciencegood versus eviloperabound and gaggedsword fightstrangulationaxedisguisemixed martial artsmapnonlinear timelineanti heroritualfemme fatalegraveyardnecklacegraveprologuerace against timeknocked outreadinglightningopening action scenehangingwitnessstylized violenceprivate detectiveteaassassination attemptkicked in the stomachfaked deathrailway stationviolinback from the deaddamsel in distresshit in the crotchpunched in the stomachresurrectiontitle appears in writingbribebible quoteeye patchwar veteransword duelhorse and carriagechainblack magicstick fightpipe smokinggeniusengagement ringbullet timedrugged drinkbattombfianceesidekickspiral staircasehuman sacrificetwo man armysecret societyfraternitynewspaper articlesawed off shotgunambassadormeat cleaveraltered version of studio logoclueslaughterhousesorceryman on firefrenchmanriddlesherlock holmesman hits a womankicking in a doorred winestrong manbulldogparliamentillegitimate sonjumping out a windowantidotesecret organizationhidden roomsliced in twobig ben londonillusionistfalling asleephidden doorchambermaidgallowstall manbare knuckle fightingpoison gashandcuffed womanfirst of trilogyshipyardsinking shippalm readingwall safedead body in waterhandcuffed to a beddead ratexecution by hangingfly the insecttinnituscharacter appears on front page of a newspapercharacter appears in newspaperpushed from heightdrowning in a bathtubdiamond necklaceelectro shockarch villaindead body in bathtubhit in the throatsword canearm in a slingevil geniusphotograph in newspaperjumping into a rivernecklace yanked offbuzzsawdeductiongypsy womanfake nosebridge constructionhouse flysecret orderdeath of fianceeenglish bulldoghouse of lordsdenouementfrog dissectionparliament buildingbook of revelationsretired doctorindustrial agereference to don giovannideductive reasoninglate victorian eralondon bobbystolen necklacethames river (See All) |
Marv is unconscious on a highway surrounded by corpses. When he awakes, he has amnesia and tries to recall his last steps from the Kadie's saloon on the Saturday night. He recalls that he found four playboys burning a homeless man alive and defended the poor man. Marv hunts them down and kills the g …roup. The cocky gambler Johnny hits jackpot in slot machines in the Kadie's saloon and invites the waitress Marcie to go with him to play poker game against the powerful Senator Roark. He wins the game and suffers the consequence of his arrogance. The private detective Dwight McCarthy is contacted by his former lover Ava Lord that asks to meet him at the Kadie's saloon. Ava asks him for forgiveness for leaving him to marry the wealthy Damian Lord. However her strong chauffeur Manute takes her home. Dwight snoops around Ava's house but is found and beaten by Manute and the bodyguards. When he returns home, Ava is waiting for him naked in the bed and seduces him again. Then she tells that Damian and Manute torture her and soon she will be killed. Once again Manute takes Ava with him and hits Dwight that invites Marv to help him to rescue Ava. Damian denies the accusation but Dwight beats him to death while Marv tear Manute's eye out. But soon Dwight finds that he was lured by Ava that shoots him. Marv rescues Dwight and takes him to the Old Town where Dwight finds his former lover Gail that helps him to recover while Dwight plots revenge against Ava. (Read More)
| Subgenre: | independent filmmartial artsblack comedyb moviedystopia |
| Themes: | murder of a police officertorturesuicidedeathmurderrevengeinfidelitymoneybetrayalghostadulterydrunkennessdeceptionvoyeurismseduction …extramarital affaircorruptionbrutalityobsessionredemptiongriefhome invasionphotographyvengeanceamnesia (See All) |
| Mood: | nightmaregoreneo noircar chaseone night |
| Locations: | rooftophospitalbarrestaurantswimming poolhotelcarhelicoptermotorcyclecemeteryapartmentfarmpolice carstrip clubbrothel …car explosioncar motorcycle chase (See All) |
| Characters: | doctorfather son relationshiptattooprostitutedetectivephotographersister sister relationshiptough guywarrioraction herowaitresspolice detectivepolice chaseself mutilationhomeless man …police lieutenantself cutting (See All) |
| Story: | straight razorbreaking a mirrorlooking at oneself in a mirrorperson on fireloading a gunpassenger trainimmolationjumping through a windowthrown through a windowgash in the faceloss of loved oneburned aliveshot in the shoulderscarcharacter repeating someone else's dialogue …severed headtied to a chairthroat slittingimpalementmansionfoot chasedecapitationhallucinationheld at gunpointlettershot in the chestblood splattercorpsefirepistoldogflashbackbloodbased on novelviolencesequelfemale frontal nuditymale rear nuditybare chested malegunsex scenefemale rear nudityfightcigarette smokingphotographtitle spoken by characterexplosionknifechaseshowervoice over narrationshootoutwoman on topbeatingshot to deathfistfightmachine guncar accidentshot in the headshotgunrescueslow motion scenepunched in the facecamerawritten by directorswordgunfightbrawlbare buttfalling from heightshowdownhand to hand combatbombsecond partplace name in titlecar crashhandcuffsvoyeurrevolverstrippertelephoneshot in the backsubjective camerabased on comic bookstrangulationaxedisguisestabbed to deathcolon in titlemixed martial artsdinerstabbed in the chestweaponnonlinear timelineexploding cardrivinganti heroanimalone man armydouble crosspolice officer killedfemme fataleanthologycigar smokingshot in the legshot in the foreheadbartenderskinny dippingattempted murderlimousineone against manygravebinocularsbeaten to deathstabbed in the backcharacter's point of view camera shotninjaknocked outkicked in the facetough girllightningmanipulationconvertiblebodyguardcrossautomobiledeath of husbandneck breakingpremarital sexthreatened with a knifehandgunsilencertwincowdismembermentheroincorrupt copstylized violenceprivate detectivecrime bossuzibow and arrowhead buttnipples visible through clothingpokerheavy rainkicked in the stomachtwinsdesperationjumping from heightsevered handdriving a carrailway stationbald manbikerthugcrime scenehaunted by the pastswitchbladestealing a carcrossbowseven word titlekatana sworddual wieldstabbed in the throat3 dimensionalpunched in the stomachshot in the facekicked in the crotchlove at first sightstabbed in the headensemble castcigarette lightersenatorstabbed in the legexploding headpunched in the chestsaferainstormeye gougingdisfigurementbody landing on a cargasolinedressing roomsequel to cult favoriteflamethrowercoinshot multiple timessinchauffeurmob bossfemale assassinmemory lossactress playing multiple rolesnude swimmingabandoned buildingnarrated by characterdirector cameogamblerreturning character killed offdinner partyplastic surgerypistol whipstrongmansecond in seriesexotic dancershot with an arrowold flamestabbed in the armbillionaireshot in the eyebody in a trunkbased on graphic novelman kills a womancrashing through a windowslot machineeyeballwoman kills a mancowgirl sex positionkicked in the headcar set on fireextreme violenceford mustangmotorcycle gangsuperhuman strengthfacial scarrighteous ragestabbed in the facecorrupt officialcut into piecesmotorcycle coptwin sistershooting rangepsychotronic filmbiker ganggrindhouse filmsocial decaytear on cheekman slaps a womanpoker gamethrown from a carfictional cityreturning character with different actorgold diggerthroat cutautomatic weaponstrong mancutting hairdrinking from a bottlecard tricksexual intercourselassored light districtdrinking from the bottleharley davidsoncorrupt businessmanjumping from a carbroken fingerfemale ninjaneon signfilicidemidnight moviefemale star appears nudefalling through a windowmasked womanhanged by the neckcoin tossskull crushingduffel bagspeeding vehiclepliersvirtual setchevrolet corvettehandcuffed to a beddollar billshot in the buttwoman wearing a thonggirl gangglass shardtwerkingdark horse comicswoman murders a manchauffeured limousineeye ripped outman murders a womanplaying pokertoothpickphysical torturereverse cowgirl sex positionbandaged facemachine pistolprequel and sequelwoman in a bathfalling through a rooftop windowclimbing in a windowself injectionhard boiledjackpotgun with silencersleight of handdoused with gasolinecoin trickflipwoman on top sexactor reprises previous roleangry womancadillac convertiblestealing a police carcredit card declinedmotor carbreaking someone's fingersbeaten to a pulpone dollar billback hand slapgun rangeinjured manambidexterityfield surgeryford mustang convertibleman carrying a mantalking on a phone while having sexblack jackclimbing a fire escapecrashing through a skylightdodge the carlong haired womanpunched in the throatred convertiblebandage over eyediving into swimming pool (See All) |
A British Squad is sent on a training mission in the Highlands of Scotland against Special Operations squad. Ignoring the childish "campfire" stories heard about the area, they continue with their mission and come across the bloody remains of the Special Ops Squad, and a fierce howling is pitching t …he night sky... With two mortally wounded men, they make an escape, running into a zoologist by the name of Megan - who knows exactly what hunts them. What began as what they thought was a training mission turns into a battle for their lives against the most unlikely enemies they would have expected - werewolves. (Read More)
| Subgenre: | cult filmindependent filmsurvival horrorbritish horror |
| Themes: | deathdrunkennessself sacrifice |
| Mood: | gore |
| Locations: | foresthelicopterkitchenblood in car |
| Characters: | soldierwarriorfemale scientist |
| Story: | howlingthroat rippinghead ripped offbreaking through a doorfull moonwerewolfsevered armtrapsevered headtied to a chairimpalementnewspaperfoot chasedecapitationheld at gunpoint …shot in the chestblood splatterfirepistolsurprise endingdogbloodgunphotographexplosionknifeshot to deathmachine gunshot in the headshotgunpunched in the facecameraswordfalling from heightaxedeath of friendstabbed in the chestexploding carshot in the foreheadstabbed in the backknocked outskeletongiftbasementshot in the armdismembermentgrenadebulletkilling an animalinjurysevered handeaten alivescotlandpunched in the stomachspecial forcesdisembowelmentwisecrack humorhealingstabbed in the eyemudshot through a windowblood on camera lensintestinesmolotov cocktailstandoffnight visionstabbed in the armclimbing through a windowflarecabin in the woodsmetamorphosisbritish armywalesgasexploding housesole survivorarm cut offtrapdoorshot through a doorgas explosionbitten in the throatfalling through the floorsoccer fansilverglueplatoonhiding in a carbackpackerreference to little red riding hoodcampsitescottish highlandsjumping from a helicoptersuperglueancient swordtraining missionwerewolf family (See All) |
This movie is set in the mid 1800s and involves poet 'Edgar Allan Poe' (qv). A serial killer is on the loose and murdering people using Poe's descriptions from his published stories and poems. Poe teams up with Detective Fields, a Baltimore policeman to try and catch the killer by using his knowledg …e of the descriptions. Even though the stories are fictional, they start to become reality and the killer is a step ahead of them. Then it takes on a personal note as Poe's lover becomes a target. Will they stop the killer in time? (Read More)
| Themes: | torturemurderdeathkidnappingblackmailabductiontheatremurder investigation |
| Locations: | paris francepolice stationtunnelsewer |
| Characters: | father daughter relationshiptattooserial killerkilleralcoholictattoo on backtheatre actresssuicide by poison |
| Period: | 19th century |
| Story: | newspaper headlinereference to shakespeare's macbethhorse drawn carriagetavernpiano playingtorso cut in halfpassionate kisslanternfull moonshot in the shouldercharacter repeating someone else's dialoguecoffinno opening creditsthroat slittingnewspaper …foot chaseanimal in titleshot in the chestmirrorblood splattercorpsepistolsurprise endingtwo word titletitle spoken by charactershot to deathslow motion scenepunched in the facemaskcandlestrangulationaxepolice officer killedvoice overmarriage proposalgraveauthorpoisondeath of childpursuitcharacter says i love youpoetpoemapplausemorguedead womanmasked mancamera shot of feetdeath of protagonistengagementheartmurder of a childsailordead woman with eyes openpolice inspectorplaying pianoclose up of eyesburied alivewhistleflaskcostume partyfilm starts with textpocket watchbird in titleoverhead camera shotcriticdead catmagnifying glassbaltimore marylandpsychotronic filmkiss on the cheekoff screen murderhouse fireraccoonballroom dancingdead woman on floorman in draghorse chaseman dressed as womanmystery killernewspaper editorwriting in bloodtortured to deathsliced in twomagnetdeadlineprinting presssevered tongueforced suicidepickaxebrokelooking through a keyholemasked womanpoetry readingmanholenewspaper officecut in halfpendulummouth sewn shutmasked ballpolice officer throat slittrap doorwoman screamingcostume balllisteningpiano recitalreference to jules vernesitting on a park benchbaltimorehistorical figurebased on the works of edgar allan poeedgar allan poeopening creditsthrown out of a barlast dayslife imitates artnewspaper reviewpolice whistlereference to ralph waldo emersonsextantstrapped to a tablechronometerfield surgerywoman kidnappedoverturning a tablescream off camerayear 1849knocking a hole in a wallusing a candle for light (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | cult filmindependent filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | evildeathmurderfriendshipsurrealismfeardrunkennessescapedancedeceptionvoyeurismbrutalitysupernatural powerparanoiaillness …sadismunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All) |
| Mood: | raingorenightavant gardeslasherdarknessstylization |
| Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
| Characters: | doctorteenagerfriendboyteenage girlfemale protagonistteachergirlpolice officerstudentsister sister relationshipkillerpsychiatristprofessorwitch …germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
| Period: | 1970syear 1977 |
| Story: | looking at oneself in a mirrorhouse on firethroat rippingglowing eyesbitten in the neckrazorpiano playingfull moonanimal attackservantburned aliveinjectiondisappearancemissing personcharacter repeating someone else's dialogue …coffinthroat slittingimpalementfoot chasehallucinationblood splattercorpsefiresurprise endingdogflashbackbloodviolenceone word titlecigarette smokingdancingexplosionknifechasetelephone callvoice over narrationslow motion scenesecretfalling from heightshowdownbathroompianodemonvoyeurtelephonesubjective cameraswimminggood versus evilwineambushstrangulationstabbingdeath of friendstabbed to deathtoiletstabbed in the chestritualattempted murderlegenddangerprologuescreaminglocker roomcharacter's point of view camera shotcover upcollege studentlightningscreamhangingsuspicionmurdererfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingkilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainfaintingcookexploding buildingwitchcraftnosebleedgossipvisitcovered in bloodgrindhousevictimdead womanschizophreniareverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswormwhistlingoffscreen killingmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmastersilhouetteanimal killingfade to blackghoulgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boyflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn …that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)
| Subgenre: | gothic horrorcult filmcoming of agesuspensetragedyfairy talecreature featurebased on fairy talefolk horror |
| Themes: | death of mothertorturedeathmurderlovefriendshiprevengekidnappingbetrayalfearescapedeceptionseductionangerdeath of father …supernatural powerparanoiahumiliationunrequited loveexecutionpaniccouragedeath of daughterautism (See All) |
| Mood: | nightmaredarkness |
| Locations: | lakechurchforestsnowboatvillagewoodscavelog cabin |
| Characters: | priestfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistsoldierhostagesister sister relationshiplove trianglegrandmother granddaughter relationshiphunting party …woodcutter (See All) |
| Period: | winter |
| Story: | dark foresthorse drawn carriagestagecoachglowing eyestavernfull moonrampageanimal attacktorchwerewolfwaterfallcursesevered headimpalementfoot chase …shot in the chestblood splattercorpsefiresurprise endingflashbackbloodf ratedcharacter name in titleviolencedancingpartyknifechasethree word titlevoice over narrationtitle directed by femaledreamhorserescueslow motion sceneswordarrestmaskinterrogationcolor in titlesubjective cameragood versus evilsurvivalorphanambushaxemassacremountainarmystabbed to deathstabbed in the chestfalse accusationdouble crossritualflash forwardtreedangerstabbed in the backcharacter's point of view camera shotrace against timetragic eventpigloss of fatherloss of mothercaptainsabotagewolfrevelationgothichelmetjail cellhuntersevered handpreachershieldvisionbraveryarranged marriagecrossbowhatredrowboatmedieval timesdeath of sisteraerial shotcapturesnowingdark pastfemale directorkilling spreemoral dilemmatelepathyclose up of eyesnarrated by characterface maskhistorical fictionabuse of powerloss of daughtermental retardationshot with an arrowyoung version of characterwhodunithuntcabin in the woodsmercy killingpatricidereverendaltered version of studio logoloss of sisterchapeldeath of grandmothertragic pastmatricidemiddle agesblacksmithmind readinganimal killingwrongful arresthatchetcard trickmistsuit of armorcaged humanbasketsilverwood choppingwhite rabbitloss of grandmotherred riding hoodwomen dancing togetherred capebrothers grimmtorture devicetunicthrown from a boatwitch hunterdaughter murders fatherplanetary alignmentwerewolf bitewoodsmanbitten in the handwalking over hot coalsbitten in the armred hoodblood moonbitten in the legmurder of grandmotherrabbit trapwater bucketmonster hunterred moon (See All) |
After discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre ocurrences happen and the group becomes trapped inside the ship, which they soon learn is inhabi …ted by a demonic creature. (Read More)
| Subgenre: | cult filmsuspensesurvival horror |
| Themes: | deathmurderbetrayalghostdrunkennessdeceptionangersupernatural powerguiltgreed |
| Mood: | raingore |
| Locations: | barseaoceanghost ship |
| Characters: | little girllustghost in mirror |
| Period: | 1960syear 1962zip line |
| Story: | straight razorlooking at oneself in a mirrorperson on firetaverntorso cut in halfburned alivesevered armdisappearancecharacter repeating someone else's dialoguechild in perilsevered headthroat slittingimpalementdecapitationheld at gunpoint …shot in the chestblood splattercorpsepistolbloodflashbackviolencefemale frontal nudityfemale rear nuditycigarette smokingphotographtitle spoken by characterexplosionshot to deathmachine gunshot in the headshotgunpunched in the facefalling from heightvomitingislandsubjective cameraflashlightmassacreambulancedeath of friendwomanmapradiounderwater scenefemme fatalecigar smokingnecklacedrowningshot in the foreheadbinocularsstabbed in the backpoisonstorytellingknocked outdeath of childskeletonexploding bodyhauntingratdismembermentchild murderitaliangoldcaptainmass murdershot in the stomachtreasurebuttocksfemale singersevered handwatching televisionstabbed in the throatstabbed in the legsoulsinapparitionfemale removes her dressshipwreckburnt faceshot in the eyepoisoningdripping bloodrazor bladescuba divingpassengeraltered version of studio logocruise shipsole black character dies clichemaggotshape shifterimmortalexploding shipcut into piecessole survivorpool of bloodvillain not really dead clichelocketradarballroomballroom dancingcruiseexploding boatfalling through the floorc4 explosivessliced in twostabbed in the foothundred dollar billfall to deathlocked inblowtorchmorphingfreak accidentocean linerstartledrock paper scissorssinking shiphead cut in halfshaving headspear gungold barindoor swimming poolrat poisonwoman wearing a red dresssalvagehanged childhung from a hookconstruction cranepile of moneytugboathit with a metal pipeavaricefalling to one's deathrustshell casingchild ghostlogbookdigital watchluxury linerpoisoned foodevil markfall through floorbering straitcan of beansfalling into poolhiding in a freezership collisionbenevolent spirittug boat (See All) |
With much of the world's population now an undead horde, R is a young and oddly introspective zombie. While fighting with and feeding on a human scavenger party, R meets Julie and feels an urge to protect her. What happens next is the beginning of a strangely warm relationship that allows R to begin … regaining his humanity. As this change spreads through the local undead population like a virus, Julie and R eventually have to face a larger issue when the very nature of their friendship is challenged. Caught between the paranoid human forces and the ferocious "Bonies", zombies who are a mutual threat, R and Julie must find a way to bridge the differences of each side to fight for a better world no one thought possible. (Read More)
| Subgenre: | independent filmblack comedypost apocalypsezombie apocalypsezombie spoof |
| Themes: | deathmurderfriendshipkidnappingfearescapedeceptionmilitarymemorydeath of fatherparanoiaunrequited lovehopecannibalismnear death experience |
| Mood: | rain |
| Locations: | barairplanewaterairportlaboratorywalled city |
| Characters: | father daughter relationshipteenagerboyfriend girlfriend relationshipteenage girlzombiesoldiernursehostagesecurity guardyounger version of character |
| Story: | newspaper headlineknocked out with a gun buttglowing eyesjumping through a windowgash in the facestrong female leadloss of loved onestrong female characterreference to william shakespeareshot in the shouldermissing persontentcharacter repeating someone else's dialoguetransformationdream sequence …throat slittingimpalementmansionfoot chaseheld at gunpointshot in the chestblood splattercorpsepistolsurprise endingtwo word titlebloodflashbackbased on novelviolencebare chested malefightphotographknifechaseshowervoice over narrationbeatingdreamshot to deathmachine gunshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightshowdownbeerrunningguitarshot in the backsubjective camerasurvivalflashlightbraambushmassacredisguisemontagearmysubwayhit by a carfictional warunderwater scenecreatureshot in the legshot in the foreheadblack pantiesbeaten to deathsuburbattackfantasy sequencecharacter's point of view camera shottough girlskeletonconvertiblesplit screengeneralfireworksundeadbattlefieldfreeze framerecord playerheavy rainscene during opening creditssecurity camerawalkie talkiejumping from heightskullparking garageeaten alivefemale warriorfloodstealing a cartarget practiceblood on facehungerlove at first sightassault riflehealinghighwaybalconyknife throwingattractionlooking at self in mirrorlens flarestadiummale in showerclose up of eyesfemale soldierabandoned buildingnarrated by charactergirl in bra and pantiesliving deaddirector cameofemale fightersubway stationarmored carabandoned housemakeoverplaguewatchpolaroidwallhead bashed inwoman in bra and pantiesplaying a video gamecrushed headdeath of boyfriendbullet woundquarantinemetal detectorflesh eating zombiewalking deadbmwpolaroid camerahoodiearmy baseman with no namerecordbaseball stadiumvinylknife in the chestpretending to be deadsuper speedsnowglobebritish actor playing american characterzombie childipodkicked in the chestabandoned carbitten on the armshakespeare's romeo and julietbased on young adult novelscavengercity in ruinswatching someone sleephit on the head with a fire extinguishercanned foodhit with a fire extinguisherfalling through a rooftop windowshakespeare adaptationeating brainsreference to kim kardashianweed whackerdeserted cityreference to guns 'n' rosesfemale feet in socksgirl with socks ondestroyed walltalking zombiezombie pov (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | death of motherfuneralmurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapemonster …deceptionmagicrobberyangerdeath of fatherbrutalitysupernatural powerparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | nightmareraindarkness |
| Locations: | lakelondon englandforestboatwatervillagewoodsenglandshipcastlecavebrothelsewer |
| Characters: | father son relationshiphusband wife relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | glowing eyestaverncrushed to deathanimal attacktorchburned alivesevered armwaterfallshot in the shoulderscarcharacter repeating someone else's dialoguetransformationchild in perilsevered headthroat slitting …impalementfoot chasedecapitationshot in the chestblood splattercorpsefiresurprise endingdogbloodflashbackcharacter name in titleviolencebare chested malefighttitle spoken by characterexplosionknifechasebased on bookbeatingshot to deathfistfighthorseshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameragood versus evilspyorphancandlegangambushstrangulationaxemassacredisguisemontagebridgearmystabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelineanti herodisarming someoneone man armyfictional warritualunderwater scenekingcreaturefemme fataleshot in the legon the runtrainingone against manylegendbeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action scenemanipulationexploding bodyloss of fatherratthreatened with a knifeloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowhead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someoneinterracial friendshipscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcererbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalhawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
Sharon Da Silva believes that she is on the run with her adoptive father because he killed a man in self-defense when she was young. Now on the eve of her 18th birthday, living under the alias of Heather Mason, plagued by horrific nightmares and the disappearance of her father, Sharon discovers he h …as been protecting her from a religious cult called the Order of Valtiel. The revelation leads her deeper into a demonic world that threatens to trap her forever in a place known as Silent Hill. (Read More)
| Themes: | revengekidnappingmonstercannibalismnear death experienceghost town |
| Mood: | nightmaregorehigh school |
| Locations: | churchsnowelevatormotelschool busnew school |
| Characters: | mother son relationshipfather daughter relationshipfemale protagonistgirlhomeless mannew student |
| Story: | person on firemedallionimmolationasylumburned alivesyringesevered armtrapdisappearancecharacter repeating someone else's dialoguetransformationno opening creditssevered headdecapitationhallucination …lettershot in the chestmirrorblood splatterfirepistolsurprise endingflashbackbloodsequelfemale frontal nuditybare chested malethree word titlepunctuation in titledigit in titleshot to deathshot in the headslow motion scenewritten by directorsecond partsword fightstabbed to deathstabbed in the cheston the runstabbed in the backclowncharacter's point of view camera shotcharacter says i love youdismembermentbirthday cakeoccultballoonstabbed in the stomachsevered handorphanagecarnivalfalse identityhitchhikinggas maskcamera shot of feetsevered fingerbased on video game3 dimensionalamusement parkscene after end creditsdisembowelmentfogalternate realitydisfigurementstabbed in the eyeblind mannewspaper clippingmannequinprivate investigatordoppelgangerblood on camera lensintestinesbirthday presentstuffed animalgun in mouthreference to facebookgun held to headsecret societyyoung version of charactermallhanging upside downferris wheelstabbed in the shouldershot through the mouthreference to twitteramuletcarouselmerry go roundportland oregonelevator shaftevil clownreturning character with different actorevil childgiant spidervivisectionhung upside downmissing fatherflickering lighthooded figurewriting in bloodpendantscreaming in fearrunning for your lifewriting on a wallhand through chestadopted childwest virginiaabandoned minedead fishhelium ballooncliffhangerskinned aliveburned at the stakesexy nurseadoptive fathervagrantchoke holdanother dimensionfemale bullydream within a dreamvestdisintegration18th birthdaybolt upright after nightmareashhung from a hookoccult ritualring of fireintroductionunexpected kiss3d sequel to 2d filmshackledabandoned townpop tartfaceless mangoldfish bowltoy rabbitcarrying a womanindian burial groundscarificationash fallterrifiedsemi tractor trailerwearing a maskgear worksstrapped to a gurney (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
| Subgenre: | martial artssword and sorceryalternate historysword and fantasy |
| Themes: | evildeath of mothertorturesuicidemurderdeathrevengekidnappingjealousypregnancyescapeheromagicdeath of fatherbrutality …supernatural powercrueltydeath of wifevengeancedeath of daughtermurder of fatherdeath in childbirth (See All) |
| Mood: | gore |
| Locations: | snowboatwoodscastlecampfirewalled city |
| Characters: | father son relationshiphusband wife relationshipfather daughter relationshipboysoldierthieftough guywarrioraction herowitchsingle fatheryounger version of characterdancing girl |
| Story: | person on firehorse drawn wagontavernpassionate kissgash in the facecrushed to deathanimal attackburned alivesevered armwaterfallscarchild in perilno opening creditssevered headthroat slitting …impalementfoot chasedecapitationremakeshot in the chestblood splatterfirebloodflashbackfemale nuditycharacter name in titlemale nudityviolencebare chested malesex scenefightexplosionknifechasethree word titleshot to deathfistfighthorseshot in the headrescueslow motion scenebattleswordfalling from heightmaskbased on comicshowdownhand to hand combatinterrogationdemonfightingcombatshot in the backgood versus evilassassinbound and gaggedsword fightbased on comic bookambushname in titleaxemassacremountaindisguisestabbed to deathmixed martial artsstabbed in the chestnunanti herodisarming someoneone man armyfictional warritualunderwater scenekingcreatureshot in the legprincessdrowningone against manybeaten to deathstabbed in the backkeyattackevil mankicked in the facetough girlchildbirthexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarybattlefieldfreeze framesingle parenthenchmanpiratebow and arrowkilling an animalhead buttspearassassination attempteggcatfightslaverymutilationkicked in the stomachjumping from heightmonkgoatinterracial friendshipback from the deadslavecelebrationfemale warriordamsel in distressadventurerdual wield3 dimensionalchaosresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdark herodungeoncapturedisfigurementeye patchdemonic possessionsword duelblack magicburned to deathdaggerstick fightpipe smokingpalaceswordsmandriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationshot with an arrowmegalomaniacadventure herosorcerertentacletestcrushed headsword fightingsword and sandalslingshothammockchainedbarbarianprehistoric timesarcherfacial scarrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipshot with a bow and arrowstarts with narrationhorse chasewagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallwarrior womanmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopusrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All) |
As a toxin begins to turn the residents of Ogden Marsh, Iowa into violent psychopaths, sheriff David Dutton tries to make sense of the situation while he, his wife, and two other unaffected townspeople band together in a fight for survival.
| Subgenre: | cult filmsurvival horrordisaster film |
| Themes: | murder of a police officerinsanitydeathmurderfriendshiprevengepregnancyescapemilitarydeath of fatherexecutionself sacrificehuntingmurder of familyghost town |
| Mood: | horror movie remakegorehigh schoolambiguous ending |
| Locations: | lakeswimming poolhelicoptersmall townboatbusdesertrural settingpolice stationfarmpolice cartruckgas stationschool buscar explosion …fire truckhumveetruck accidentcountry doctorcity on fire (See All) |
| Characters: | doctorfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipteenagerboyfriend girlfriend relationshipzombiesoldiersecretarysheriffmayor |
| Story: | house on fireperson on firedouble barreled shotgungash in the facechild in perilno opening creditstied to a chairimpalementheld at gunpointrifleremakeshot in the chestblood splattercorpsefire …pistolsurprise endingbloodviolencebare chested malefightexplosionknifecell phoneshootoutshot to deathmachine guncar accidentface slapshot in the headshotgunrescuepunched in the facecomputerrevolvershot in the backf wordsurvivalbound and gaggedstrangulationmassacreambulancedeath of friendarmystabbed to deathdinerstabbed in the chestexploding carcoffeeshot in the foreheadon the runfugitivecover uptankscene during end creditsfarmerdeath of husbandhandgunarsonchild murderriotdiseasevirusbarnjail cellwalkie talkiehuntermorguenosebleedgenocidegas maskpump action shotgunu.s. armystabbed in the throatchaospolice officer shotcigarette lighterswampassault rifleconcentration campinfectionautopsyparachuteblood on shirtbulletproof vestgasolinefemale doctormutationburned to deathflat tirefirefightersatelliteshot through a windowdementiastabbed in the handhiding in a closetepidemicpolice officer shot in the chestlockerhomicidal maniacplane crashcar washcornfielddeputyhand over mouthwhistlingroadblockbaseball gamedeath of boyfriendstabbed in the shoulderquarantinefuneral homeopen endedoverturning carpitchforkiowanuclear explosionbaseball fieldmortuarytrancekeystruck stopmushroom cloudcar wreckflame throwerbiological weaponset on firebottled waterhazmat suitcircular sawhigh school principalburning cargovernment coveruphanged womanlaundry drying on clothes lineno cellphone signalcatatoniamarshamerican midwestchain link fenceweird behaviorinfectious diseasemouth sewn shutcatatonic statemaniacombine harvestergift shopcontamination suiteyes sewn shutatomic explosionsemiautomatic riflestabbed with a pitchforkharvesterdead pilotknife through handfemale physicianpull the plugsatellite imageshadowy figureexposure to radiationfugitive herowheel bootwooden match (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
| Themes: | deathmurderloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionseductiondeath of fatherbrutalitysupernatural power …redemptionfaithhopeapocalypseblindnesscourageself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
| Mood: | darknesspoetic justiceaustralian supernatural |
| Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
| Characters: | father son relationshiphusband wife relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guywarrioraction heroex husband ex wife relationshipdeath of girlfriend |
| Story: | horse drawn carriagehusband murders wifeglowing eyesimmolationtorso cut in halfsevered legcrushed to deathtelescopeanimal attacktorchservantloss of loved oneburned alivesevered armwaterfall …trapstatuecharacter repeating someone else's dialoguetransformationno opening creditssevered headimpalementdecapitationshot in the chestcorpsefiresurprise endingflashbackbloodviolencebare chested malekissfightexplosionknifechasevoice over narrationbeatingfistfighthorserescueslow motion scenepunched in the facebattleswordbrawlfalling from heightshowdownhand to hand combatbeddemonorgycombatgood versus evilsurvivalbedroomassassinsword fightambushold manaxemassacremountainbridgearmystabbed to deathmixed martial artsstabbed in the chestsnakeanti heroone man armyfictional wardouble crossunderwater scenekingcreaturenecklaceone against manylibrarydangerstabbed in the backprologueattackmissiondragonrace against timeevil manlightningopening action sceneskeletonbraceletdeath of husbandloss of fatherthreatened with a knifelove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionbow and arrowflyingspearassassination attemptbreaking and enteringquesthelmetslaveryelephanttempletreasureexploding buildingkicked in the stomacharchitectgiantmind controlwomanizerend of the worldfatefemale killerback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisionbraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic heroburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathyfemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbingthronefratricidewingsstarts with narrationbeetleslow motion action scenescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
| Subgenre: | independent filmmartial artssuspenseconspiracycorporate conspiracy |
| Themes: | suicidemurderdeathrevengekidnappingbetrayalfearescapeinvestigationdeceptionangerbrutalityparanoiasurveillancepanic …artificial intelligence (See All) |
| Mood: | car chase |
| Locations: | lakeforestwoodskitchenfarmlaboratoryresearch station |
| Characters: | doctorboyfriend girlfriend relationshiphostageinterracial relationshippsychiatristchinesesuicide by hangingbabe scientistfemale scientistgeneticist |
| Period: | near future |
| Story: | looking at oneself in a mirrorthroat rippinggash in the facefull moonrampagesubtitled sceneshot in the shoulderinjectioncharacter repeating someone else's dialogueimpalementfoot chaseheld at gunpointrifleshot in the chestmirror …blood splattercorpsepistolsurprise endingbloodflashbackcharacter name in titleviolenceone word titleinterviewbare chested malefighttitle spoken by characterknifechaseshowercell phonebeatingfistfightcar accidentshot in the headrescuepunched in the facecomputercamerabrawlshowdownhand to hand combatbedinterrogationriversciencekung fuscientistshot in the backf wordbedroomassassinambushstrangulationdeath of friendstabbed to deathmixed martial artsdinerstabbed in the chestman with glassesdisarming someonedouble crossdrowningshot in the foreheadlatex glovesattempted murdertreebeaten to deathdangerstabbed in the backkaratesuitcasecover upknocked outkicked in the faceisolationlaptopneck breakingsuspicionthreatened with a knifedirectorial debuttrustfalling down stairssabotagerevelationhead buttelectronic music scorehypodermic needlecatfightmutantjoggingcooksecurity camerabeardkicked in the stomachpsychologistcompassionfemale killerandroidpresumed deadstealing a carblood on facefight to the deathstabbed in the neckevacuationpunched in the chestaerial shotdeerstabbed in the eyefemale doctorpiertied feetcorporationmutationcharacters killed one by onekilling spreeclonestick fightmoral dilemmasouthern accentimprisonmentclose up of eyesfemale assassinforename as titlefinal showdownpistol whipsuper strengtheuthanasiaabandoned houseyoung version of characterbunkerstabbed in the armclimbing through a windowhired killergenetic engineeringmercy killingwoman kills a mandeath of boyfriendexperiment gone wrongfilmed killinghigh techmysterious womangeneticsdistrustcloningimprovised weaponunwanted kisslocked in a roombroken necksolitary confinementscience runs amokbilingualisminnocent person killedsurveillance footagebitten in the throatwoman's neck brokendeoxyribonucleic acidcorporate executivebritish actor playing american charactermanor househumanoidvideo recordingtranquilizer dartsuper soldierhybridlethal injectionscience experimentsecret laboratoryhunting rifleprototypehead held underwaterresearch facilitysmothered to deathhooded sweatshirttranquilizer gunstabbed with a pencar crashing into a treebloody hand printkilling a deerbehavioristmutant humanbody in waterstrapped to a bedwoman kills a womanrisk management (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
| Subgenre: | cult filmindependent filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror |
| Themes: | insanitydeathmurderfriendshiprevengedrinkingfeardrunkennessescapebrutalityparanoiaguiltillnessunrequited lovehome invasion …exploitationpanicpolice brutalityhuntingcamping (See All) |
| Mood: | raingorecar chaseambiguous ending |
| Locations: | lakehospitalforestbathtubbicyclewaterwoodsfarmtruckcavegas stationcampfirebackwoodsshed |
| Characters: | doctorfather son relationshippoliceafrican americanboyfriend girlfriend relationshippolice officersheriffself mutilationhomeless mankiller dog |
| Period: | 2000s |
| Story: | person on firedouble barreled shotguntorso cut in halfsevered leganimal attacktorchburned alivefireplacesevered armsevered headtied to a chairimpalementfoot chasedecapitationhallucination …held at gunpointrifleshot in the chestblood splattercorpsefirepistolsurprise endingflashbackdogbloodfemale nudityviolencefemale frontal nuditymasturbationbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifechasepantiesshowercell phonewoman on topbeatingshot to deathhorsecar accidenturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingbeerdead bodylow budget filmmarijuanarevolverguitarshot in the backf wordswimmingcleavagesurvivalgay slurambushaxemassacreambulancedeath of friendstabbed to deathstabbed in the chestbrunettefalse accusationscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousepeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchcharacters killed one by oneflat tiresouthern accentwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirrelaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
Barney Ross leads the "Expendables", a band of highly skilled mercenaries including knife enthusiast Lee Christmas, martial arts expert Yin Yang, heavy weapons specialist Hale Caesar, demolitionist Toll Road and loose-cannon sniper Gunner Jensen. When the group is commissioned by the mysterious Mr. …Church to assassinate the merciless dictator of a small South American island, Barney and Lee head to the remote locale to scout out their opposition. Once there, they meet with local rebel Sandra and discover the true nature of the conflict engulfing the city. When they escape the island and Sandra stays behind, Ross must choose to either walk away and save his own life - or attempt a suicidal rescue mission that might just save his soul. (Read More)
| Subgenre: | cult filmindependent filmmartial arts |
| Themes: | torturemurderrevengekidnappingdrugsbetrayalescapecorruptionpsychopathdeath of fatherwrestlingredemptionguiltsurveillanceexecution …affairforgivenessregret (See All) |
| Mood: | gorecar chase |
| Locations: | restaurantchurchswimming poolhelicoptermotorcycleairplaneshiptruckwater torture |
| Characters: | father daughter relationshiptattoosoldierhostagetough guyaction herosnipersniper rifletattoo artist |
| Story: | straight razorperson on firehorse drawn carriageknocked out with a gun buttimmolationtorso cut in halfgash in the faceburned alivesubtitled scenereference to william shakespeareshot in the shoulderscartentstatuecharacter repeating someone else's dialogue …severed headtied to a chairthroat slittingimpalementdecapitationheld at gunpointshot in the chestblood splatterfirepistolsurprise endingbloodviolencebare chested malefightcigarette smokingexplosionknifechaseshootoutbeatingshot to deathmachine gunhorsecar accidentshot in the headshotgunrescuepunched in the facebattleswordgunfightfalling from heightpaintingvomitingshowdownhand to hand combatbombcar crashinterrogationislandguitarshot in the backf wordflashlightassassinbound and gaggedcandlestrangulationmassacrevideo camerabasketballbridgearmystabbed to deathmixed martial artsstabbed in the chestexploding carapologyanti herofictional warcigar smokingshot in the legbeaten to deathstabbed in the backuniformwritten and directed by cast membermissionevil mankicked in the faceringscene during end creditsfarmerdirected by starbodyguardexploding bodylaptopneck breakingdie hard scenariofirst partthreatened with a knifemercenaryblindfoldshot in the armgeneralciagaragehenchmanak 47machismomissileropepiratetraitoruzigrenadeassassination attemptmachetesociopathscene during opening creditscowboy hatsecurity camerajail cellexploding buildingkicked in the stomachnosebleedsevered handlaserrocket launchermexican standoffransompassportdamsel in distressreverse footagecameoface painttarget practiceexplosivestabbed in the throathit in the crotchpool tablestabbed in the necknew orleans louisianapunched in the stomachshot in the facedeath threattitle appears in writingensemble castspecial forcesexploding headtitle at the endundercover agentbulletproof vestknife throwinggasolinepierbody countlens flarefieldrescue missionbruiselasersightdictatorexploding helicopterpipe smokingpalacesouthern accentheroismcia agentdockhead blown offfireballarms dealernight visionstabbed in the armfemale spyexploding truckone linerbaseball capman punching a womanrazor bladekicked in the headstabbed in the shoulderdrive by shootingteamworkbladespeedboatrighteous ragerogue agentbutt slapdeformityabusive boyfriendportcockney accentflare gunarmy basebullet proof vestknife in the chestfictional countryinterpolseaplanebasketball courtmale camaraderiefire fighttied to a tablesuitcase of moneypunched in the crotchtattoo parlorshaky camgas grenadebeer bottleshot in the kneelogowaterboardinghuman shieldsomaliarubyblown to piecesthrowing a knifed box motion codedart boardopen air marketlimericksecret hideoutspanish accentstrafingdriving a car without a doorfruit standwoman hostageducati motorcyclegeneral's daughterweapon expertwoman being tortured (See All) |
Every seven years in an unsuspecting town, The Tournament takes place. A battle royale between 30 of the world's deadliest assassins. The last man standing receiving the $10,000,000 cash prize and the title of Worlds No 1, which itself carries the legendary million dollar a bullet price tag.
| Subgenre: | martial artsblack comedy |
| Themes: | torturesuicidedeathmurderrevengemoneypregnancydrinkingdrunkennessescapedeceptionpsychopathredemptionguiltgambling …sadismsurveillanceexecutiondeath of wifevengeanceself sacrificemurder of an innocent person (See All) |
| Mood: | raingorecar chasenightone nightmurder suicide |
| Locations: | rooftopbartrainchurchhotelmotorcyclesmall townbusfarmpolice carenglandtruckstrip clubgas stationbrazil …train stationbus driverwater tortureshootout in a church (See All) |
| Characters: | priesthitmanasianalcoholicsniperrussianchineseamerican abroadsniper rifleself mutilationrussian soldierformer soldierself surgeryalcoholic priest |
| Story: | breaking a mirrorlooking at oneself in a mirrorperson on firerunning across a roofloading a gunknocked out with a gun buttjumping through a windowthrown through a windowgash in the facecrushed to deathstrong female leadstrong female charactershot in the shoulderscarno opening credits …held at gunpointrifleshot in the chestblood splattercorpsefirepistolsurprise endingtwo word titleflashbackblooddogfemale nudityviolencefightcigarette smokingtitle spoken by characterexplosionknifechaseshowertelephone callvoice over narrationcell phoneshootoutshot to deathfistfightmachine guncar accidentface slapshot in the headshotgunslow motion scenepunched in the facecomputercar crashdead bodycafebathroomhandcuffsprayerrevolvercompetitionalcoholcombatstrippershot in the backf wordsurvivalassassincandlestrangulationmassacrevideo camerastabbingmontagetoiletstabbed in the chestexploding carapologyfemme fatalenews reportcigar smokingshot in the legdrowningcoffeeshot in the foreheadbartenderconfessionlimousinehotel roombeaten to deathstabbed in the backprologuechampagneproduct placementrace against timeevil manknocked outkicked in the facemanipulationmartial artistcontestexploding bodyneck breakingsuspiciontied upchampionthreatened with a knifeshot in the armsilencerobscene finger gesturepubmaniacak 47machismotv newsuzianswering machinehand grenadegrenadedestructionbulletkilling an animalassassination attemptmass murdershot in the stomachred dresssecurity cameracrucifixnosebleedasian womanphone boothjumping from heightsevered handcovered in bloodclubirishsheepfaked deathparking garagetournamentdead womanmexican standoffwhiskeydivingstealing a carsurveillance camerasevered fingerfight to the deathmillionaireconvenience storegunshot woundkicked in the crotchmiami floridacigarette lighterspecial forcesstabbed in the leghit on the headexploding headblood on shirtwedding ringdisfigurementbody landing on a carraised middle fingerbettrailerdead woman with eyes openlasersightdrugged drinktracking devicedead dogclose up of eyesfemale assassinman cryingimpersonating a police officershot through a windowsermonbazookablood on camera lenssuffocationprayingsaving a lifetablegun in mouthspit in the facekilling a dogfemale fighterhead blown offtelephone boothremorselecturelighterparkourtexanstandoffstabbed in the armponytailbroken mirrorprizeburnt faceexploding trucksawed off shotguncrashing through a windowfemale martial artistepiloguesunrisefinger cut offkimonosleeping in a carhijackingcontract killerfilmed killingmurder of wifecountdownbettingrighteous ragewoman fights a manjumpingslaughterhouseman on firefrenchmanpole dancerpool of bloodtrapdoorcar rollovermurder of a nude womandriving at nightanti heroinecctvgreat britainpole dancingfreewaynews footageknife held to throatdead woman on floorwhite coatjumpwoman's neck brokenmoney falling through the airgarroteman fights a womanwoman shot in the foreheadmicrowavemost dangerous gamesuitcase of moneytime limitdouble decker buskicked in the chestnunchuckspersonal growthdawnfragments of glasshit by a busroom servicespit takekilled in an elevatorstabbed in the bellygame of deathplayerhands tied behind backliverpudlianhit with a rifle buttchinese womanmanic laughterpeepholeclappingprofessional hitmurder of a pregnant womantoilet bowlsign of the crossmeat hookabandoned churchblood on wallwoman murders a manhunting knifecontract killinghead held underwaterblood on clotheslast man standingfree runningtanker truckman murders a womanface woundshooting a womanexploding trailerstrip barshot through the floormurder of a womanwoman murders a womanfemale sniperwoman wearing a g stringsaved at the last secondstanding on a tablegame of survivalthrown out of a bargenuflectingjumping on a moving vehicleknife held to someone's throatsaved from drowningsetting someone on firebreaking an armthrown through glassdetectordisguised as a priestinjured womanjump from bridgesuffocated with a plastic bagcar flying through the airdifficulty walkingshooting out a car windowbasement parkingdesecrating a churchforced vomitingfree runnerreplayslashed in the cheekwoman wearing a hat (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com