Best popular movies like Universal Soldier: Regeneration:

Do you need specific genre & keyword selection to find films similar to Universal Soldier: Regeneration?
<< FIND THEM HERE! >>

Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Universal Soldier: Regeneration (2009)

With stolen top-secret technology, terrorists have created a next-generation Universal Soldier - an elite fighter genetically altered into a programmable killing machine. With this "UniSol" (Former UFC Heavyweight Champion Andrei "The Pit Bull" Arlovski) leading the way, they seize the crippled Cher β€¦nobyl nuclear reactor, threatening to unleash a lethal radioactive cloud. The only one who can stop them is Luc Deveraux (Jean-Claude Van Damme), a UniSol who's been decommissioned for years. Reactivated and retrained, Deveraux must make a full-out assault on the heavily armed fortress. But inside, he'll discover not one but two of these virtually indestructible warriors. Andrew Scott (Dolph Lundgren), Deveraux's vicious UniSol enemy from the original Universal Soldier, has been secretly reanimated and upgraded. Now, these elite fighters are locked, loaded and programmed to kill; and the fate of millions hinges on this high-action showdown. (Read More)

Subgenre:
videosuspensecult filmmartial arts
Themes:
ghost townmurder of a police officerself sacrificeamnesiahome invasionsurveillanceterrorismmilitaryheroescapekidnappingsuicidemurderdeathrevenge
Mood:
car chasearchive footagegore
Locations:
museumpolice carsnowhelicopterrestaurant
Characters:
action heropolice chaseshooting a police officerself mutilationtough guyhostagepolice officersoldierbrother sister relationshipdoctormother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship
Period:
2000s1960s
Story:
surveillance footageautomatic weaponmad scientistblood on camera lenssoldier shotsoldier killedsuper soldierdead soldieranti herofoot chaseguerrilla armybleeding mouthrorschach inkblotbody slamcrashing through a wall β€¦prosthetic armchernobyl ukrainemeltdownflipping carsmoke grenadeinhumanityantennanuclear reactortransmitterknocked out with a gun buttstabbed in the crotchbattering rampower plantinsubordinationcoming out of retirementshot through a wallcircular sawsuperhumaninvulnerabilitynuclear threatstrong mankicking in a doorcryogenicsshot in the crotchhooksecret missionhuman experimentgun dueltreadmillapprenticestabbed in the faceoverturning carfilmed killingkicked in the headbladeoperationcrashing through a windowhijackinggenetic engineeringvirginiarehabilitationrecoverybullet balletpolice officer shot in the chestcommandersuper strengthreturning character killed offhead blown offvillain played by lead actortimebombshot through a windowprime ministerfight to the deathfifth partclonebody countstabbed in the eyebulletproof vesteye gougingjumping through a windowstabbed in the legstabbed in the headdynamitepunched in the stomachshot in the facegash in the facestabbed in the throatgun battlegun fuu.s. armytarget practiceexplosivegas maskback from the deadkickboxingcyborgcolonelmind controljumping from heightpsychologistkicked in the stomachlifting someone into the airhypodermic needlehead buttfalling down stairshand grenadecaptainuzimachismosubtitled scenesevered armsilencergeneralcabinmercenaryneck breakingexploding bodyshot in the shoulderinjectionlong takekicked in the facerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadtrainingshot in the legchild in perilhit by a carpart of seriesone man armyweaponstabbed in the chestmixed martial artsthroat slittingimpalementmontagewomanmassacrestrangulationterroristgood versus evilshot in the backscientistbritishcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malegunsequeldogbloodfightviolence (See All)

Hardcore Henry (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hardcore Henry (2015)

Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo β€¦u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)

Subgenre:
suspensemartial arts
Themes:
self sacrificeamnesiahome invasionsurveillanceterrorismescapekidnappingrevengemurderdeath
Mood:
car chasegore
Locations:
police carhelicopter
Characters:
action heropolice chaseself mutilationtough guyhostagesoldierdoctorhusband wife relationship
Story:
mad scientistblood on camera lenssuper soldieranti herofoot chaseprosthetic armknocked out with a gun buttshot through a wallinvulnerabilitycryogenicsstabbed in the facecrashing through a windowsuper strengthhead blown offshot through a window β€¦fight to the deathclonebody countstabbed in the eyebulletproof vesteye gougingjumping through a windowstabbed in the legstabbed in the headshot in the facestabbed in the throatgun battlegun fuback from the deadcyborgmind controljumping from heightkicked in the stomachhead butthand grenadeuzimachismosubtitled scenesevered armsilencermercenaryneck breakingexploding bodyshot in the shoulderlong takekicked in the facebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the leghit by a carone man armystabbed in the chestmixed martial artsthroat slittingimpalementmontagemassacrestrangulationterroristgood versus evilshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malebloodfightgunviolencedog (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Olympus Has Fallen (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Olympus Has Fallen (2013)

When the White House (Secret Service Code: "Olympus") is captured by a terrorist mastermind and the President is kidnapped, disgraced former Presidential Secret Service Agent Mike Banning finds himself trapped within the building. As our national security team scrambles to respond, they are forced t β€¦o rely on Banning's inside knowledge to help retake the White House, save the President and avert an even bigger disaster. (Read More)

Subgenre:
martial arts
Themes:
murder of a police officersurveillanceterrorismmilitaryescapekidnappingmurderdeath
Mood:
gore
Locations:
snowhelicopter
Characters:
action heroshooting a police officertough guyhostagesoldierhusband wife relationshipfather son relationship
Story:
automatic weaponanti herofoot chaseshot through a wallnuclear threatfilmed killingpolice officer shot in the chestshot through a windowprime ministerbody countbulletproof veststabbed in the legstabbed in the headpunched in the stomachgash in the face β€¦u.s. armygas maskfalling down stairshand grenadeuzimachismosubtitled scenesevered armsilencergeneralmercenaryneck breakingexploding bodyshot in the shoulderrace against timebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the legchild in perilone man armystabbed in the chestmixed martial artsthroat slittingmassacrestrangulationterroristshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolchaseknifeexplosioncigarette smokingbare chested malefightbloodviolence (See All)

John Wick: Chapter 2 (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

John Wick: Chapter 2 (2017)

Subgenre:
suspensemartial arts
Themes:
escapesuicidedeathrevengemurder
Mood:
car chasegore
Locations:
restaurant
Characters:
action heroself mutilationtough guypolice officerbrother sister relationship
Story:
blood on camera lensanti herofoot chasestabbed in the crotchcoming out of retirementshot through a wallgun duelcrashing through a windowbullet balletshot through a windowfight to the deathbody countbulletproof veststabbed in the legstabbed in the head β€¦shot in the facestabbed in the throatgun futarget practicekicked in the stomachfalling down stairsmachismosubtitled scenesilencerneck breakingshot in the shoulderlong takekicked in the facestabbed in the backone against manyshot in the foreheadshot in the leghit by a carone man armystabbed in the chestmixed martial artsthroat slittingmontagemassacrestrangulationshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion sceneshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingfightgundogviolencesequelblood (See All)

American Assassin (2017) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American Assassin (2017)

Twenty three-year-old Mitch lost his parents to a tragic car accident at the age of fourteen, and his girlfriend to a terrorist attack just as they were engaged. Seeking revenge, he is enlisted by CIA Deputy Director Irene Kennedy as a black ops recruit. Kennedy then assigns Cold War veteran Stan Hu β€¦rley to train Mitch. Together they will later on investigate a wave of apparently random attacks on military and civilian targets. The discovery of a pattern in the violence leads them to a joint mission with a lethal Turkish agent to stop a mysterious operative intent on starting a world war in the Middle East. (Read More)

Subgenre:
suspensemartial arts
Themes:
surveillanceterrorismmilitaryescapekidnappingsuicidedeathrevengemurder
Mood:
car chasegore
Locations:
helicopterrestaurant
Characters:
action herotough guyhostagepolice officersoldierdoctor
Story:
surveillance footageblood on camera lensanti herofoot chaseknocked out with a gun buttinsubordinationnuclear threatfilmed killingvirginiacommandertimebombfight to the deathbody counteye gougingjumping through a window β€¦stabbed in the legshot in the facestabbed in the throatgun battletarget practicegas maskkickboxingkicked in the stomachuzimachismosubtitled scenesilencergeneralmercenaryshot in the shoulderlong takerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadtrainingshot in the leghit by a carone man armystabbed in the chestmixed martial artsmontagemassacrestrangulationterroristshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malefightviolenceblooddog (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Universal Soldier (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Universal Soldier (1992)

An elite team of soldiers has been used against terrorists where they use astounding physical capabilities to overcome them. Victoria, a reporter, follows them and discovers a part of their secret. When one of the team kills her cameraman she tries to escape. Luc, one of the soldiers begins to have  β€¦flashbacks and turns sides and helps her as the remainder of the team follows to protect their secrets. (Read More)

Subgenre:
cult filmmartial arts
Themes:
amnesiaterrorismmilitaryheroescapekidnappingdeathmurder
Mood:
car chasegore
Locations:
helicopter
Characters:
action herotough guyhostagesoldier
Period:
1960s
Story:
super soldierstrong mangun duelbullet balletsuper strengthvillain played by lead actorfight to the deatheye gouginggun battlegun fuu.s. armyback from the deadkickboxingcyborgcolonel β€¦head butthand grenademachismosilencermercenaryneck breakingexploding bodybeaten to deathone against manyshot in the foreheadone man armymixed martial artsthroat slittingimpalementmassacrestrangulationgood versus evilscientisthand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightslow motion scenerescuemachine gunblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malebloodgunviolencefight (See All)

Die Hard 2 (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Die Hard 2 (1990)

After the terrifying events in LA, John McClane (Willis) is about to go through it all again. A team of terrorists, led by Col. Stuart (Sadler) is holding the entire airport hostage. The terrorists are planning to rescue a drug lord from justice. In order to do so, they have seized control of all el β€¦ectrical equipment affecting all planes. With no runway lights available, all aircraft have to remain in the air, with fuel running low, McClane will need to be fast. (Read More)

Subgenre:
suspensecult filmmartial arts
Themes:
terrorismmilitaryheroescapedeathmurder
Mood:
gore
Locations:
snowhelicopter
Characters:
action herotough guyhostagepolice officersoldierhusband wife relationship
Story:
soldier killedanti heroantennagun duelhijackingbullet balletpolice officer shot in the chestfight to the deathstabbed in the eyebulletproof vestgash in the facegun fuexplosivecolonelkicked in the stomach β€¦hand grenademachismosilencergeneralmercenarykicked in the facerace against timebeaten to deathone against manyshot in the foreheadpart of seriesone man armyweaponmixed martial artsthroat slittingmassacrestrangulationterroristshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutpistolchaseknifeexplosioncigarette smokingsequelgunfightbloodviolence (See All)

Underworld: Awakening (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underworld: Awakening (2012)

Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th β€¦e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)

Subgenre:
martial arts
Themes:
home invasionsurveillanceescapekidnappingrevengemurderdeath
Mood:
gore
Locations:
helicopter
Characters:
self mutilationhostagedoctormother daughter relationshipfather son relationship
Story:
anti herocryogenicsstabbed in the facegenetic engineeringsuper strengthstabbed in the eyejumping through a windowstabbed in the legstabbed in the headshot in the facestabbed in the throatgun fuexplosiveback from the deadjumping from height β€¦kicked in the stomachhypodermic needlehand grenadesevered armmercenaryneck breakingexploding bodyshot in the shoulderinjectionkicked in the facebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the legchild in perilhit by a carstabbed in the chestmixed martial artsthroat slittingimpalementmassacrestrangulationgood versus evilshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the facerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested malebloodviolencesequel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Resident Evil: Retribution (2012) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Resident Evil: Retribution (2012)

Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo β€¦rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)

Subgenre:
martial arts
Themes:
self sacrificesurveillancemilitaryescapekidnappingmurderdeathrevenge
Mood:
car chasegore
Locations:
snowhelicopter
Characters:
action herotough guyhostagesoldier
Story:
blood on camera lensfoot chaseinvulnerabilityfilmed killinggenetic engineeringsuper strengthreturning character killed offtimebombfifth partclonebulletproof vestshot in the facegun fuexplosivegas mask β€¦mind controlkicked in the stomachhypodermic needlehand grenademercenaryexploding bodyshot in the shoulderinjectionkicked in the facerace against timeone against manyshot in the foreheadshot in the legchild in perilhit by a carpart of seriesmixed martial artsimpalementstrangulationshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosionbloodsequelviolencefight (See All)

Underworld: Blood Wars (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underworld: Blood Wars (2016)

The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles β€¦ Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)

Subgenre:
martial arts
Themes:
self sacrificesurveillanceescapemurderdeath
Mood:
gore
Locations:
snow
Characters:
action herotough guyhostagesoldierfather son relationship
Story:
surveillance footageknocked out with a gun buttstabbed in the facesuper strengthreturning character killed offfight to the deathfifth partstabbed in the eyejumping through a windowstabbed in the legstabbed in the headshot in the facestabbed in the throatgun futarget practice β€¦explosiveback from the deadjumping from heightkicked in the stomachhypodermic needlefalling down stairsuzisevered armneck breakingshot in the shoulderinjectionkicked in the facebeaten to deathstabbed in the backone against manyshot in the foreheadtrainingshot in the legstabbed in the chestmixed martial artsthroat slittingimpalementmassacrestrangulationshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested malebloodviolencefightsequel (See All)

Brick Mansions (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brick Mansions (2014)

Subgenre:
martial arts
Themes:
home invasionsurveillancemilitaryescapekidnappingrevengemurderdeath
Mood:
car chase
Locations:
restaurant
Characters:
action heropolice chasetough guyhostagesoldier
Story:
anti herofoot chasebattering ramnuclear threatstrong mankicking in a doorcrashing through a windowtimebombshot through a windowjumping through a windowu.s. armyjumping from heightkicked in the stomachhead butthand grenade β€¦uzimachismosilencermercenarykicked in the facerace against timebeaten to deathone against manyone man armymixed martial artscar crashhand to hand combatheld at gunpointfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headmachine guncar accidentfistfightshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested maleviolencefight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Logan (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Logan (2017)

In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra β€¦nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)

Subgenre:
suspensemartial arts
Themes:
self sacrificehome invasionescapekidnappingmurderrevengedeath
Mood:
car chasegore
Locations:
police carhelicopter
Characters:
action heroself mutilationtough guyhostagesoldierdoctorhusband wife relationshipfather son relationshipmother son relationship
Story:
mad scientistblood on camera lenssuper soldieranti herofoot chaseknocked out with a gun buttinvulnerabilitystabbed in the faceoverturning carfilmed killinggenetic engineeringsuper strengthreturning character killed offhead blown offshot through a window β€¦fight to the deathclonebody countstabbed in the eyebulletproof veststabbed in the legstabbed in the headshot in the facestabbed in the throatcyborgmind controlkicked in the stomachhypodermic needlehand grenadesubtitled scenesevered armmercenaryneck breakingexploding bodyshot in the shoulderinjectionlong takekicked in the facerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the legchild in perilhit by a carone man armystabbed in the chestmixed martial artsthroat slittingimpalementmontagemassacrestrangulationshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionbare chested malefightgunsequelviolenceblooddog (See All)

Morgan (2016) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Morgan (2016)

Subgenre:
suspensemartial arts
Themes:
surveillanceescapekidnappingsuicidemurderrevengedeath
Mood:
car chase
Characters:
hostagedoctor
Story:
surveillance footagesuper soldierfoot chasefilmed killinggenetic engineeringsuper strengthfight to the deathclonestabbed in the eyegash in the facepsychologistkicked in the stomachhypodermic needlehead buttfalling down stairs β€¦subtitled sceneneck breakingshot in the shoulderinjectionkicked in the facebeaten to deathstabbed in the backshot in the foreheadstabbed in the chestmixed martial artsimpalementstrangulationshot in the backscientisthand to hand combatheld at gunpointshowdownbrawlcamerapunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightcorpsepistolsurprise endingchaseknifebare chested malefightviolenceblood (See All)

New Police Story (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

New Police Story (2004)

Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing,  β€¦to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)

Subgenre:
cult filmmartial arts
Themes:
murder of a police officerself sacrificesurveillanceheroescapekidnappingrevengemurderdeath
Mood:
car chase
Locations:
police carhelicopter
Characters:
action heropolice chaseself mutilationtough guyhostagepolice officerbrother sister relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship
Period:
2000s
Story:
surveillance footageanti herofoot chaseoverturning carfilmed killingtimebombshot through a windowfifth partbulletproof vestjumping through a windowtarget practiceexplosivejumping from heightkicked in the stomachhead butt β€¦falling down stairshand grenadeuzishot in the shoulderkicked in the facerace against timebeaten to deathone against manyshot in the foreheadtrainingshot in the legone man armymixed martial artsmontagemassacrestrangulationgood versus evilshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseexplosionbare chested maleviolencebloodsequelfight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hitman: Agent 47 (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hitman: Agent 47 (2015)

HITMAN: AGENT 47 centers on an elite assassin who was genetically engineered from conception to be the perfect killing machine, and is known only by the last two digits on the barcode tattooed on the back of his neck. He is the culmination of decades of research and forty-six earlier Agent clones -- β€¦ endowing him with unprecedented strength, speed, stamina and intelligence. His latest target is a mega-corporation that plans to unlock the secret of Agent 47's past to create an army of killers whose powers surpass even his own. Teaming up with a young woman who may hold the secret to overcoming their powerful and clandestine enemies, 47 confronts stunning revelations about his own origins and squares off in an epic battle with his deadliest foe. (Read More)

Themes:
surveillanceescapekidnappingsuicidedeathrevengemurder
Mood:
car chasegore
Locations:
helicopter
Characters:
action herotough guyhostagedoctorfather daughter relationship
Story:
mad scientistblood on camera lenssuper soldieranti herofoot chaseinvulnerabilityhuman experimentoverturning carcrashing through a windowgenetic engineeringsuper strengthshot through a windowclonejumping through a windowshot in the face β€¦kicked in the stomachhypodermic needlehead buttfalling down stairsuzisilencermercenaryneck breakingexploding bodyshot in the shoulderinjectionkicked in the facerace against timeone against manyshot in the foreheadshot in the leghit by a carone man armystabbed in the chestmixed martial artsimpalementwomanstrangulationshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingknifeexplosionviolence (See All)

Resident Evil: The Final Chapter (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Resident Evil: The Final Chapter (2016)

Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather β€¦ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)

Subgenre:
martial arts
Themes:
self sacrificesurveillanceescapekidnappingmurderdeathrevenge
Mood:
gore
Characters:
hostagesoldierdoctorfather daughter relationship
Story:
surveillance footagemad scientistgenetic engineeringcommandersuper strengthreturning character killed offfight to the deathclonestabbed in the eyestabbed in the legshot in the facestabbed in the throatgun fucyborgjumping from height β€¦kicked in the stomachhypodermic needlehead butthand grenadeuzisevered armmercenaryexploding bodyshot in the shoulderkicked in the facerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the legstabbed in the chestmixed martial artsthroat slittingimpalementmassacrestrangulationgood versus evilshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosiondogviolencefightsequelblood (See All)

The Dark Knight Rises (2012) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dark Knight Rises (2012)

Despite his tarnished reputation after the events of The Dark Knight, in which he took the rap for Dent's crimes, Batman feels compelled to intervene to assist the city and its police force which is struggling to cope with Bane's plans to destroy the city.

Subgenre:
suspensecult filmmartial arts
Themes:
murder of a police officerself sacrificehome invasionsurveillanceterrorismmilitaryescapekidnappingsuicidemurderdeathrevenge
Locations:
snowhelicopter
Characters:
action heropolice chaseshooting a police officertough guyhostagepolice officersoldierdoctor
Story:
anti herofoot chaseknocked out with a gun buttcoming out of retirementnuclear threatstrong manfilmed killingcrashing through a windowrecoverypolice officer shot in the chestsuper strengthreturning character killed offtimebombfight to the deathbulletproof vest β€¦jumping through a windowu.s. armyexplosivegas maskjumping from heightkicked in the stomachhypodermic needlehead butthand grenadecaptainuzimercenaryneck breakingexploding bodyinjectionkicked in the facerace against timebeaten to deathstabbed in the backone against manytrainingshot in the legchild in perilone man armystabbed in the chestmixed martial artsimpalementmassacrestrangulationterroristgood versus evilshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the facerescueshot in the chestmachine guncar accidentfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested malefightsequel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Captain America: The Winter Soldier (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Captain America: The Winter Soldier (2014)

For Steve Rogers, awakening after decades of suspended animation involves more than catching up on pop culture; it also means that this old school idealist must face a world of subtler threats and difficult moral complexities. That becomes clear when Director Nick Fury is killed by the mysterious as β€¦sassin, the Winter Soldier, but not before warning Rogers that SHIELD has been subverted by its enemies. When Rogers acts on Fury's warning to trust no one there, he is branded as a traitor by the organization. Now a fugitive, Captain America must get to the bottom of this deadly mystery with the help of the Black Widow and his new friend, The Falcon. However, the battle will be costly for the Sentinel of Liberty, with Rogers finding enemies where he least expects them while learning that the Winter Soldier looks disturbingly familiar. (Read More)

Subgenre:
suspensemartial arts
Themes:
amnesiasurveillanceterrorismkidnappingmurderdeath
Mood:
car chasearchive footage
Locations:
museumhelicopter
Characters:
action herotough guyhostagepolice officersoldier
Story:
super soldierfoot chaseprosthetic armflipping carbattering ramcoming out of retirementshot through a walloverturning carcrashing through a windowgenetic engineeringsuper strengthreturning character killed offshot through a windowbulletproof vestjumping through a window β€¦gun fuback from the deadcyborgmind controljumping from heightkicked in the stomachhead butthand grenadecaptainuzisubtitled scenesilencermercenaryshot in the shoulderkicked in the facerace against timebeaten to deathone against manyhit by a carone man armystabbed in the chestmixed martial artsterroristgood versus evilshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosionbare chested malesequelbloodviolencefight (See All)

Batman V Superman: Dawn Of Justice (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Batman V Superman: Dawn Of Justice (2016)

The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi β€¦nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)

Subgenre:
suspensemartial arts
Themes:
self sacrificesurveillanceterrorismmilitaryescapekidnappingrevengedeathmurder
Mood:
car chase
Locations:
museumsnowhelicopter
Characters:
action heroself mutilationtough guyhostagepolice officersoldiermother son relationshipfather son relationship
Story:
surveillance footagemad scientistanti heroknocked out with a gun buttinvulnerabilityfilmed killingcrashing through a windowgenetic engineeringsuper strengthreturning character killed offfight to the deathbulletproof vestjumping through a windowshot in the faceu.s. army β€¦explosivecyborgjumping from heightkicked in the stomachhead butthand grenadesubtitled scenesevered armsilencergeneralmercenaryexploding bodylong takekicked in the facerace against timebeaten to deathstabbed in the backone against manytrainingchild in perilhit by a carone man armystabbed in the chestimpalementmontagemassacrestrangulationterroristgood versus evilscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpseshootoutpistolsurprise endingknifeexplosionbare chested malesequelviolencebloodfight (See All)

Machete Kills (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Machete Kills (2013)

During an operation of a Mexican Cartel, Machete Cortez and Sartana Rivera intercept the criminals alone, but another group arrives and a masked man kills Sartana. Machete is arrested, accused of killing his beloved Sartana and Sheriff Doakes hangs Machete. But the President of the USA Rathcock pard β€¦ons and recruits Machete to kill the revolutionary Marcos Mendez that has threatened the USA with a missile with a bomb. Machete goes to San Antonio to meet the Miss San Antonio Blanca Vasquez that will be the liaison between Machete and President Rathcock. Then Machete goes to the brothel of Madame Desdemona to seek out the prostitute Cereza that is Mendez's mistress. Machete meets Mendez and learns that his heart is connected to the missile and only the arm dealer Luther Voz is capable to disarm the bomb. Now Machete needs to bring Mendez to the USA in less than twenty-four hours and save his new country in a dangerous journey with betrayals. (Read More)

Subgenre:
martial arts
Themes:
self sacrificesurveillanceterrorismescapekidnappingmurderrevengedeath
Mood:
car chasegore
Locations:
helicopter
Characters:
action herotough guyhostagesoldierdoctormother daughter relationship
Story:
blood on camera lenssuper soldieranti herofoot chasenuclear threatoperationgenetic engineeringsuper strengthreturning character killed offtimebombfight to the deathclonebody countjumping through a windowstabbed in the head β€¦stabbed in the throatjumping from heighthead buttuzisubtitled scenesevered armsilencermercenaryneck breakingexploding bodyshot in the shoulderrace against timestabbed in the backone against manyshot in the foreheadshot in the legone man armystabbed in the chestmixed martial artsthroat slittingimpalementmassacreterroristshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosionbare chested maleviolencefightsequelblood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Exit Wounds (2001) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Exit Wounds (2001)

Orin Boyd (Seagal) is a Detroit cop who doesn't follow rules. After he saved the Vice President by violating every order he received he is transferred to one of the worst precincts in the city. There he quickly encounters some corrupt cops selling heroin to drug dealers. The problem is, it's very di β€¦fficult to tell who is the bad guy and who you can trust. (Read More)

Subgenre:
martial arts
Themes:
surveillanceterrorismheroescapekidnappingdeathmurder
Mood:
car chasegore
Locations:
police carhelicopterrestaurant
Characters:
action heropolice chasetough guyhostagepolice officer
Period:
2000s
Story:
anti herofoot chaseinsubordinationshot through a windowfight to the deathbulletproof vestjumping through a windowstabbed in the legpunched in the stomachgun fuexplosivekicked in the stomachhypodermic needlehead buttuzi β€¦machismoshot in the shoulderinjectionkicked in the facebeaten to deathshot in the foreheadshot in the leghit by a carone man armyweaponmixed martial artsimpalementwomanterroristshot in the backcar crashhand to hand combatheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathshootoutpistolchaseknifeexplosionviolencefightblood (See All)

The Expendables (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Expendables (2010)

Barney Ross leads the "Expendables", a band of highly skilled mercenaries including knife enthusiast Lee Christmas, martial arts expert Yin Yang, heavy weapons specialist Hale Caesar, demolitionist Toll Road and loose-cannon sniper Gunner Jensen. When the group is commissioned by the mysterious Mr.  β€¦Church to assassinate the merciless dictator of a small South American island, Barney and Lee head to the remote locale to scout out their opposition. Once there, they meet with local rebel Sandra and discover the true nature of the conflict engulfing the city. When they escape the island and Sandra stays behind, Ross must choose to either walk away and save his own life - or attempt a suicidal rescue mission that might just save his soul. (Read More)

Subgenre:
cult filmmartial arts
Themes:
surveillanceescapekidnappingmurderrevenge
Mood:
car chasegore
Locations:
helicopterrestaurant
Characters:
action herotough guyhostagesoldierfather daughter relationship
Story:
anti heroknocked out with a gun buttkicked in the headbladehead blown offbody countbulletproof vestpunched in the stomachshot in the facegash in the facestabbed in the throattarget practiceexplosivekicked in the stomachuzi β€¦machismosubtitled scenegeneralmercenaryneck breakingexploding bodyshot in the shoulderkicked in the facebeaten to deathstabbed in the backshot in the legstabbed in the chestmixed martial artsthroat slittingimpalementmassacrestrangulationshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightgunfightpunched in the facerescueshot in the headshot in the chestmachine guncar accidentblood splattershot to deathshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested maleviolencefightblood (See All)

London Has Fallen (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

London Has Fallen (2016)

After the British Prime Minister has passed away under mysterious circumstances, all leaders of the Western world must attend his funeral. But what starts out as the most protected event on earth, turns into a deadly plot to kill the world's most powerful leaders and unleash a terrifying vision of t β€¦he future. The President of the United States, his formidable secret service head and a British MI-6 agent who trusts no one are the only people that have any hope of stopping it. (Read More)

Themes:
murder of a police officerself sacrificesurveillanceterrorismmilitaryescapekidnappingsuiciderevengemurderdeath
Mood:
car chasegore
Locations:
police carhelicopter
Characters:
action herotough guyhostagesoldiermother daughter relationshiphusband wife relationship
Story:
smoke grenadeshot through a wallreturning character killed offshot through a windowprime ministerstabbed in the eyebulletproof veststabbed in the legstabbed in the throatjumping from heightkicked in the stomachhand grenademachismosubtitled scenegeneral β€¦mercenaryneck breakingexploding bodyshot in the shoulderlong takerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the leghit by a carone man armystabbed in the chestthroat slittingimpalementmassacrestrangulationterroristgood versus evilshot in the backbritishcar crashhand to hand combatheld at gunpointbrawlpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingknifeexplosionsequelviolence (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ninja Assassin (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ninja Assassin (2009)

Trained since childhood to be a lethal killer, Raizo has since turned his back on the Ozunu clan that raised him and now seeks revenge for their heartless murders. Teaming up with Europol investigator Mika, Raizo steadily butchers his enemies while inching ever closer to the long-awaited bloody reun β€¦ion with his former master. (Read More)

Subgenre:
martial arts
Themes:
murder of a police officersurveillanceescaperevengedeathmurder
Mood:
gore
Locations:
police carhelicopter
Characters:
action heroself mutilationtough guypolice officer
Story:
blood on camera lensanti herofoot chasebullet balletfight to the deathstabbed in the legstabbed in the headgash in the facestabbed in the throatgun battlegun fumachismosevered armbeaten to deathstabbed in the back β€¦one against manytraininghit by a carone man armystabbed in the chestmixed martial artsimpalementmassacregood versus evilshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathshootoutpistolchaseexplosioncigarette smokingbare chested malebloodviolencegunfight (See All)

Passenger 57 (1992) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Passenger 57 (1992)

Air travel is the safest, the FAA says. But the FAA never figured the risk with Charles Rane on board. "The Rane of Terror" has masterminded four terrorist attacks. Soon there will be a fifth -- and that's bad news for the passengers on Flight 163. But there's good news too: the man in seat 57! Wesl β€¦ey Snipes plays John Cutter, an undercover security operative who enters the lavatory and exits to find Rane (Bruce Payne) and his gang have taken over. Cutter's next move is clear. Do. Or be done to. (Read More)

Subgenre:
suspensecult filmmartial arts
Themes:
terrorismheroescapekidnappingdeathrevengemurder
Mood:
gore
Locations:
police carhelicopter
Characters:
action herotough guyhostagepolice officer
Story:
anti herofoot chasehijackingfight to the deathjumping through a windowjumping from heightkicked in the stomachhand grenadeuzimachismosilencerneck breakingkicked in the facerace against timebeaten to death β€¦one against manyshot in the foreheadchild in perilone man armymixed martial artsthroat slittingstrangulationterroristgood versus evilshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionfightviolencebloodgun (See All)

Suicide Squad (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Suicide Squad (2016)

It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter β€¦mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)

Subgenre:
martial arts
Themes:
self sacrificesurveillancemilitaryescapekidnappingsuiciderevengemurderdeath
Mood:
car chase
Locations:
snowhelicopterrestaurant
Characters:
action herotough guyhostagesoldierbrother sister relationshipfather daughter relationship
Story:
anti herosecret missionstabbed in the facefilmed killingsuper strengthhead blown offbulletproof vestjumping through a windowstabbed in the headdynamiteu.s. armytarget practiceexplosivemind controlcolonel β€¦jumping from heightkicked in the stomachhypodermic needlehead buttcaptainuzisubtitled scenesilencermercenaryneck breakingexploding bodyinjectionkicked in the facerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadweaponstabbed in the chestmixed martial artsthroat slittingimpalementmontagewomanmassacrestrangulationshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpseshootoutpistolsurprise endingknifeexplosionbare chested malefightviolence (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

G.i. Joe: Retaliation (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

G.i. Joe: Retaliation (2013)

The G.I. Joe team is framed for crimes against the country by Zartan, disguised as the President, and Cobra Commander has all the world leaders under his influence, with their advanced warheads headed towards innocent populaces around the world. Outnumbered and outgunned, the surviving team members  β€¦form a plan with their original leader, General Joseph Colton, to rescue the President and face off Cobra Commander, his accomplices and the world leaders. (Read More)

Subgenre:
martial arts
Themes:
surveillanceterrorismmilitarykidnappingdeathrevengemurder
Locations:
snowhelicopter
Characters:
action heroself mutilationtough guyhostagesoldier
Story:
foot chasecoming out of retirementnuclear threatcryogenicsapprenticevirginiareturning character killed offbulletproof veststabbed in the headgun futarget practiceexplosivejumping from heightkicked in the stomachfalling down stairs β€¦hand grenadeuzisilencergeneralmercenaryexploding bodyinjectionkicked in the facerace against timetraininghit by a carstabbed in the chestmixed martial artsimpalementmassacreterroristgood versus evilshot in the backbritishhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested maleviolencesequelbloodfight (See All)

The Expendables 2 (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Expendables 2 (2012)

Barney Ross is approached by CIA man Church, who wants him and his guns for hire to go to the former Soviet Union to retrieve something that was on a plane that crashed. Church doesn't tell him what he is getting. And Church sends a woman, Maggie with him to make sure he gets it. They find the plane β€¦ and get the thing but some men take one of Barney's people hostage and the leader tells him to give him what they got or he'll kill his hostage. They give it to him but he kills his hostage anyway. Barney asks Maggie what was so important about that thing. She says that it showed the location of a Russian plutonium storage mine. Barney decides to track the man down and deal with him. They track them down and discover that the man they seek is Vilain who leads a group known as The Sangs and that they have taken all the men from the surrounding villages to work the mine. (Read More)

Subgenre:
cult filmmartial arts
Themes:
terrorismdeathmurderrevenge
Mood:
gore
Locations:
helicopter
Characters:
action herotough guyhostagesoldier
Story:
crashing through a wallnuclear threatstabbed in the facecrashing through a windowbullet ballethead blown offshot through a windowbody countbulletproof vestjumping through a windowstabbed in the legstabbed in the headshot in the facegash in the facestabbed in the throat β€¦gun battlegun fuexplosivekicked in the stomachmachismosubtitled scenesevered armmercenaryneck breakingexploding bodyshot in the shoulderkicked in the facebeaten to deathstabbed in the backshot in the foreheadshot in the legone man armystabbed in the chestmixed martial artsthroat slittingimpalementwomanstrangulationterroristgood versus evilshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathshootoutpistolknifeexplosionfightbloodviolencesequelgun (See All)

The Raid: Redemption (2011) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Raid: Redemption (2011)

In Jakarta, Indonesia, Lieutenant Wahyu organizes the invasion of an apartment building that is the safe house of the powerful and cruel drug lord Tama and his gang. The SWAT team breaks in the building but one lookout sees and warns the gangsters and the police force is trapped on the seventh floor β€¦. They learn that Lt. Wahyu has not informed his superiors about the operation. Now the police officers have to fight with limited ammunition against the armed and dangerous gangsters. (Read More)

Subgenre:
suspensecult filmmartial arts
Themes:
murder of a police officersurveillancedeathmurder
Mood:
gore
Characters:
action heroshooting a police officertough guypolice officerhusband wife relationship
Story:
blood on camera lensstabbed in the facefilmed killingkicked in the headoperationpolice officer shot in the chestshot through a windowfight to the deathbody countjumping through a windowstabbed in the legstabbed in the headpunched in the stomachshot in the facesilencer β€¦neck breakingshot in the shoulderlong takebeaten to deathshot in the legone man armystabbed in the chestmixed martial artsthroat slittingimpalementmassacrestrangulationhand to hand combatfalling from heightbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingknifeexplosionbare chested malefightviolenceblood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Fate Of The Furious (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fate Of The Furious (2017)

Now that Dom and Letty are on their honeymoon and Brian and Mia have retired from the game-and the rest of the crew has been exonerated-the globetrotting team has found a semblance of a normal life. But when a mysterious woman seduces Dom into the world of crime he can't seem to escape and a betraya β€¦l of those closest to him, they will face trials that will test them as never before. From the shores of Cuba and the streets of New York City to the icy plains off the arctic Barents Sea, the elite force will crisscross the globe to stop an anarchist from unleashing chaos on the world's stage... and to bring home the man who made them a family. (Read More)

Subgenre:
martial arts
Themes:
surveillanceterrorismescapekidnappingdeathmurderrevenge
Mood:
car chase
Locations:
police carsnowhelicopterrestaurant
Characters:
action heropolice chasetough guyhostagesoldierfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationship
Story:
anti herofoot chaseflipping carknocked out with a gun buttnuclear threatoverturning carcrashing through a windowreturning character killed offfight to the deathbulletproof vestexplosivejumping from heightkicked in the stomachhead buttfalling down stairs β€¦hand grenadesubtitled scenesilencermercenarykicked in the facerace against timebeaten to deathstabbed in the backone against manychild in perilhit by a carone man armystabbed in the chestmixed martial artswomanstrangulationterroristshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested maleviolencefightbloodsequel (See All)

Captain America: Civil War (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Captain America: Civil War (2016)

With many people fearing the actions of super heroes, the government decides to push for the Hero Registration Act, a law that limits a hero's actions. This results in a division in The Avengers. Iron Man stands with this Act, claiming that their actions must be kept in check otherwise cities will c β€¦ontinue to be destroyed, but Captain America feels that saving the world is daring enough and that they cannot rely on the government to protect the world. This escalates into an all-out war between Team Iron Man (Iron Man, Black Panther, Vision, Black Widow, War Machine, and Spider-Man) and Team Captain America (Captain America, Bucky Barnes, Falcon, Scarlet Witch, Hawkeye, and Ant Man) while a new villain emerges. (Read More)

Subgenre:
suspensemartial arts
Themes:
home invasionsurveillanceterrorismescapekidnappingsuicidemurderrevengedeath
Mood:
car chase
Locations:
police carsnowhelicopterrestaurant
Characters:
action heropolice chasetough guyhostagesoldierfather son relationship
Story:
surveillance footagesuper soldierfoot chasecoming out of retirementkicking in a doorcryogenicscrashing through a windowsuper strengthreturning character killed offfight to the deathjumping through a windowexplosivegas maskmind controlcolonel β€¦jumping from heightpsychologistkicked in the stomachhead buttfalling down stairshand grenadecaptainuzisubtitled scenesevered armmercenaryneck breakingexploding bodykicked in the facerace against timebeaten to deathshot in the foreheadtraininghit by a carone man armystabbed in the chestmixed martial artsstrangulationterroristscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested malefightviolencebloodsequel (See All)

The Mummy (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Mummy (2017)

Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.

Subgenre:
martial arts
Themes:
self sacrificesurveillancemilitaryescapekidnappingmurderrevengedeath
Locations:
museumpolice carhelicopter
Characters:
action heroself mutilationtough guyhostagepolice officersoldierdoctor
Story:
mad scientistanti herofoot chaseflipping carfight to the deathbulletproof veststabbed in the leggun battleu.s. armytarget practiceback from the deadmind controlcolonelkicked in the stomachhypodermic needle β€¦hand grenadesubtitled scenemercenaryinjectionrace against timebeaten to deathshot in the legone man armystabbed in the chestmixed martial artsthroat slittingmassacrestrangulationgood versus evilshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested maledogviolencebloodfight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Atomic Blonde (2017) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Atomic Blonde (2017)

The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized β€¦ city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)

Subgenre:
suspensemartial arts
Themes:
home invasionescapekidnappingdeathmurderrevenge
Mood:
car chasegore
Locations:
police carsnowrestaurant
Characters:
police chasehostagepolice officersoldiermother daughter relationshipfather daughter relationshiphusband wife relationship
Story:
blood on camera lensfoot chaseknocked out with a gun buttstabbed in the faceoverturning carfight to the deathstabbed in the legstabbed in the headshot in the facestabbed in the throatjumping from heightkicked in the stomachhead buttfalling down stairssubtitled scene β€¦silencerneck breakinglong takekicked in the facerace against timebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the leghit by a carstabbed in the chestmixed martial artsthroat slittingimpalementmontagewomanmassacrestrangulationshot in the backbritishcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malefightgunviolenceblood (See All)

Kingsman: The Golden Circle (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kingsman: The Golden Circle (2017)

After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ β€¦le'. (Read More)

Subgenre:
martial arts
Themes:
self sacrificeamnesiasurveillanceterrorismescapekidnappingrevengedeathmurder
Mood:
car chasegore
Locations:
police carsnowhelicopter
Characters:
action herotough guyhostagesoldierfather daughter relationshipmother daughter relationshiphusband wife relationship
Story:
surveillance footageanti heroknocked out with a gun buttshot through a wallcryogenicsfilmed killingcrashing through a windowreturning character killed offfight to the deathshot in the facegun fuexplosiveback from the deadkicked in the stomachhypodermic needle β€¦head butthand grenadesubtitled scenesevered armgeneralmercenarycabinneck breakingexploding bodyshot in the shoulderinjectionkicked in the facerace against timebeaten to deathone against manyshot in the foreheadmixed martial artsimpalementmontagestrangulationgood versus evilshot in the backbritishcar crashhand to hand combatheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malefightgundogsequelviolenceblood (See All)

The November Man (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The November Man (2014)

Peter Devereaux is a former CIA agent who is asked by the man he worked for to extract a woman who is in Russia and is presently close to a man running for President, who is believed to have committed crimes during the Chechen war. She can give them the name of someone who can prove it. His friend s β€¦ays that she will only come to him. So he goes and she gets the info and tries to get out but the man finds out and tries to stop her. (Read More)

Subgenre:
martial arts
Themes:
home invasionsurveillancekidnappingmurderdeathrevenge
Mood:
car chase
Locations:
restaurant
Characters:
action herotough guyhostagefather daughter relationship
Period:
2000s
Story:
anti herofoot chasecoming out of retirementvillain played by lead actorshot through a windowbody countstabbed in the legshot in the facegash in the facestabbed in the throatkicked in the stomachhead buttfalling down stairssubtitled scenesilencer β€¦kicked in the faceshot in the foreheadchild in perilhit by a carone man armystabbed in the chestmixed martial artsthroat slittingwomanstrangulationshot in the backcar crashhand to hand combatheld at gunpointfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifebare chested malefightviolenceblood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Good Day To Die Hard (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Good Day To Die Hard (2013)

Iconoclastic, take-no-prisoners cop John McClane, for the first time, finds himself on foreign soil after traveling to Moscow to help his wayward son Jack - unaware that Jack is really a highly-trained CIA operative out to stop a nuclear weapons heist. With the Russian underworld in pursuit, and bat β€¦tling a countdown to war, the two McClanes discover that their opposing methods make them unstoppable heroes. (Read More)

Themes:
surveillanceterrorismescapesuiciderevengemurder
Mood:
car chase
Locations:
helicopter
Characters:
action herotough guypolice officerfather daughter relationshipfather son relationship
Story:
anti herochernobyl ukrainenuclear threatcrashing through a windowshot through a windowfifth partbulletproof vestjumping through a windowstabbed in the legtarget practiceexplosivegas maskjumping from heighthead butthand grenade β€¦subtitled scenemercenaryneck breakingexploding bodyshot in the shouldershot in the legone man armystrangulationterroristshot in the backcar crashheld at gunpointfalling from heightgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splattershot to deathshootoutpistolsurprise endingknifeexplosionbare chested malesequel (See All)

The Last Boy Scout (1991) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last Boy Scout (1991)

A down and out cynical detective teams up with a down and out ex-quarterback to try and solve a murder case involving a pro football team and a politician.

Subgenre:
suspensecult filmmartial arts
Themes:
murder of a police officerself sacrificeheroescapekidnappingsuiciderevengemurderdeath
Mood:
car chasegore
Locations:
helicopter
Characters:
action herotough guyhostagepolice officermother daughter relationshipfather daughter relationshiphusband wife relationship
Story:
anti herokicking in a doorgun dueloverturning carbullet ballethead blown offstabbed in the legshot in the facestabbed in the throatgun battlegun fuexplosivemachismoexploding bodyshot in the shoulder β€¦race against timeone against manyshot in the foreheadshot in the legchild in perilhit by a carone man armymassacreshot in the backcar crashheld at gunpointshowdownfalling from heightbrawlgunfightcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested maledoggunviolencefightblood (See All)

Captain America: The First Avenger (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Captain America: The First Avenger (2011)

It is 1942, America has entered World War II, and sickly but determined Steve Rogers is frustrated at being rejected yet again for military service. Everything changes when Dr. Erskine recruits him for the secret Project Rebirth. Proving his extraordinary courage, wits and conscience, Rogers undergo β€¦es the experiment and his weak body is suddenly enhanced into the maximum human potential. When Dr. Erskine is then immediately assassinated by an agent of Nazi Germany's secret HYDRA research department (headed by Johann Schmidt, a.k.a. the Red Skull), Rogers is left as a unique man who is initially misused as a propaganda mascot; however, when his comrades need him, Rogers goes on a successful adventure that truly makes him Captain America, and his war against Schmidt begins. (Read More)

Subgenre:
martial arts
Themes:
self sacrificesurveillanceterrorismmilitaryheroescapesuicidedeathmurder
Locations:
snowrestaurant
Characters:
action herotough guyhostagesoldierdoctor
Story:
mad scientistsuper soldieranti herofoot chasestrong manhuman experimentsuper strengthtimebombjumping through a windowpunched in the stomachu.s. armykicked in the stomachhead butthand grenadecaptain β€¦generalmercenaryneck breakingexploding bodyshot in the shoulderinjectionkicked in the facerace against timebeaten to deathone against manytrainingshot in the legchild in perilhit by a carone man armymixed martial artsmontagestrangulationterroristgood versus evilshot in the backscientistcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseexplosionbare chested maleviolencebloodfight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

King Arthur: Legend Of The Sword (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
martial arts
Themes:
self sacrificeescapekidnappingdeathrevengemurder
Characters:
action herotough guyhostagesoldierbrother sister relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship
Story:
anti herofoot chasebattering ramkicking in a doorcommandersuper strengthstabbed in the legstabbed in the headshot in the facetarget practiceexplosivemind controljumping from heightkicked in the stomachhead butt β€¦falling down stairscaptainsevered armgeneralexploding bodyshot in the shoulderbeaten to deathstabbed in the backone against manytrainingshot in the legchild in perilone man armystabbed in the chestmixed martial artsthroat slittingimpalementmontagemassacrestrangulationgood versus evilshot in the backbritishhand to hand combatshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsesurprise endingchaseknifeexplosionbare chested maledogfightbloodviolence (See All)

The Brothers Grimsby (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brothers Grimsby (2016)

MI6's top assassin (Mark Strong) has a brother. Unfortunately for him, he's a football hooligan (Sacha Baron Cohen) from the town of Grimsby. Nobby has everything a man from the poor English fishing town of Grimsby could want - 9 children and the most attractive girlfriend in northern England (Rebel β€¦ Wilson). There's only one thing missing in his life: his little brother, Sebastian. After they were adopted by different families as children, Nobby spent 28 years searching for him. Upon hearing of his location, Nobby sets off to reunite with his brother, unaware that not only is his brother an MI6 agent, but he's just uncovered a plot that puts the world in danger. On the run and wrongfully accused, Sebastian realizes that if he is going to save the world, he will need the help of its biggest idiot. (Read More)

Subgenre:
martial arts
Themes:
surveillanceterrorismescapekidnappingrevengemurderdeath
Mood:
car chasegore
Locations:
museumpolice carhelicopter
Characters:
action heropolice chasetough guyhostagepolice officerbrother sister relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationship
Story:
foot chaseshot in the crotchfilmed killingcommandershot through a windowbulletproof vestjumping through a windowjumping from heightkicked in the stomachhypodermic needlehead buttfalling down stairssilencermercenaryneck breaking β€¦exploding bodyshot in the shoulderinjectionkicked in the facerace against timebeaten to deathone against manyshot in the foreheadshot in the legchild in perilhit by a carone man armystabbed in the chestmixed martial artsimpalementmontagestrangulationterroristshot in the backscientistbritishcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosioncigarette smokingbare chested maleviolencegunfightblooddog (See All)

Allegiant (2016) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Allegiant (2016)

After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc β€¦king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)

Subgenre:
suspensemartial arts
Themes:
amnesiasurveillanceterrorismmilitaryescapekidnappingrevengedeathmurder
Characters:
action herotough guyhostagesoldierbrother sister relationshipmother son relationship
Story:
anti herofoot chaseknocked out with a gun buttshot through a walloverturning carreturning character killed offshot through a windowbulletproof vestgash in the facestabbed in the throattarget practiceexplosivegas maskkicked in the stomachhead butt β€¦falling down stairsinjectionkicked in the facerace against timebeaten to deathone against manyshot in the foreheadtrainingchild in perilpart of seriesone man armystabbed in the chestmixed martial artsthroat slittingimpalementgood versus evilshot in the backscientisthand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested malefightsequelbloodviolence (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kiss Of The Dragon (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kiss Of The Dragon (2001)

Liu Jian, a police officer from China, comes to Paris to help the vice squad apprehend a Chinese drug lord and his unknown French connection. The French connection is Richard, the head of the vice squad, who intends to kill the drug lord then frame Jian. Jian ducks a bullet and escapes with a tape o β€¦f what really happened. By chance, Jian turns to Jessica - a US farm girl who is one of Richard's hookers - for help. She has her own problems, including the fact that Richard has her daughter locked in an orphanage to keep Jessica on the streets and silent about his activities. Can Jian protect Jessica, rescue her daughter, and give Richard the kiss of the dragon? (Read More)

Subgenre:
suspensemartial arts
Themes:
surveillanceheromurderdeath
Mood:
car chasegore
Locations:
police car
Characters:
action heroshooting a police officertough guyhostagepolice officermother daughter relationship
Story:
foot chaseshot in the crotchfilmed killingkicked in the headpunched in the stomachstabbed in the throatgun battlegun fukickboxingkicked in the stomachhypodermic needlehead butthand grenadeneck breakingexploding body β€¦shot in the shoulderkicked in the facestabbed in the backone against manyshot in the foreheadchild in perilhit by a carone man armystabbed in the chestshot in the backhand to hand combatheld at gunpointbrawlcamerapunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathshootoutpistolchaseexplosionbare chested malegunfightbloodviolence (See All)

Resident Evil: Afterlife (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Resident Evil: Afterlife (2010)

In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead  β€¦that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)

Subgenre:
martial arts
Themes:
amnesiasurveillanceescapekidnappingdeathrevengemurder
Mood:
gore
Locations:
police carsnowhelicopter
Characters:
hostagesoldierbrother sister relationship
Story:
anti heroinvulnerabilitygun duelcrashing through a windowbullet balletsuper strengthhead blown offtimebombcloneshot in the facegash in the facegun battlegun fuexplosivemind control β€¦jumping from heightkicked in the stomachuzisubtitled scenemercenaryexploding bodyshot in the shoulderinjectionkicked in the facestabbed in the backshot in the foreheadshot in the legchild in perilpart of seriesstabbed in the chestimpalementmassacregood versus evilshot in the backheld at gunpointfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splattershot to deathshootoutpistolsurprise endingchaseknifeexplosionviolencedogbloodgunsequelfight (See All)

Die Hard (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Die Hard (1988)

NYPD cop John McClane goes on a Christmas vacation to visit his wife Holly in Los Angeles where she works for the Nakatomi Corporation. While they are at the Nakatomi headquarters for a Christmas party, a group of bank robbers led by Hans Gruber take control of the building and hold everyone hostage β€¦, with the exception of John, while they plan to perform a lucrative heist. Unable to escape and with no immediate police response, John is forced to take matters into his own hands. (Read More)

Subgenre:
suspensecult filmmartial arts
Themes:
terrorismheroescapekidnappingrevengemurderdeath
Mood:
gore
Locations:
helicopter
Characters:
action herotough guyhostage
Story:
blood on camera lenssoldier killedanti herogun duelbullet balletpolice officer shot in the chestgash in the facefalling down stairsmachismosilencermercenaryneck breakingkicked in the facerace against timeone against many β€¦shot in the foreheadshot in the legpart of seriesone man armyweaponmixed martial artsstrangulationterroristhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolsurprise endingexplosioncigarette smokingbare chested malefightgunviolenceblood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ghost In The Shell (2017) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ghost In The Shell (2017)

In the near future, Major Motoko Kusanagi (Scarlett Johansson) is the first of her kind: A human saved from a terrible terrorist attack, who is cyber-enhanced to be a perfect soldier devoted to stopping the world's most dangerous criminals. When terrorism reaches a new level that includes the abilit β€¦y to hack into people's minds and control them, Major Kusanagi is uniquely qualified to stop it. As she prepares to face a new enemy, Major Kusanagi discovers that she has been lied to: her life was not saved, it was stolen. She will stop at nothing to recover her past, find out who did this to her and stop them before they do it to others. (Read More)

Subgenre:
suspensemartial arts
Themes:
amnesiaterrorismescapekidnappingsuicidedeathrevengemurder
Locations:
helicopter
Characters:
action herotough guyhostagesoldiermother daughter relationship
Story:
anti herofoot chaseoverturning carsuper strengthshot through a windowprime ministerbulletproof vestjumping through a windowgun fuexplosivecyborgmind controljumping from heightkicked in the stomachhypodermic needle β€¦hand grenadeuzisubtitled scenesevered armexploding bodyinjectionkicked in the facerace against timebeaten to deathone against manyshot in the foreheadshot in the legmixed martial artsmontagemassacreterroristscientistcar crashhand to hand combatheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentfistfightshot to deathcorpseshootoutpistolchaseknifeexplosioncigarette smokingbare chested maledoggunviolencefight (See All)

Broken Arrow (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Broken Arrow (1996)

"Broken Arrow" is the term used to describe a nuclear device that has been lost. In this movie, two nuclear missiles are stolen by rogue US pilot Deakins, but hot on his trail is his co-pilot Hale and a Park Ranger, Terry. The action takes place in Utah's canyon country; a high stakes game of cat an β€¦d mouse. (Read More)

Subgenre:
martial arts
Themes:
terrorismmilitaryherodeathmurder
Mood:
car chase
Locations:
helicopter
Characters:
soldier
Story:
nuclear threatgun duelbullet balletvillain played by lead actortimebombpunched in the stomachgash in the facegun battlegun fucolonelkicked in the stomachhand grenadecaptainmachismomercenary β€¦exploding bodyshot in the shouldershot in the leghit by a carweaponmixed martial artsimpalementterroristhand to hand combatheld at gunpointfalling from heightbrawlgunfightpunched in the faceslow motion sceneshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutpistolchaseexplosioncigarette smokingbare chested maleviolencebloodfightgun (See All)

3 Days To Kill (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

3 Days To Kill (2014)

Dying of brain cancer, a dangerous international spy is determined to give up his high stakes life to finally build a closer relationship with his estranged wife and daughter, whom he's previously kept at arm's length to keep out of danger; but first, he must complete one last mission - even if it m β€¦eans juggling the two toughest assignments yet: hunt down the world's most ruthless terrorist and look after his teenage daughter for the first time in ten years while his wife is out of town. (Read More)

Subgenre:
videomartial arts
Themes:
kidnappingdeathmurder
Mood:
car chase
Locations:
snow
Characters:
action herotough guyhostagemother daughter relationshipfather daughter relationshiphusband wife relationship
Story:
anti herofoot chasesmoke grenadecoming out of retirementshot through a windowbulletproof vestexplosivegas maskhypodermic needleuzisubtitled scenesilencerinjectionkicked in the facerace against time β€¦beaten to deathone against manyshot in the foreheadshot in the leghit by a carone man armymixed martial artsmontageterroristshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion sceneshot in the headshot in the chestmachine guncar accidentfistfightshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionviolencebloodfight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Escape From New York (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Escape From New York (1981)

In the future, crime is out of control and New York City's Manhattan is a maximum security prison. Grabbing a bargaining chip right out of the air, convicts bring down the President's plane in bad old Gotham. Gruff Snake Plissken, a one-eyed lone warrior new to prison life, is coerced into bringing  β€¦the President, and his cargo, out of this land of undesirables. (Read More)

Subgenre:
cult filmmartial arts
Themes:
self sacrificeheroescapemurderdeath
Mood:
car chase
Locations:
helicopter
Characters:
action herotough guyhostage
Story:
automatic weaponanti herofoot chaseknocked out with a gun buttkicking in a doorbladehijackingfight to the deathstabbed in the headpunched in the stomachgun fuuzisilencerinjectionrace against time β€¦one against manyshot in the leghit by a carone man armystabbed in the chestmixed martial artswomanhand to hand combatheld at gunpointshowdownbrawlgunfightpunched in the facerescueshot in the chestmachine guncar accidentfistfightshot to deathshootoutpistolsurprise endingchaseexplosioncigarette smokingbare chested malebloodviolence (See All)

The Raid 2: Berandal (2014) is one of the best movies like Universal Soldier: Regeneration (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Raid 2: Berandal (2014)

He thought it was over. After fighting his way out of a building filled with gangsters and madmen - a fight that left the bodies of police and gangsters alike piled in the halls - rookie Jakarta cop Rama thought it was done and he could resume a normal life. He couldn't have been more wrong. Formida β€¦ble though they may have been, Rama's opponents in that fateful building were nothing more than small fish swimming in a pond much larger than he ever dreamed possible. And his triumph over the small fry has attracted the attention of the predators farther up the food chain. His family at risk, Rama has only one choice to protect his infant son and wife: He must go undercover to enter the criminal underworld himself and climb through the hierarchy of competing forces until it leads him to the corrupt politicians and police pulling the strings at the top of the heap. And so Rama begins a new odyssey of violence, a journey that will force him to set aside his own life and history and take on a new identity as the violent offender "Yuda." In prison he must gain the confidence of Uco - the son of a prominent gang kingpin - to join the gang himself, laying his own life on the line in a desperate all-or-nothing gambit to bring the whole rotten enterprise to an end. (Read More)

Subgenre:
martial arts
Themes:
murder of a police officersuicidedeathrevengemurder
Mood:
car chasegore
Locations:
snowrestaurant
Characters:
action heropolice chasetough guyhostagebrother sister relationshiphusband wife relationshipfather son relationship
Story:
blood on camera lensfoot chasestabbed in the facekicked in the headreturning character killed offfight to the deathbody counteye gougingjumping through a windowstabbed in the legstabbed in the headpunched in the stomachshot in the facestabbed in the throathead butt β€¦uzimachismoneck breakingshot in the shoulderlong takekicked in the facebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the leghit by a carone man armystabbed in the chestmixed martial artsthroat slittingimpalementstrangulationshot in the backcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine guncar accidentblood splatterfistfightshot to deathcorpseshootoutpistolchaseknifecigarette smokingbare chested malebloodfightsequelviolence (See All)

Dracula 2000 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula 2000 (2000)

In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β€¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)

Subgenre:
suspensecult filmmartial arts
Themes:
home invasionsurveillanceescapekidnappingsuicidedeathrevengemurder
Mood:
gore
Characters:
hostagedoctorfather daughter relationship
Period:
2000s
Story:
foot chasecoming out of retirementinvulnerabilityfilmed killingcrashing through a windowsuper strengthstabbed in the eyejumping through a windowstabbed in the throatexplosiveback from the deadmind controljumping from heightkicked in the stomachhypodermic needle β€¦severed armneck breakinginjectionkicked in the facerace against timestabbed in the backtrainingstabbed in the chestmixed martial artsthroat slittingimpalementmassacrestrangulationgood versus evilshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionbare chested malefightviolencegunblood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Universal Soldier: Regeneration?
<< FIND THEM HERE! >>