Please wait - finding best movies...
Urban Legend tells the story of a group of pretty college students at a remote New England university. The focus of the story is Natalie, a beautiful, academically-gifted student at the fictional Pendleton University. Natalie and her friends are all involved in the Folklore class being taught by Pro …fessor Wexler. Wexler regales his class with urban legends, which include Pendleton's own urban legend about a Psych professor who murdered six students at Stanley Hall 25 years ago. Natalie is the first one to suspect there's a killer on campus, especially after she has ties to all of the victims. No one, including her friends, Wexler, Dean Adams and security guard, of course, believes her until it's too late. Now she finds that she and her friends are part of the killer's ultimate urban legend. (Read More)
| Subgenre: | slasher flickteen horrorteen movie |
| Themes: | psychopathrevengemurderdeath |
| Mood: | car chaseslasherraingore |
| Locations: | singing in a cargas stationswimming pool |
| Characters: | mysterious killerprofessorsecurity guardserial killerfemale protagonistfriendteenager |
| Story: | college campuscollege roommatesinging along with radiomicrowave ovenannoying roommateroommate issuesradio call in showradio callerradio talk showradio hosttalk radioradio stationaxe murderfemale psychopathheavy rain …loss of best friendshot with a gunthrown through windshieldwest highland white terrierfalse scarestuck during sexkilled in a carbody in a car trunkcrying for helpdead teenagercall for helpfall to deathlifting a male into the airdead body in a car trunkcry for helpyelling for helpsource musicdark and stormy nightconvicted felonchat roomhanged boyoff screen murderfemale serial killerdorm roompepsimicrowavevillain not really dead clichepoodlered herringgoth girlorchestral music scoredisc jockeycampusbody in a trunkscalpelfraternityspreadeaglescene before opening creditsurban legendcar troublecharacters killed one by onerainstormthunderstormrear entry sexjanitorfemale killerdeath of friendparking garagejournalismstabbed in the stomachvillainesslifting someone into the airtied to a bedgothicfirst partsuspicionhanginglightningproduct placementroommateradioimpalementbridgeaxestrangulationbound and gaggedcandlejournalistdecapitationtelephonecollegevomitingfalling from heightcomputerblood splattercorpsepistolsurprise endingchasepartysingingsex sceneflashbackgunbloodviolence (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
| Subgenre: | teen horrorteen movieblack comedy |
| Themes: | revengedeathmurderbetrayalfearescapedeceptionparanoiaguiltnear death experience |
| Mood: | slashergorenightmare |
| Locations: | singing in a carswimming poolhospitalbarrestaurantchurchhotelhelicoptercemeterysmall townairplaneboatnightclubairportkitchen …storm (See All) |
| Characters: | serial killerfriendteenagerfather son relationshipboyfriend girlfriend relationshipdoctornursemaidfisherman |
| Period: | 1990syear 1988 |
| Story: | radio stationheavy raindark and stormy nightvillain not really dead clichered herringcharacters killed one by onerainstormdeath of friendlifting someone into the airlightningroommateimpalementaxecollegevomiting …blood splattercorpsepistolsurprise endingchaseflashbackviolencebloodsequelbare chested malefightdancingknifeshowershot to deathfistfightcar accidentshot in the chestrescuepunched in the facebikinibrawlshowdownsecond partmarijuanahallucinationislandrevolvercleavagesurvivalambushdrug dealerstabbed to deathstabbed in the chestfalse accusationno opening creditsdream sequencescantily clad femalebartenderattempted murdercharacter repeating someone else's dialoguestabbed in the backscreamingpay phonevacationrace against timecollege studentgymthreatened with a knifefireplacespearlooking at oneself in a mirrorkicked in the stomachpart of trilogyinterracial friendshippresumed deadhaunted by the pastblood on facestabbed in the throatpower outagepunched in the stomachbroken glasskaraoketitle appears in writingstabbed in the headstabbed in the legaccidental killingatticpierlens flaresequel to cult favoritevoodoofemale in showermannequinengagement ringtombmarijuana jointyellingstabbed in the handconfessionalcomic reliefstonerhurricaneresortgreenhousedance cluboffscreen killingman punching a womanman in swimsuitjockhanged mandeath of boyfriendpawnshophiding under a bedfourth of julyseason in titlefemale bartenderreference to richard nixonstupid victimtoothbrushhookarm slingno endingfalling through the floorpost traumatic stresshooded figurestrobe lightwriting in bloodstabbed in the foothotel managerstabbed in the sidefilicidejumping on a bedsecond in trilogybahamassequel to cult filmspit takesparklerfear of flyingseasicknesswhite male pretending to be blackfalling down a hillhook for handtanning beddouble impalementstabbed through the chinstranded on an islandu.s. coast guardfalling through a rooftop windowreference to bob marleyreference to freddy kruegersleeping in classboatmanhook for a handreference to jason voorheesstabbed through the neck (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
| Subgenre: | slasher flickteen horrorteen moviecult filmblack comedysuspenseconspiracypost modernhorror spoof |
| Themes: | psychopathmurderrevengedeathlovebetrayalfeardrunkennessescapeinvestigationdeceptionvoyeurismparanoiainsanitysadism …theatremurder of a police officernear death experience (See All) |
| Mood: | slashergoresatire |
| Locations: | hospitalbicyclepolice stationpolice carfire truck |
| Characters: | serial killerfemale protagonistteenagerpoliceboyfriend girlfriend relationshippolice officerdetectivehostagekillerpolice detectiveex boyfriend ex girlfriend relationshipself referential |
| Period: | 1990s |
| Story: | college campusfemale psychopathvillain not really dead clichered herringfraternitycharacters killed one by onedeath of friendstabbed in the stomachvillainesssuspicionlightningproduct placementimpalementaxejournalist …telephonecollegecomputerblood splattercorpsepistolsurprise endingchasepartysingingviolencebloodf ratednumber in titlesequelinterviewbare chested malekisscigarette smokingknifecell phonebeatingdigit in titleshot to deathcar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvbrawlmaskshowdownheld at gunpointsunglassessecond partcar crashhallucinationvoyeurtelevisionf wordreportergood versus evilsurvivalfoot chasegay slurbedroomflashlightambushvideo cameraambulancestabbingthroat slittingstabbed to deathstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phonestatuecover upknocked outkicked in the facecollege studentprankscarbodyguardstalkingfilm within a filmisolationstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendscrucifixmovie theatervideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplayethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chiefpopcornwhodunitcameramansororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimclimbing out a windowvcrthrown from a car555 phone numberfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
| Subgenre: | slasher flickteen horrorteen movieindependent filmcult filmblack comedysuspensefish out of watersurvival horrorpsychological thriller |
| Themes: | psychopathrevengemurderdeathfriendshipkidnappingfeartortureescapebrutalityparanoiainsanityhome invasionpaniccannibalism …couragehuntingmurder of a police officerwildernessnear death experience (See All) |
| Mood: | slashergore |
| Locations: | gas stationforestbathtubwoodspolice cartruckcave |
| Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
| Period: | 2000s |
| Story: | axe murderdead teenagervillain not really dead clichecar troublecharacters killed one by onedeath of friendtied to a bedfirst partaxebound and gaggeddecapitationcollegefalling from heightblood splattercorpse …pistolsurprise endingchaseviolencebloodsexcigarette smokingexplosionknifefirecryingcell phonebeatingshot to deathcar accidentshot in the headshotgunrescueslow motion sceneshowdownriflecar crashmarijuanashot in the backsurvivalfoot chaseflashlightambushmountainstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendsjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countsevered legarrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wiremolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned carwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | slasher flickteen horrorteen movieindependent filmcult filmsuspensepsycho thrillermurder mysteryamerican horror |
| Themes: | psychopathdeathrevengemurderfearvoyeurismcorruptionbrutalityinsanityhumiliationsadismevilcrueltytraumamysterious death |
| Mood: | slashergorenightdarknessblood and gore |
| Locations: | carmotorcycleboatwaterwoodsrural settingpolice carlaketruck |
| Characters: | serial killerfriendteenagerpoliceteenage boypolice officerpolicemanartistkillermothervillainsheriffterrortruck driverslasher killer …mysterious villainserial murderer (See All) |
| Period: | 1970s1950ssummer |
| Story: | axe murderfemale psychopathheavy raindead teenagerdark and stormy nightoff screen murderfemale serial killervillain not really dead clicheorchestral music scorecar troublecharacters killed one by onethunderstormstabbed in the stomachvillainessgothic …first partaxecandledecapitationblood splattercorpsesurprise endingviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlepantiesbeatingdigit in titlefistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective camerabedroombraold manmassacrestabbingwomanthroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurderercabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepmachetehathammerpsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareroomkilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingmysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violencesexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgemurder spreebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorweirdoawakeningdate in titledisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | slasher flickteen horrorindependent filmcult filmamerican horror |
| Themes: | psychopathrevengedeathmurderfeardeceptionsurveillanceevilmurder of a police officer |
| Mood: | slashergoresatire |
| Locations: | forestwoodskitchenwheelchairrooftopfire truck |
| Characters: | security guardserial killerteenage girlteenage boynursekillervillainpsychiatristslasher killercoroner |
| Period: | 2000s |
| Story: | axe murderheavy raindead teenagercharacters killed one by onerainstormlifting someone into the airlightningproduct placementimpalementaxestrangulationdecapitationfalling from heightcomputerblood splatter …corpsesurprise endingchaseviolenceflashbackbloodfemale nuditysequeltwo word titlefightknifefirecell phonefistfightmirrorwatching tvcameraundressingbrawlmaskshowdownf wordsubjective cameragood versus evilhalloweenfoot chaseflashlightambulancemontagethroat slittingstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotevil mankicked in the facecollege studentskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingmaniacchainsawsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailraised middle fingergasolinebody countcasual sexsequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myerslifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
| Subgenre: | slasher flickteen horrorteen moviecult filmcoming of ageblack comedysuspenseconspiracypost modernpsychological thrillerhorror spoof |
| Themes: | psychopathdeathrevengemurderfriendshipinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcebrutalitydeath of mother …paranoiahome invasionnear death experiencedeath of daughter (See All) |
| Mood: | slashergoresatirehigh schooldarkness |
| Locations: | forestsmall townwoodskitchenpolice stationschool bus |
| Characters: | serial killerfemale protagonistteenagerfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyvillainsheriff …single fatherslasher killerself referential (See All) |
| Period: | 1990s |
| Story: | dead teenagervillain not really dead clichered herringcharacters killed one by onedeath of friendlifting someone into the airfirst partsuspicionhangingproduct placementbound and gaggedtelephonefalling from heightcomputerblood splatter …corpsepistolsurprise endingchasepartybloodviolencef ratedone word titlebare chested malecigarette smokingtitle spoken by characterknifefirecell phoneshot to deathcar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcatarrestmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisionf wordsubjective camerasurvivalfoot chaseflashlightcaliforniadisguiseambulancethroat slittingstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotscreamprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinegroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportermasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned carhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | slasher flickteen horrorteen movieindependent filmcult filmamerican horrorindependent horror |
| Themes: | psychopathrevengemurdersurrealismfuneralsupernatural powerevil |
| Mood: | slashergorehigh schoolnightmareavant garde |
| Locations: | cemeterybathtubpolice station |
| Characters: | serial killerhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlkilleralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain …serial murdererpolice lieutenant (See All) |
| Period: | 1980s |
| Story: | dead teenagerhanged boyvillain not really dead clichecharacters killed one by onedeath of friendlifting someone into the airgothicfirst parthangingstrangulationtelephonefalling from heightblood splattercorpsesurprise ending …violencebloodbare chested malecigarette smokingdreammirrorface slapslow motion scenearrestbeddemonjailclassroomsubjective cameragood versus evilfoot chasestabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shotevil manstalkingdeath of sonpremarital sexcharacter says i love youreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scorehatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementbody countcellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdisturbingdemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | slasher flickteen horrorindependent filmcult filmpsycho thrilleramerican horror |
| Themes: | psychopathdeathmurderdrugsparanoiainsanityevilabductionalcoholism |
| Mood: | slasherhigh schoolnightmare |
| Locations: | schoolsmall townelevatorkitchentruck |
| Characters: | security guardserial killerteenagerfamily relationshipspolicemother son relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlnursepolicemanalcoholicvillain …secretaryterrorslasher killermysterious villain (See All) |
| Period: | 1990syear 1998 |
| Story: | axe murderdead teenagerlifting a male into the airvillain not really dead clichecar troublecharacters killed one by onedeath of friendlifting someone into the airaxecandledecapitationtelephonefalling from heightpistolchase …violencebloodnumber in titlesequelknifecar accidentmaskbirthdaydead bodyneighborhallucinationsubjective cameragood versus evilhalloweenflashlightwinecaliforniaambulancestabbingthroat slittingstabbed to deathtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityevil manactor shares first name with characterstalkingreunionflowersplattermaniacbreaking and enteringheroinesurvivorrageloss of friendhidingpsychovictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingbody countdivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen carserial murderpsychopathic killeranniversarybad guybeheadingmadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatehomicidal maniacslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathmurder spreesittingseventh partpsycho terrormichael myersdoor belllifting an adult into the airsadisticboogeymanjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
| Themes: | psychopathmurderdeathfriendshipsurrealismkidnappingrapefeartorturedeath of fatherbrutalitydeath of motherinsanitysadismevil …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | car chaseslashergorenightmarenightdarknessblood and gore |
| Locations: | singing in a cargas stationhospitalforestbathtubwoodsrural settingroad tripfrancetruckbackwoodsback country |
| Characters: | mysterious killerserial killerfemale protagonistfriendfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlstudent …best friendkillervillainterrorfrenchslasher killerbest friendsmysterious villainserial murdererdeath of boy (See All) |
| Story: | axe murderfemale psychopathfemale serial killercharacters killed one by onefemale killerstabbed in the stomachimpalementaxebound and gaggeddecapitationtelephoneblood splattercorpsesurprise endingchase …flashbackgunviolencebloodfemale nudityf ratedbare breastsfemale frontal nuditymasturbationdogcigarette smokingphotographknifelesbian kissshowertelephone calldreamcar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurshot in the backsubjective camerasurvivalflashlightmassacrestabbingthroat slittingstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationpsychosevered handgrindhousestrangerrape victimfollowing someonerapistrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countsexual assaultkilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhouseslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
After an accident on a winding road, four teens make the fatal mistake of dumping their victim's body into the sea. But exactly one year later, the dead man returns from his watery grave and he's looking for more than an apology.
| Subgenre: | slasher flickteen horrorteen moviecult film |
| Themes: | psychopathrevengemurderdrunkennessblackmailguilt |
| Mood: | slasherhigh school |
| Locations: | hospitalbeachboat |
| Characters: | serial killerteenagermother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boysister sister relationshipfishermanslasher killer |
| Period: | 1990s |
| Story: | dead teenagerbody in a trunkurban legendcharacters killed one by onedeath of friendfirst partsuspicioncollegefalling from heightcorpsesurprise endingchasebloodbased on novelbare chested male …photographtitle spoken by characterblondepunched in the facebikinisecretlettercleavagestabbed to deathstabbed in the chestscantily clad femalehit by a carunderwater scenepolice officer killedcharacter repeating someone else's dialoguelocker roomfirst of seriescharacter's point of view camera shotstorytellingcover updeath of brotherreunioncharacter says i love youclaim in titleoverallsblockbustersevered handparadefestivalhaircutunderage drinkingtitle appears in writingdeath of sisterfemale in showerreckless drivingmale in showerstorehiding in a closetdisposing of a dead bodybeauty pageantwhodunitnorth carolinacrabfourth of julyseason in titlestupid victimbreaking a mirrorhookmanslaughterman wearing towelno endingbeauty contestaliastiarareference to mother teresastabbed through the chinwriting on mirror (See All) |
In Seattle, the successful forensic psychiatrist and college professor Jack Gramm is in evidence since he was responsible for the condemnation of the serial killer Jon Forster, influencing the jury to sentence him to the death row. Jon accuses Jack of manipulation, inducing one witness and sister of … one of his victims to testify against him. On the eve of Jon's execution, Jack receives a phone call telling him that he has only eighty-eight minutes of life, while a killer is copycatting Jon, killing women with the same "modus-operandi" and is investigated by Seattle Slayer Task Force. With the support of associate Shelly Barnes, an FBI agent, his friend Frank Parks, and his assistant Kim Cummings, Jack investigates some weird and problematic students, a security guard of the campus and the woman with whom he had one night stand. (Read More)
| Subgenre: | suspense |
| Themes: | deathmurderrapeprisondrinkingtortureinvestigationparanoiaguiltexecutionmurder investigationpolice investigationmurder of sister |
| Mood: | rainneo noirmurder trial |
| Locations: | barmotorcycleairplanetaxielevatorcourtroomrooftoptaxi drivercar explosioncar bombfire truckcar on fireapartment firemotorcycle killer |
| Characters: | professorsecurity guardserial killerfriendpolicefather daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlteacherstudentpolicemanlawyersister sister relationship …teacher student relationshippsychiatristasian americanex boyfriend ex girlfriend relationshipuncle niece relationship (See All) |
| Period: | 1990syear 1997 |
| Story: | college campuscall for helpcry for helpcampusscalpelspreadeagleparking garagesuspicionproduct placementstrangulationbound and gaggedcollegefalling from heightcomputercorpse …pistolsurprise endingflashbackbloodgunviolencefemale nuditynumber in titleinterviewfemale rear nuditydancingtitle spoken by characterexplosionlesbian kisspantiestelephone callfirecell phoneshootoutshot to deathshot in the headwatching tvcatdrinkshootingheld at gunpointbombrunningdead bodyclassroomshot in the backflashlightbraambulancethroat slittingtied to a chairexploding carjudgetrialsearchlatex glovesflash forwardconfessionprologuefbiumbrellascreamuniversitycourtmanipulationamerican flagpursuitdie hard scenariohandgunclassobscene finger gesturetwinnewspaper headlineropetv newsfalling down stairsbreaking and enteringfbi agentloss of loved onebuttocksnosebleedvideotapepsychologistfemale tied uprapistdead womanmilkclockcelebrationburglarrap musicburglarychaosdeath threatevacuationframe updeath of sisterone daysuspectdead woman with eyes opensmokeframed for murderseattle washingtonlaptop computerfiremanbreak inpistol whiplecturealarmjuryhanging upside downtape recordinglistening to a radiodeath rowcookiescene of the crimekitednawrongful convictionporscheloss of sisterforgerytime for titlewoman shotoverhead camera shotcapital punishmentblack catradio newstwin sistergroupiedoormanpet catpackagegagreal timevideo cassettetear on cheekstairwellpersonal assistantapple computertortured to deathseaplaneuniversity professorpocket knifetelevision broadcastfire engineforensicslethal injectionloud musicwalking in the rainescort servicecount downdriving in the rainkite flyingsearch warrantguilty verdictbomb threatfree willdead sisterdictaphoneelectric toothbrushlistening to a car radioblackberryreference to jeffrey dahmerreference to ted bundytask forceconference roomstegosauruscopycat murdermissing petsleepmaskuniversity campusmilk and cookiespinwheelsee through blousebomb scareburgundyseattle space needlereference to msnbcapple laptopforensic psychologistpulleyriding motorcyclecellular phone traceoverhead projectorsmashed car windshieldbluetoothchocolate chip cookieperrier waterblock and tacklehydroplanesuspicious packageamerican flag lapel pinchecking one's watchdelayed executionladder truckphone tracewalther p99 (See All) |
Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh …ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)
| Subgenre: | cult filmblack comedysuspenseconspiracypost modern |
| Themes: | psychopathdeathrevengemurderlovebetrayaljealousydrunkennessescapeinvestigationdeceptiondeath of mothersurveillancehome invasiongreed …murder of a police officer (See All) |
| Mood: | slashergoresatirehigh school |
| Locations: | hospitalsmall townelevatorpolice station |
| Characters: | serial killerfemale protagonistteenagerhusband wife relationshippolicesheriffcousin cousin relationshipex boyfriend ex girlfriend relationshipself mutilationaunt niece relationshipself referentialshooting a police officer |
| Period: | 2010s |
| Story: | dead teenagervillain not really dead clichered herringcharacters killed one by onefemale killerdeath of friendparking garagestabbed in the stomachsuspicionbound and gaggedfalling from heightblood splattercorpsepistolsurprise ending …chasepartyviolencebloodnumber in titlesequelknifecell phonedigit in titleshot to deathshot in the chestrescuepunched in the facemaskbookheld at gunpointnumbered sequelf wordreporterfoot chaseflashlightvideo cameradisguiseambulancethroat slittingstabbed to deathstabbed in the chesttied to a chairno opening creditspolice officer killedfemme fatalenews reportshot in the foreheadauthorcharacter repeating someone else's dialoguevirginstabbed in the backfired from the jobelectrocutionknocked outhigh school studentfilm within a filmpolicewomanthreatened with a knifevigilantestrong female characteranswering machinefalling down stairsrevelationsociopathfamegroup of friendsred dressbarnsecurity camerawalkie talkiekicked in the stomachfourth partimpersonationpress conferencestrong female leadduct tape over mouthcrime scenetensionunderage drinkingstabbed in the throatstabbed in the neckpunched in the stomachdeath threatstabbed in the legdisembowelmentbookstorebody landing on a carlens flaredead woman with eyes opensequel to cult favoritemasked killermedia coveragelaptop computerintestinesstabbed in the handhiding in a closetreference to facebookwebcamstabbed in the armclimbing through a windowwhodunitfacebookdeputystabbed in the shouldersole black character dies clichefilmed killingcamcorderreference to twitterfemale cophiding under a bedspitting bloodbreaking through a doorshot in the crotchstupid victimwoman in dangerbullet proof vestdead woman on floormovie fantauntingdeeply disturbed personmystery killerpretending to be deadbook signingstabbed in the footdoorbellaccomplicebreaking down a doorbloggergeneration ydefibrillatorstartledstabbed in the bellystabbed in the foreheadclichepublicistmillennial generationthreatening telephone callfourth in seriesthrown through a glass doorunmaskingparty crashingmotivephone terrorreference to jeffrey dahmertelephone terrorweb camerathrown off a balconyreference to bruce willissudden disappearanceschool clubstabbing a womanhiding evidencemise en abymestabbing a police officerself inflicted woundcrashing through windowgarage door openerwatching a horror movieactress shares last name with characterdraw bladerunning into a wall (See All) |
A teenage girl, trying to enjoy her birthday, soon realizes that this is her final one. That is, if she can figure out who her killer is. She must relive that day, over and over again, dying in a different way each time. Can she solve her own murder?
| Subgenre: | slasher flickteen horrorblack comedy |
| Themes: | murderdeathsuicideinfidelityjealousyextramarital affairtime travel |
| Mood: | slasher |
| Locations: | hospitalcar explosioncar on fire |
| Characters: | security guardserial killerfemale protagonisthomosexualfather daughter relationshipmother daughter relationshipdoctorpolice officerkillerteacher student relationshipsuicide by hangingslasher killerteacher student sexpolice officer taken hostage …blonde asianasian girlteacher student affairsex with a studentasian boybaby mask (See All) |
| Story: | college campuscollege roommatedead teenagerdorm roomred herringcharacters killed one by onefemale killerparking garagecollegesurprise endingchasepartyviolencebloodgun …female nuditymasturbationkissfemale rear nudityexplosionknifethree word titlecryingcell phoneshot to deathmaskbirthdayf wordfoot chasethroat slittingstabbed to deathdinerstabbed in the chestexploding carpolice officer killednews reportpublic nuditymini skirtbaseball batcollege studentamerican flagstalkingmurdererlove interestarsonbirthday cakecloseted homosexualcrying womanflatulenceteddy bearmasked manstealing a carmobile phoneplot twistblack brahit on the headtitle at the endalternate realitycasual sexglobal warmingmasked killerholding handsprequelparking lothit with a baseball batleather jacketserial murderfinal showdownhiding in a closetrepeated scenetwist endingsuit and tiealarmblonde womanmini dresstelevision newsfemale friendshipyoung womanescaped convictsororityfriendship between girlspartial female nuditybaseball capshort skirtfemale villainmercedes benzmusic boxmasked villainfart jokevending machinepsychotronic filmtime loopgrindhouse filmyoung adultmurder victimsurprise partyknife held to throatdeja vudriver's licensealternate timelinemystery killerdyed hairmultiple outcomesfemale studentdoctor's officein the closetescaped prisonerrepeated eventcupcakeco edhospital gowntime warprun over by a carfalling out a windowhit by a bustime travelercar alarmgay pornhorror iconbare midriffcheating on wifehanged by the necksurprise birthday partybell towermiddle fingerdisco ballcurly hairmarried mandying repeatedlypower cutpointing a gun on someonebirthday cardhighway patrolsorority houseblowing out candles on a birthday cakesorority girldeath in titleman murders a womanteacher student romancehooded sweatshirtreference to harry houdinishooting a womanmontage with pop songempty gunlong haired mancake in the facesmashing a car windowblowing out a candlehair curlerschocolate milksmashing a windowstood uptrapped in a time loopbloody knifemobile telephonereference to janis joplinrunning mascaracutting own hairloose womanshort dresskilled on birthdaysetting a car on firehead traumapoisoned to deaththroat slitwhite boardhit on the head with a hammeropening creditspoisoned foodreliving the pastfemale flatulenceknife held to someone's throatbirthday candleboarded up windowpulled over by policekiss on the neckpushed through a windowthe morning afterarizona desertfemale college studenthair curlernight walkreference to ghostbusterscrush on teachereternal recurrenceknife held to one's throatthrown against a wallfat shaminggirl in jeopardyhalter topreference to bill murraywalking alone at nightwatching a gay porn videowatching gay porn (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
| Themes: | psychopathmurderrevengedeathfearbrutalityinsanitysadismevilexploitationpolice investigation |
| Mood: | slasherraingorenightmarenightdarkness |
| Locations: | cemeterysmall townwoodsamericabackwoods |
| Characters: | mysterious killerserial killerteenagerpolicemother son relationshipbrother brother relationshipkillervillainsheriffterrorslasher killermysterious villainserial murderercountry boy |
| Period: | 1980s |
| Story: | axe murdersource musicdark and stormy nightorchestral music scorecar troublecharacters killed one by onestabbed in the stomachlifting someone into the airimpalementaxedecapitationblood splattersurprise endingchaseviolence …bloodsexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancingpantiesdigit in titledead bodylow budget filmnumbered sequelsubjective camerasword fightmassacrethroat slittingchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetemutilationbarnpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyebody countfifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guymadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violencestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdrive in classiccandy barclotheslinegory violenceeast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
| Subgenre: | cult filmblack comedyconspiracysupernatural |
| Themes: | psychopathmurderdeathrevengelovesurrealismkidnappingmarriagemoneybetrayalpregnancyfearescapeweddingdeception …seductionrobberybrutalitysupernatural powerparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
| Mood: | car chaseslashergorepoetic justice |
| Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
| Characters: | serial killerteenagerhomosexualpoliceboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerdetectivepriesthostagethiefpolice detective …maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
| Period: | 1990s |
| Story: | heavy rainfemale serial killervillain not really dead clichebody in a trunkscene before opening creditsrainstormfemale killergothicsuspicionlightningimpalementbridgestrangulationtelephoneblood splatter …corpsepistolsurprise endingchaseviolencebloodgunsexcharacter name in titlesequelbare chested malekissfightcigarette smokingphotographknifefirecryingcell phonebeatingshot to deathcar accidentmirrorshot in the chestrescueslow motion scenewatching tvbare buttlettershowdownheld at gunpointrock musiccar crashdead bodymarijuanahandcuffsrevolverf wordorphanflashlightambushmansionmontagethroat slittingstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timedollknocked outbaseball batskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexrattied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standoffback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the enddisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage loveabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facehit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victiminnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishnailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | suspensesupernaturalparanormalpsycho thriller |
| Themes: | psychopathmurderdeathsuicidekidnappingmarriagerapeghostprisonfeartortureescapememorysupernatural powerparanoia …drug useinsanitymental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
| Mood: | slasherraingoreneo noirnightmaredarkness |
| Locations: | swimming poolhospitalcarbathtubtaxipolice stationpolice car |
| Characters: | security guardserial killerfemale protagonistfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoonursepolicemanlawyerreference to god …killervillainpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
| Story: | axe murderheavy rainscalpelspreadeaglerainstormthunderstormjanitorgothiclightningbridgeaxecomputerblood splattercorpsepistol …surprise endingchaseflashbackviolencebloodgunsexfemale nudityf ratedfemale frontal nudityinterviewbare chested malekissfightphotographexplosionknifeshowertelephone callfirecryingcell phonedreamcar accidentmirrorshotgunwatching tvshootingrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightvideo camerawomanthroat slittingsuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlebarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographywomen's prisonabsent fatherevidencefemale doctornervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood staindenialhearing voiceslistening to a radiostethoscopefallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Fresh from Des Moines, Iowa, Sara Matthews has just landed in Los Angeles as a college freshman studying fashion design. She meets handsome Stephen, party-lover Tracy, and roommate Rebecca. Rebecca is nice, sweet and ready to share everything with Sara. It could be the beginning of a beautiful frien …dship. But Tracy is convinced that there's something seriously wrong with Rebecca and bad things start happening to everyone close to Sara. If Sara is to have a normal college experience, she's going to have to get to the bottom of what's up with Rebecca and quickly get out of her clutches. (Read More)
| Subgenre: | teen moviesuspensepsycho thriller |
| Themes: | psychopathmurderrevengedeathlovekidnappingbetrayaljealousyfeardrunkennessescapeinvestigationdeceptionseductionobsession …mental illnessbullyingunrequited lovehome invasionpanicfashionnear death experienceself harm (See All) |
| Locations: | gas stationbarschoollos angeles californianightclubtaxielevatorapartmentcityschool bully |
| Characters: | professorfemale protagonistteenagerfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattooteacherstudentmusicianhostagegay kiss …bullywaitressalcoholicteacher student relationshipolder man younger woman relationshipex boyfriend ex girlfriend relationshipself mutilationmysterious girlsame sex kisscat killer (See All) |
| Period: | 2010s |
| Story: | college campuscollege roommateroommate issuesfemale psychopathdorm roomcampusvillainesstied to a bedproduct placementroommatebound and gaggedcollegepistolsurprise endingparty …sex sceneviolencebloodfemale nudityf ratedmasturbationbondagetwo word titlebare chested malekissfightdancingphotographknifelesbian kissshowertelephone callcryingcell phoneblondeface slaprescueslow motion scenepunched in the facecatcameraundressingpaintingheld at gunpointbeersunglassescafeclassroomrevolverbandambushdisguisemansionstabbingmontagestabbed to deathdinerstabbed in the chestrock bandbrunetteapologydisarming someonedrawingdouble crossfemme fatalenecklacecoffeeattempted murderlibrarystalkerhotel roomcharacter repeating someone else's dialoguedangerstabbed in the backportraitkicked in the facecollege studentscreamuniversitymanipulationconvertibletragic eventstalkinglaptoppremarital sexreuniontied upthreatened with a knifelove interestgraffitiredheadpowereavesdroppingkilling an animalbreaking and enteringwoundbeer drinkinggay characterlooking at oneself in a mirrorlistening to musictape recordersociopathscene during opening creditscatfighthatjoggingcrying womanart galleryfollowing someoneschizophreniaplaygroundblood on facehit in the crotchmercilessnessdeath threatdelusiondrummermedicationmentorcigarette lightersexual harassmentsketchdeath of sisterlipstickboyfriendgasolinedark pastdressing roombarefoot femalepassionate kissbruisedead woman with eyes opensports carposterthanksgivingdrugged drinkfemale female kisscoffee shoptext messagingbeing followedmale objectificationmental patienttaking a photographclosetpistol whipspiral staircasefemale friendshipguitar playinganimal crueltyphone sexbroken mirrorcheering crowdplaying guitarkittendesignoffscreen killingtaking off shirtobsessive lovefashion showfemale villainkicked in the headuniversity studentmoving incrying femaleart exhibitionmysterious womanmanipulative behaviortragic pastwashing machinebechdel test passeddance scenedead catseductive behaviorlesbian subtextundressing someonefamily homevending machinetext messagewet clothesunwanted kissfeet on tableman hits a womanpet catbreaking a mirrorextreme close uphometownpointing a gun at someonescreaming womanwrapped in a towelseductive womanfemale antagonistframed photographdeeply disturbed persongay cinemadrinking from a bottledrunken womanmovie postermoving outthreatened with a gunhysterical womandutch anglegas station attendantwoman kills manfired from a jobbipolar disorderdyed hairbig cityfemale in a showersecretly observinguniversity professorpretending to be someone elserepeated eventresentmentmanipulative womanoverheard conversationhysterical outburstcollege lifetattoo parlorlgbt cinemaman punches a womanvillainess played by lead actresstalking to an animalaspiring musicianwashing hairaudio recordingkneed in the groinkilling a cattaking a selfiewoman with a gunroommate roommate relationshipwatching someone sleeppart time jobprivate investigationthanksgiving dinnerhit in the groinmurder by stabbingvoice recordingfemale bullyfemale stalkerroommate relationshipschool librarybox cutterfrat partywoman murders a manfreshmanmeet cutedangerous friendfalse evidencelesbian characterpersonality disorderjealous womanfemale sociopathsleeping shirtlessfalse friendear piercingfemale alcoholicmentally unstable womanspilled drinkdeath by stabbingdeath of catgoogling for informationspilled coffeewoman wrapped in a towelgagged womanmartyress syndromementally disturbed persontattoo on chestviolent womanbelly button piercingchokecracked mirrormartyr syndromepiercing ripped outplastic bag over headkilling a petmistaken belief that someone is deadnavel piercingsuffocated with plastic bagplaying drumsslut shamingtalking to a catkey cardportrait drawingsecret recordingseductive girltattoo on breastemotionally unstable womanfake friendhitting oneselfsketch padtied handsfinger injuryimplied female nuditykissing someone's neckwoman bound and gaggedbare backdrinking coffeefemale bondagelying on the floorsmelling clothescutting oneselfmanipulative girlnew roommateplaying keyboardfemale exhibitionistsetting a trapjealous friend (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | slasher flickteen horrorcult filmsupernaturalpsycho thrillerparanormal phenomenaamerican horror |
| Themes: | psychopathmurderdeathprisonmonstersupernatural powerinsanityevilmurder of a police officer |
| Mood: | car chaseslashergoredarknessbreaking the fourth wall |
| Locations: | forestcemeterysmall townboatwoodslakeamerica |
| Characters: | serial killerteenagerpolicezombiekillervillainsheriffterrorslasher killerserial murderer |
| Period: | 1980s |
| Story: | dead teenagerdark and stormy nightoff screen murdervillain not really dead clichelifting someone into the airgothicdecapitationblood splattersurprise endingflashbackviolencesexcharacter name in titlenumber in titlesequel …masknumbered sequeldemonflashlightmassacreambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdermachetemutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathmurder spreeghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightninghockey masklifting a female into the airdemonicdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | slasher flickteen horrorindependent filmcult filmblack comedysuspensetragedypsycho thrillersurvival horroramerican horrorindependent horror |
| Themes: | psychopathdeathmurderfriendshipkidnappingfeartortureescapebrutalityparanoiadysfunctional familyinsanitysadismevilexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
| Mood: | slasheravant gardedarknessambiguous ending |
| Locations: | gas stationcarcemeterykitchenwheelchairfarmroad triptrucktexascountryback country |
| Characters: | serial killerteenagerfamily relationshipsboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostagekillervillainterrorself mutilationtruck driverslasher killer …serial murdererself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | dead teenageryelling for helpscene before opening creditsurban legendcar troublecharacters killed one by onedeath of friendlifting someone into the airgothicfirst partproduct placementradioimpalementbound and gaggeddecapitation …collegevomitingfalling from heightblood splattercorpsesurprise endingchaseviolencebloodphotographknifevoice over narrationbeatingurinationblondecamerawritten by directorsunglassesrunninglow budget filmsurvivalfoot chaseflashlightambushmassacrestabbed in the chesttied to a chairdinnerman with glassesdouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckchainsawropegroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingkilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guyhysteriamadmanyellingface maskminimal castvomithead woundold dark househuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queensickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | cult filmsuspenseb horrorpsycho thrilleramerican horrorindependent horror |
| Themes: | psychopathmurderdeathfearbrutalityinsanityevilexploitation |
| Mood: | slashergoredarkness |
| Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
| Characters: | mysterious killerserial killerteenagerboyfriend girlfriend relationshipkillervillainterrorslasher killermysterious villainserial murderer |
| Period: | 1980ssummeryear 1984 |
| Story: | false scarehanged boyvillain not really dead clicheorchestral music scorecar troublecharacters killed one by onevillainesslifting someone into the airgothicimpalementstrangulationdecapitationblood splattercorpsesurprise ending …flashbackbloodviolencesexfemale nuditynumber in titlesequelfemale frontal nuditykissfightnipplespantiestelephone calldigit in titleblondeslow motion scenecatbikinimasksecond partdead bodynumbered sequelsubjective cameraswimmingbramassacrethroat slittingjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotevil manopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexkillingsplatterchessmaniacchainsawfireplacespearnipples visible through clothingmass murdermacheteragemutilationphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarekilling spreepsychoticmasked killerpsycho killernude swimmingserial murderpsychopathic killerbad guymadmanmysterious manreturning character killed offhuman monstersummer campfreakskirtsexual violencehomicidal maniacslashingwetting pantshillbillyday in titletow truckparaplegicmultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexbutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdodisturbinglifting a female into the airtrailtorturergiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityhand on shoulder scarelatex mask (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | slasher flickteen horrorteen movieindependent filmcult filmpsycho thrilleramerican horrorholiday horror |
| Themes: | psychopathmurderdeathfearcorruptionparanoiaevilmurder of family |
| Mood: | slasherhigh schoolnight |
| Locations: | carsmall towncar theftkitchen knife |
| Characters: | serial killerfemale protagonistteenagerhusband wife relationshipboyteenage girlteenage boygirllittle girlkillerlittle boyvillainpsychiatristterrordoctor patient relationship …slasher killerserial murderer (See All) |
| Period: | 1970s1960syear 1963year 1978 |
| Story: | dead teenagerlifting a male into the airoff screen murdervillain not really dead clichestabbed in the stomachlifting someone into the airfirst partstrangulationtelephonefalling from heightblood splattersurprise endinggunviolencefemale nudity …nudityone word titledogcigarette smokingtitle spoken by characterknifeshot to deathshot in the chestwatching tvmaskrunninglow budget filmmarijuananeighbortelevisionsubjective cameragood versus evilhalloweenstabbingthroat slittingstabbed to deathchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shotevil manhalloween costumelong takestalkingmurdererhandgunkillingmaniacpot smokingteen angstbulletelectronic music scorebabysittermutilationblockbusterpsychogrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endbody countdead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killerbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathwetnessmurder spreegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phoneheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadewoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Donnas senior prom is supposed to be the best night of her life, one of magic, beauty, and love. Surrounded by her best friends, she should be safe from the horrors of her dark past. But when the night turns from magic to murder there is only one man who could be responsible, the man she thought was … gone forever. Now, Donna and her friends must find a way to escape the sadistic rampage of an obsessed killer, and survive their Prom Night. (Read More)
| Subgenre: | slasher flickteen horrorteen moviecoming of agesuspense |
| Themes: | psychopathmurderdeathfriendshipdrunkennessdanceobsessionrivalryhome invasionmurder of a police officermurder of family |
| Mood: | slasherhigh schoolnightmarehorror movie remake |
| Locations: | hotelelevatorpolice stationfire truck |
| Characters: | friendteenagerhusband wife relationshippoliceboyfriend girlfriend relationshipteenage girlteacherdetectivekillerpolice detectiveuncle niece relationshipaunt niece relationshipdeath of girlfriend |
| Story: | body in a trunkcharacters killed one by onedeath of friendbridgeaxestrangulationblood splattercorpsepistolchasepartyflashbackviolencebloodmale nudity …masturbationdancingtitle spoken by characterknifeshowercell phoneshot to deathmirrorshot in the chestremakeslow motion scenehallucinationsurvivalorphandisguiseambulancethroat slittingstabbed to deathstabbed in the chestjokedream sequencepolice officer killednews reportlimousinestalkervirginclownrace against timekicked in the facedeath of childhigh school studentstalkingthreatened with a knifeloss of loved oneswat teampsychologistrapistbarefootcrime scenehaunted by the pastfloodunderage drinkingevacuationpedophileblood on shirtmurder of a childone dayuncleengagement ringparentsdjpervertauntgraduationfire extinguisherhiding in a closethigh school teacherpedophiliacomic relieftrashflaskescaped convictmtvpromdeath of boyfriendgarbagemugshothiding under a beddeath of familychild molesterstupid victimbreaking a mirrorrookie copsexual predatorrenovationcliquebitten handsex offenderclicheflasherbad actinghotel suitemedicine cabinetbroken dishblack stereotypeprom queenbathroom mirrorcut telephone linecockinesserotomaniaprom kinghotel staffmaster keybridgeport connecticutstupid cop (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c …olleagues (Read More)
| Subgenre: | slasher flickcult filmblack comedysuspensesurvival horror |
| Themes: | psychopathrevengedeathmurdersurrealismrapedrinkingfearescapevoyeurismangersupernatural powerparanoiainsanitysurveillance …evilpanictechnologymadness (See All) |
| Mood: | slasher |
| Locations: | swimming poolrestaurantelevatorlaboratory |
| Characters: | security guardfemale protagonistboyfriend girlfriend relationshipreference to godbabe scientistslasher killer |
| Period: | 1990s2000s |
| Story: | villain not really dead clichecharacters killed one by onestabbed in the stomachlifting someone into the airfirst partimpalementstrangulationvomitingcomputerblood splattercorpsechasegunviolenceblood …female nudityfemale frontal nuditymale rear nuditydogbare chested malekissfightnipplesexplosionpantiesshowertelephone callfiredreamunderwearmirrorshot in the chesturinationface slappunched in the facedrinkthongmaskshowdownsunglassesbombdead bodycafebathroomvoyeursciencescientistsurvivalfoot chaseman with glassesanti herounderwater scenedrowningtransformationstalkerdangerstabbed in the backsuburbperson on fireelectrocutioninjectionpursuitstalkingneck breakingratcult directormonkeywashington d.c.experimenteavesdroppingburned alivekilling an animalwarehousemass murdercagesociopathmad scientistpoolcovered in bloodcgipeeping tomrampagetrappedsurveillance cameraresearchthirty somethingbody countlasersightkilling spreeflamethrowerburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillabroken windowanimal abuseelectric shockgiving a toastseizuretop secretburnt bodysole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonscience runs amokscientific researchloss of controlresearchertragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insecticiclesprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
3 backpackers are in Amsterdam where they get locked out of their youth hostel. They are invited into a man's house where he tells them of a hostel somewhere in eastern Europe where the women are all incredibly hot and have a taste for American men. When they get there, everything is too good to be …true - the hostel is "to die for" (Read More)
| Subgenre: | slasher flickcult filmconspiracysurvival horrorsadistic horror |
| Themes: | psychopathrevengedeathmurdersuicidekidnappingdrinkingfeartortureescapedeceptionseductiontravelbrutality …sadismpolice brutality (See All) |
| Mood: | car chaseslashergore |
| Locations: | trainpolice stationbrothelmuseumtrain stationsex in a bathroom |
| Characters: | serial killerfriendprostituteamerican abroadslasher killer |
| Story: | scalpelrear entry sexdeath of friendgothicfirst partstrangulationbound and gaggedvomitingblood splattercorpsepistolviolencebloodfemale nudityone word title …threesomefemale frontal nuditymale rear nuditybare chested malefemale rear nuditydancingphotographtitle spoken by characterpantiescell phonebeatingshot to deathshot in the chestface slapheld at gunpointprostitutionhandcuffsshot in the backsubjective camerafoot chasethroat slittingtied to a chairsevered headchild in perilhit by a carcontroversysearchfemme fataleshot in the foreheadpainon the runbeaten to deathscreamingcharacter's point of view camera shotmissing personcover upcollege studentdisappearanceglassestrappremarital sexwhippingeuropedismembermentsurgerychainsawpot smokingwarehousemachetemutilationdesperationsevered handcovered in bloodsadomasochismcrying manpassportsexual desirecameostealing a carwhipmercilessnesspunched in the stomachtitle appears in writingscissorstitle at the endvegetarianeye gougingtoursevered legsurprise after end creditsdrugged drinkpsychopathic killermysterious manbongbag over headforeignerburnt faceamsterdam netherlandshead bashed inwoman in bra and pantiesicelandwhistlingbusiness cardunsubtitled foreign languagefinger cut offcrushed headcorrupt policekiller childextreme violencespaslaughterhousedrillcut into pieceshit with a hammersole survivorlocked in a roomstupid victimnude photographhit by a traintorture chamberpower drillbodily dismembermentbubble gumblowtorchhostelhit with a rocksledge hammerbackpackersaladhit on the head with a rockdrill in the headburn injuryslovakiaachilles tendon cuthead in a toiletugly americanhit by a doorsevered toebegging for lifefanny packthrown out of a barbratislavareflection in glasshousehold cleaning gloveswhimperingkid gangtitle appears in text on screensearching for friendsearching for missing friend (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
| Subgenre: | slasher flickindependent filmcult filmdark comedycreature featuresadistic horror |
| Themes: | murderdeathsurrealismkidnappingrapejealousyfeartorturefuneralmonsterseductiontheftdeath of fatherinsanitymental illness …sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
| Mood: | slasherraingorenightmare |
| Locations: | gas stationcemeterypolice carroad tripcavemuseumtunnelshedcave in |
| Characters: | serial killerfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipthiefsheriffslasher killerpolice lieutenantevil doctor |
| Period: | 1970syear 1977 |
| Story: | female serial killerbody in a trunkurban legendlifting someone into the airtied to a bedhanginglightningaxebound and gaggedblood splattercorpsepistolsurprise endingchaseviolence …bloodflashbacknumber in titlebare chested maledancingphotographknifefirebeatingdreamdigit in titleshot to deathcar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenstabbed to deathstabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manskeletonhalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recordercaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark househuman monsterfreakmental retardationnight visionbillboardpsychedelicdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Alex is boarding his plane to France on a school trip, when he suddenly gets a premonition that the plane will explode. When Alex and a group of students are thrown off the plane, to their horror, the plane does in fact explode. Alex must now work out Death's plan, as each of the surviving students …falls victim. Whilst preventing the worst from happening, Alex must also dodge the FBI, which believes Alex caused the explosion. (Read More)
| Themes: | murderdeathfearinvestigationsupernatural powerself sacrificenear death experiencefear of deathcheating death |
| Mood: | raingore |
| Locations: | beachparis francebathtubairportairplane accidentbicycle accident |
| Characters: | teenagerboyfriend girlfriend relationshipbest friendteacher student relationshipamerican abroaddeath of girlfriend |
| Period: | 2000s |
| Story: | dead teenagerhanged boycharacters killed one by onedeath of friendfirst partsuspicionlightningimpalementstrangulationdecapitationcomputerblood splattercorpsesurprise endingblood …two word titleexplosionknifefireblondeinterrogationbathroomfightingcleavagefoot chasetoiletstabbed in the chestexploding carsevered headscantily clad femalecharacter repeating someone else's dialoguedangerelectrocutionfirst of seriesdeath of brothertragic eventhigh school studentdeath of sondisasterburned alivegroup of friendsfbi agentaccidental deathdead womancrushed to deathwindbroken glasstitle appears in writingsculpturedead boydead woman with eyes openreckless drivingnewspaper clippinghigh school teachershot in the necktelling someone to shut upwetting pantscabin in the woodspremonitiondripping bloodmale protagonistaltered version of studio logopsychic powerfuneral homeexploding housebutcher knifetraumatic experiencereference to michael jacksonexploding airplanejerkgas explosionvinyldead woman on floortitle appears in songmorticianfemale studentlong island new yorkextrasensory perceptionmodel airplanehit by a busfreak accidentomenmuscle carfield tripmass deathhead cut in halfmemorial servicehare krishnafalling treecar hit by a trainreference to jeffrey dahmersurvivor guiltjfk international airport queens new york citycar on train tracksbloody footprintclimbing through window (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | independent filmcult filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | deathmurderfriendshipsurrealismfeardrunkennessescapedancedeceptionvoyeurismbrutalitysupernatural powerparanoiaillnesssadism …evilunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All) |
| Mood: | slasherraingorenightavant gardedarknessstylization |
| Locations: | swimming poolschoolforesttaxiairportwoodsapartmentgermanytaxi driver |
| Characters: | mysterious killerprofessorfemale protagonistfriendteenagerdoctorboyteenage girlteachergirlpolice officerstudentsister sister relationshipkillerpsychiatrist …witchgermanamericanamerican abroadself mutilationaunt nephew relationshipevil witchnew student (See All) |
| Period: | 1970syear 1977 |
| Story: | heavy rainrainstormdeath of friendgothicfirst partsuspicionhanginglightningimpalementstrangulationtelephonefalling from heightblood splattercorpsesurprise ending …chaseflashbackbloodviolenceone word titledogcigarette smokingdancingexplosionknifetelephone callfirevoice over narrationslow motion scenesecretshowdownbathroompianodemonhallucinationvoyeursubjective cameraswimminggood versus evilfoot chasewineambushstabbingthroat slittingstabbed to deathtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotmissing personcover upcollege studentscreamdisappearanceinjectionmurdererthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlelooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the enddisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
| Subgenre: | slasher flickindependent filmblack comedysuspensepsycho thrillerpsychological thrillerholiday horrorchristmas horror |
| Themes: | psychopathdeathmurderrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionlonelinessobsession …paranoiainsanitymental illnesssurveillanceabductioncrueltypanicmadnessnear death experience (See All) |
| Mood: | car chaseslashergoreneo noirdarknessone night |
| Locations: | new york citycarsnowwatertaxielevatorurban settingpolice carcityoffice |
| Characters: | security guardfemale protagonistpolicepolice officerpolicemanhostagepolice detectiveslasher killermysterious villain |
| Period: | winter |
| Story: | body in a trunkcar troublecharacters killed one by oneparking garageproduct placementaxestrangulationbound and gaggedblood splattercorpsesurprise endingchasepartyviolenceblood …number in titleone word titledogfightexplosionknifetelephone callfirecryingcell phonehigh heelsbeatingdigit in titlefistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunningcar crashhandcuffsvoyeurmanhattan new york cityf wordsubjective cameracleavagesurvivalfoot chasenewspaperflashlightwinevideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackcharacter's point of view camera shotknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamedruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | slasher flickindependent filmcult filmsuspenseaustralian horrorsadistic horror |
| Themes: | psychopathmurderdeathkidnappingrapedrinkingfeartorturedrunkennessescapebrutalityinsanitysadismevilabduction …exploitationcruelty (See All) |
| Mood: | car chaseslashergorenightdarknessblood and gore |
| Locations: | gas stationswimming poolbarbeachrestaurantcarhelicopterairplanedesertaustraliaroad triptruckcavecampfireroad movie …australian outbackcar on fireshed (See All) |
| Characters: | mysterious killerserial killerhusband wife relationshipdoctorsingerhostagekillervillainaustralianterrorself mutilationslasher killermysterious villainserial murderer |
| Period: | year 1999 |
| Story: | villain not really dead clichescene before opening creditscar troublecharacters killed one by onerainstormfirst partimpalementbound and gaggedvomitingblood splattercorpsechasepartysinginggun …bloodviolencedogtwo word titlekisscigarette smokingphotographtitle spoken by characterexplosionknifebased on true storysongshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightmassacrevideo camerastabbingstabbed to deathfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererobscene finger gesturedismembermentufokillinggaragemaniacpickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionslaughtercapturecliffminetied feetbody countopening a doorsexual assaultkilling spreebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogmadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightdisturbed individualbutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | slasher flickteen horrorindependent filmcult filmpsycho thrillerparanormal phenomenaamerican horror |
| Themes: | psychopathdeathrevengemurdermonstersupernatural powerevildrug addictionmurder of a police officer |
| Mood: | slasherraingorehigh school |
| Locations: | new york cityboatwoodsseacityamericasewer |
| Characters: | serial killerteenage girlteenage boyzombiepolice officerkillervillainteacher student relationshipterrorslasher killermysterious villainserial murderer |
| Period: | 1980s |
| Story: | dead teenageroff screen murdercharacters killed one by onelifting someone into the airimpalementaxestrangulationdecapitationblood splatterbloodviolencefemale nuditycharacter name in titlenumber in titlesequel …bare chested maleexplosionpantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york cityflashlightgangnew yorkvideo camerastabbingthroat slittingstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlemutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyebody countsequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetromurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoonhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend … has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
| Subgenre: | slasher flickpsycho thriller |
| Themes: | psychopathmurderrevengedeathtorturedrunkennessbrutalitydeath of motherevilmurder of a police officer |
| Mood: | slashergoredarknesshorror movie remake |
| Locations: | forestmotorcycleboatbathtubbicyclewaterwoodspolice carlakecampfiretunnelschool busbackwoodssex in a tent |
| Characters: | african americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity |
| Period: | 1980s |
| Story: | axe murderfemale psychopathsource musicfemale serial killervillain not really dead clichecharacters killed one by onerear entry sexdeath of friendsuspicionimpalementaxestrangulationcandledecapitationblood splatter …corpsepistolsurprise endingchasesex sceneviolencebloodfemale nuditynuditynumber in titlebare breastsfemale frontal nuditymasturbationdogbare chested malefemale rear nuditynipplestelephone callfiretopless female nuditywoman on topdigit in titleurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholswimmingflashlightbratoplessmassacrevideo camerastabbingthroat slittingstabbed to deathstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing persontentevil manopening action scenedisappearancestalkingpremarital sexlove interestkissing while having sexmaniacpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscamppsychocovered in bloodmasked manrampagegrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyebody countsevered legarrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimjerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in bratouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
| Subgenre: | black comedy |
| Themes: | deathmurderfriendshipbetrayaldrunkennessguilt |
| Mood: | slashergorehorror movie remake |
| Locations: | kitchenfire truck |
| Characters: | mysterious killerserial killerfather son relationshipboyfriend girlfriend relationshipbrother sister relationshipinterracial relationshipalcoholicdeath of a friend |
| Story: | characters killed one by onedeath of friendimpalementaxestrangulationcollegevomitingblood splattercorpsesurprise endingchasepartyviolencebloodfemale nudity …female frontal nuditymale rear nuditybare chested malefemale rear nudityknifepantiesshowerfirecell phonemirrorshot in the chestblonderemakeshotgunslow motion scenepunched in the facebare buttsecretheld at gunpointlingeriehallucinationhandcuffsvoyeuralcoholcleavageflashlightambulancethroat slittingstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiesdead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
| Themes: | psychopathmurderdeathsurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigationangercorruption …death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
| Mood: | slashergorenightdarkness |
| Locations: | hospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car …cityitalytruck (See All) |
| Characters: | professorserial killerhomosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlpolicemanmusician …actresskillervillainpsychiatristmaidjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All) |
| Period: | 1970s |
| Story: | female psychopathfemale serial killercharacters killed one by onefemale killerstabbed in the stomachgothicsuspicionhangingimpalementaxestrangulationjournalistdecapitationtelephonevomiting …blood splattercorpsesurprise endingchasesinginggunbloodviolenceflashbacktwo word titlekisscigarette smokingphotographknifetelephone callfiresongshootoutbeatingmirrorface slapwatching tvcameradrinksecretshootingpaintingbookrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisionreportersubjective camerasurvivalgay slurnewspaperbedroomflashlightbandold manstabbingstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonpianiststalkingthreatwitnessdarkbasementtrapcult directorpsychiceuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdresstape recorderrome italymagiciantoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastbody countfemale reportergay stereotypeliving roomdead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
When Charles Lee Ray needs to get quick escape from cop Mike Norris, he takes his soul and buries it into playful, seemingly good guy doll Chucky. Little does he know a little boy by the name of Andy Barclay will be the new owner of him soon-to-come. Charles confides in Andy while he commits numerou …s murders. Once the adults accept Andy's story as truth, it's too late. (Read More)
| Subgenre: | slasher flickindependent filmcult filmpsycho thrillerstop motion animation |
| Themes: | psychopathrevengemurdersupernatural power |
| Mood: | slasher |
| Locations: | carelevatorapartmentpolice stationchicago illinois |
| Characters: | serial killermother son relationshipboypolice detectivehomeless manwitch doctor |
| Period: | 1980swinter |
| Story: | villain not really dead clichescalpeldeath of friendlifting someone into the airgothicfirst partlightningdecapitationfalling from heightblood splattercorpsepistolbloodcigarette smokingknife …punctuation in titleshootoutshot to deathurinationbirthdayapostrophe in titlecar crashshot in the backsubjective camerafoot chasewidowstabbed in the chestsubwayfalse accusationsevered headchild in perilshot in the legperson on fireelectrocutionfirst of seriescharacter's point of view camera shotpossessiondollknocked outattempted rapeshot in the shouldersevered armdismembermentfreeze framemaniactv newsburned aliveelectronic music scorebabysittertoyback from the deadbroken legreverse footagetensionchild's point of viewdark humorfalling to deathmental hospitalstabbed in the legthrown through a windowbody landing on a carsevered legvoodooblack magicgunfireframed for murderplanthit with a baseball batpresentstabbed in the handhiding in a closethead blown offhuman monsterwhodunitdepartment storeelectric shockpolice interrogationbitten in the neckbumburnt bodysole black character dies clichehiding under a bedexploding househit with a hammerbreaking through a doorfootprintjewelry storetauntingmuraltrail of bloodbandaged handevil dolltoy storebitten on the armremadevoodoo dollchantfalling through a windowbreakfast in bedskipping schoolevil laugharm blown offnude paintingmatcheskiller dollfloursoul transferencegingershot in the hearttwo killersdisbelieving adultleg blown offanimatronicattempted strangulationclaw hammerskid rowpeddlerelectroconvulsive therapyhead spinlightning stormmurder disguised as accidenttalking dollcartoon on televisionfalling on a carstalking victimjammed guncar cigarette lighterchild psychiatristelectric batterydisbelieving authoritiesfalling down a chimneyloss of aunt (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
| Subgenre: | independent filmmartial artsblack comedypost modernhorror spoof |
| Themes: | deathrevengemurderkidnappingbetrayaljealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurismtheftbrutality …paranoiacelebrityhome invasioncourage (See All) |
| Mood: | slashergoresatirenightmare |
| Locations: | swimming poolbarhelicopterlos angeles californiaapartmentpolice stationpolice car |
| Characters: | security guardserial killerfemale protagonistpolicefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshippolice officerdetectiveactorhostageactresspolice detectivefilm directorex boyfriend ex girlfriend relationship …death of girlfriendself referentialpregnant from rape (See All) |
| Period: | 1990s2000s |
| Story: | villain not really dead clichered herringbody in a trunkcharacters killed one by onestabbed in the stomachsuspicionstrangulationbound and gaggedjournalistfalling from heightblood splattercorpsepistolsurprise endingchase …partybloodviolencef ratednumber in titlesequeldogbare chested malefightcigarette smokingphotographknifeshowercell phonebeatingdigit in titleshot to deathfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewatching tvbrawlsecretmaskshowdownheld at gunpointsunglassesbirthdaycar crashhallucinationhandcuffsvoyeurrevolvershot in the backf wordreportersurvivalfoot chaseflashlightambushambulancemansionthroat slittingstabbed to deathtoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumescreamingrace against timecover upknocked outkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodyisolationbasementpremarital sexthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dresshollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportersequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimwrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j …ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
| Subgenre: | slasher flickindependent filmcult filmsurvival horrorsadistic horror |
| Themes: | psychopathmurderkidnappingmarriageinfidelitytortureescapeextramarital affaircancerinsanityhome invasionclaustrophobiaself harm |
| Mood: | car chaseslashergore |
| Locations: | hospitalhotelurban setting |
| Characters: | serial killerhusband wife relationshippolicefather daughter relationshipdoctordetectivephotographerhostagekillerpolice detectiveself mutilation |
| Story: | villain not really dead clicheparking garagegothicfirst partbound and gaggedcorpsepistolsurprise endinggunflashbackviolenceone word titleshotguncamerasecret …bathroomrevolverthroat slittingstabbed to deathtoiletchild in perilpolice officer killedclownpuppetperson on firepoisonburned aliveslow motiontape recorderblockbusterblack humorbarefootcrime scenetrappeddisembowelmentbooby trapbody countextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footbludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | black comedysupernaturalpsycho thrilleramerican horror |
| Themes: | psychopathdeathsupernatural powerevil |
| Mood: | car chaseslasherraingore |
| Locations: | chicago illinoisschool buswater gun |
| Characters: | serial killerhusband wife relationshippoliceboyteacherkillervillainterrorslasher killerserial murderernew student |
| Period: | 1990s |
| Story: | villain not really dead clicheorchestral music scorelifting someone into the airtied to a bedgothiclightningstrangulationbound and gaggedfalling from heightcorpsesingingbloodsequelcigarette smokingpunctuation in title …digit in titlecar accidentslow motion sceneheld at gunpointsecond partapostrophe in titlefoot chaseambulancethroat slittingstabbed to deathstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil mandeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturemaniacfalling down stairsburned alivetoynosebleedpsychosevered handblack humorbutchershovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murderpsycho killerpsychopathic killersuffocationbad guymadmanhiding in a closetevil spirithomicidal maniacclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machinehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roombutcheryliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
| Subgenre: | martial artscult filmcoming of ageblack comedysuspensesupernaturalheist |
| Themes: | revengedeathmurderfriendshipsurrealismsuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of fathersupernatural power …paranoiasurveillanceevilhome invasionpanic (See All) |
| Mood: | gorenightmare |
| Locations: | schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church |
| Characters: | professorsecurity guardfather daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitybiblesecretarycatholiccatholic priest |
| Period: | 2000s |
| Story: | death of friendparking garagegothichanginglightningproduct placementimpalementstrangulationcandledecapitationfalling from heightblood splattercorpsepistolsurprise ending …chasepartyflashbackgunviolencebloodsexcharacter name in titlenumber in titlebare chested malefightphotographexplosionknifelesbian kissdreamshot to deathfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf wordgood versus evilsurvivalfoot chasebedroomflashlightambushold manmassacredisguisethroat slittingstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on firerace against timeevil manknocked outkicked in the facecollege studentsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlescene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlcarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
A secret service agent, Jennifer Marsh, gets caught in a very personal and deadly cat-and-mouse game with a serial killer who knows that people (being what they are - both curious and drawn to the dark side of things) will log onto an "untraceable" website where he conducts violent and painful murde …rs LIVE on the net. The more people who log on and enter the website, the quicker and more violently the victim dies. (Read More)
| Subgenre: | suspensevideo |
| Themes: | psychopathmurderdeathrevengesuicidekidnappingtortureinvestigationvoyeurismdeath of fatherdatingsadismabductiondyingtechnology …murder investigationsuicide of father (See All) |
| Mood: | raingorepoetic justice |
| Locations: | motelstormschool bus |
| Characters: | serial killerfemale protagonisthusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipgirlpolicemansingle motherpolice detectivemuslimgrandmother granddaughter relationshipengineerchinese food …death of killercomputer datingcat killer (See All) |
| Story: | dead body in a car trunkcar troubledeath of friendhangingproduct placementbridgebound and gaggedfalling from heightcomputerblood splattercorpsesurprise endingchasebloodviolence …gunone word titlephotographtitle spoken by charactershowertelephone callcell phoneshot to deathcar accidentshot in the chestshot in the headwatching tvcatarrestshootingrunningbirthdaydead bodyvoyeursubjective cameranewspaperterroristvideo camerastabbingwidowstabbed in the chestinternetfalse accusationman with glasseschild in perilbirthday partypolice officer killedfired from the jobfbipay phonecollege studentshot in the shoulderamerican flagpursuitdatebasementloss of fatherhandgunnewspaper headlinehatesingle parentpizzatwenty somethingtv newsfalling down stairskilling an animalballoonloss of friendcaptivefbi agentloss of loved onevideotapeswat teampress conferenceskateboardstrong female leadremote controltensiondiamondsurveillance cameraironyco workerice hockeye mailbody landing on a carpolice raidduct tapeloss of husbandburned to deathpsychotictext messaginggardeningtaserdockwebsitedvdmotel roomdisposing of a dead bodytv reporteranimal crueltytraffic jamhanging upside downkittencomputer hackerbleedingpunching bagroller skatingbleeding to deathburnt bodyfilmed killingcodedead catradio newsportland oregonblogskateboardersnufftortured to deathaccomplicebreaking down a doorbreaking a car windowtiarabattering ramcyberspacemorse codehiding in a carkilling a catdriving in the raincementwatchingintravenousforensicpost itfalling off a bridgefemale fbi agentweather reporthemophiliaskate parkrollerskating rinku.s. congressmanonline chatburning fleshfelinepredator turns victimkilling machinecybercrimesports arenafalling from a rooftophouse catorgan musicid badgecomputer technologyeye blinkingsulphuric acidexsanguinationpussy catrat trapsnuff videothunderbirdchemistry teachertivopussycatbotvoice impersonatoracid deathbattery acidportland state universitypotassium chloridetrojan (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
| Themes: | psychopathdeathmurdertorturebrutalitysupernatural powerinsanitysadismevil |
| Mood: | slashergorebreaking the fourth wallblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | mysterious killerserial killerbrother sister relationshipteenage girlteenage boykillervillainterrorslasher killermysterious villainserial murderer |
| Period: | 1980s |
| Story: | villain not really dead clichecar troublecharacters killed one by onelifting someone into the airimpalementstrangulationdecapitationblood splattercorpsesurprise endingviolencebloodsexfemale nuditynumber in title …male nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiesunderwearmasklow budget filmsubjective camerastabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurderercabinloss of motherobscene finger gesturekillingmaniacsexual attractionragemutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carbody countkilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guymadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
| Themes: | psychopathdeathsuicideghostdrunkennessbrutalityinsanityevilexploitationhomelessnessmurder of a police officerdeath of daughter |
| Mood: | slasherraingorenightmaredarkness |
| Locations: | hospitalhelicopterstrip club |
| Characters: | serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner |
| Story: | axe murdercharacters killed one by onedeath of friendimpalementstrangulationdecapitationvomitingblood splattercorpsepistolchasepartysingingflashbackviolence …bloodfemale nuditynumber in titlesequelfemale frontal nudityinterviewfemale rear nuditybeatingdreamcar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookheld at gunpointsecond partcar crashcafehallucinationstripperf wordhalloweenflashlightbandstabbingthroat slittingstabbed to deathstabbed in the chestexploding carhit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackevil manhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzamaniacsurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybody countbroken armkilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderpsychopathic killerbad guybeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violencehomicidal maniacslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
After the events of Seed of Chucky, Nica, a young woman forced to a wheelchair since birth, has to regroup her sister, Barb and her brother-in-law, Ian for a funeral after the death of her mother. While dealing with Barb, Ian, along with their 5-year-old daughter, Alice; Nica receives an odd package … - a creepy doll. After people start showing up dead, the fearless Nica soon suspects that the creepy doll is much more than just a doll. (Read More)
| Subgenre: | paranormalamerican horror |
| Themes: | psychopathmurderdeathadulteryescapefuneralsupernatural powerdeath of mothersadismevilmurder of a police officermurder of family |
| Mood: | slashergore |
| Locations: | cemeteryelevatorwheelchaircourtroom |
| Characters: | serial killerfamily relationshipshusband wife relationshipmother daughter relationshippolice officersister sister relationshipterroraunt niece relationshipslasher killerbrother in law sister in law relationship |
| Period: | year 1988year 2013 |
| Story: | axe murderdark and stormy nightvillain not really dead clicheaxedecapitationfalling from heightblood splattercorpsesurprise endingviolencebloodflashbackcharacter name in titlesequel …knifelesbian kissslow motion scenewritten by directorcar crashf wordthroat slittingstabbed to deathtied to a chairjudgesevered headchild in perilcharacter repeating someone else's dialoguestabbed in the backelectrocutiondollelectronic music scorescene during opening creditssevered handhome movieduct tape over mouthcameoblack and white scenestabbed in the legscene after end creditsevidencedeath of sistereye gougingstabbed in the eyenannyclose up of eyesblood on camera lenscartoon on tvbag over headold dark houseblackouthomicidal maniacfilm projectoryoung version of characterblood stainwoman in bra and pantieseyeballwrongful convictionparaplegicsixth partstabbed in the facedirect to video sequel to theatrical moviehandicappedstabbed with scissorsdeliveryevil dollhorror iconreference to charles mansondeath by electrocutionkilled in police carmanic laughterkiller dollmurder disguised as suiciderat poisonsunflowerjump scaremurdered priestpolice officer throat slitanimate dollvictorian houseelectronic music score in style of orchestral music scorenanny campoisoned food (See All) |
College student Lewis decides to drive across the country to see Venna, a friend who doesn't know that Lewis is interested in her romantically. Unfortunately for his plans, Lewis gets saddled with his raucous-spirited older brother, Fuller, whose on-the-road pranks get the brothers and Venna sucked …into a nightmare when a psychotic truckdriver takes offense. (Read More)
| Subgenre: | suspense |
| Themes: | psychopathmurderrevengefriendshipkidnappingdrunkennessrobberytheftparanoiahumiliationcruelty |
| Mood: | car chaserain |
| Locations: | gas stationhospitalbarpolice stationroad triptruckmotelroad moviecar theft |
| Characters: | friendmother son relationshipboyfriend girlfriend relationshipbrother brother relationshippolice officerstudentsheriffchildhood friendtruck drivermysterious villain |
| Story: | college roommatechat roomimpalementbound and gaggedcollegecorpsepistolsurprise endingchasebloodsexmale nudityknifeshot to deathunderwear …car accidentmirrorshotgunslow motion scenewatching tvrifleheld at gunpointjailambulancetied to a chairinternetmapexploding carapologybartenderpublic nuditypay phonechampagneon the roadbaseball batprankstalkingcrosspickup trucknipples visible through clothingcomawalkie talkiephone boothfaked deathstealing a carnew jerseyobesitydark humorstabbed in the legrelease from prisontank topshot through a windowgatefenceclimbing through a windowcoloradocredit cardcornfieldhit by a truckmailboxcar set on firesan diego californiatequilakicking in a doorfreewaytruck stopwyomingnebraskaoverheard conversationroad ragepokiessalt lake city utahroadkilladrenalinecar trunktape over mouthcross country tripberkeley californiapeace signsan antonio texasjaw ripped offpatrolmanman forced to stripcandy canecar crashing into a treejoyridedriving through a wallembarrassing nuditybuying a cartraffic ticketboulder coloradoeighteen wheelercrashing into a treechocolate chip cookiewoman in a bedrest areaunknown villainairline ticketcitizens band radiouniversity of colorado (See All) |
Six friends are on their way to a football game. They decide to camp out for the night and continue driving the next day. The next day the friends find that they're having car troubles, so two of the friends accept a stranger's ride into a small town named Ambrose. The main attraction in Ambrose is …the House of Wax. Except something is not right in this town, the wax figures are so realistic and the whole town is deserted - except for two murderous twin brothers. The six friends must fight to survive and escape from being the next exhibits in the House of Wax. (Read More)
| Subgenre: | slasher flickteen horrorpsycho thrilleraustralian horror |
| Themes: | murderdeathtorturefuneralbrutalityyouthabusecampingghost town |
| Mood: | slashergorehorror movie remake |
| Locations: | churchforestsmall townroad tripcampfire |
| Characters: | serial killerboyfriend girlfriend relationshipdoctorbrother brother relationshipbrother sister relationshippriesttough guyinterracial relationshipvillainsheriffslasher killer |
| Story: | car troublecharacters killed one by onedeath of friendlifting someone into the airimpalementdecapitationvomitingcorpsesurprise endingchasebloodviolencemale nuditymale rear nuditybare chested male …fighttitle spoken by characterknifethree word titlepantiesfirecryingcell phoneshot in the chesturinationface slapshot in the headshotgunundressingbare buttlingeriegood versus evilbravideo camerastabbed to deathstabbed in the chestchild abusesevered headscantily clad femalebeaten to deathstripteaseperson on firetentkicked in the facebaseball batinjectionpremarital sexsevered armshot in the armtwinsyringebow and arrowgroup of friendsloss of friendamerican footballhidingfloridarednecksevered fingercrossbowgash in the facestabbed in the necktitle appears in writingscissorsstabbed in the legred pantiesbody counttank topgroupmysterious manold dark housestrandedtrafficthong pantiesstabbed in the armtraffic jaminterracial kissslappingdisfigured facesiblingsiblingsdeformitywrongful imprisonmentsadistic psychopathstupid victimburning buildinglifting female in airgpscar mechanicstabbed in the footstabbed in the sideroadkillsiamese twinsbludgeoned to deathbowie knifewaxhypodermicimpaled through the headsuper gluewax figure (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
| Subgenre: | teen horrorindependent filmmartial artsblack comedysuspensedark comedyb movieabsurdismfish out of water |
| Themes: | psychopathdeathmurderfearescapemonstermilitarybrutalitysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia |
| Mood: | slashergoreambiguous ending |
| Locations: | woodslakeouter spacelaboratoryspace stationresearch stationship explosion |
| Characters: | professorteenagerboyfriend girlfriend relationshipdoctorteachersoldiertough guyvillainteacher student relationshipterrorengineerbabe scientist |
| Period: | 2000s |
| Story: | villain not really dead clichecharacters killed one by onestabbed in the stomachimpalementstrangulationdecapitationfalling from heightcomputerblood splattercorpsepistolsurprise endingchasesex sceneflashback …violencebloodfemale nuditycharacter name in titlenumber in titlesequelfemale frontal nuditybare chested malekissfightnipplesexplosionknifefirebeatingshot to deathfistfightmachine gunshot in the chestface slapshot in the headshotgunrescuepunched in the facemaskshowdownrifleheld at gunpointhand to hand combatnumbered sequelrobotkung fuscientistshot in the backsurvivalflashlightambushmassacrethroat slittingstabbed to deathmixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotstalkerbeaten to deathdangerstabbed in the backprologuekarateelectrocutionrace against timeevil mankicked in the facetough girlinjectionstalkingexploding bodyneck breakingthreatened with a knifemercenarysevered armlove interestkissing while having sexdismembermentundeadsurgerysabotageelectronic music scoremass murderhypodermic needlemachetecowboy hatmutilationroman numeral in titlespacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityback from the deadandroidmasked manpresumed deadcyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramslaughterdisfigurementknife throwingfemale doctorsevered legtank topmasked killergatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierpsychopathic killermadmanface maskfemale fighterhuman monstersummer campslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shoulderextreme violencemicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinearm cut offfemale victimmurder of a nude womanarmy basemass murdererstupid victimscience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | independent filmcult filmblack comedypsycho thrillersadistic horror |
| Themes: | psychopathdeathmurderrevengefriendshipsuicidekidnappingrapebetrayalfeartortureescapedeceptionseductionanger …death of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
| Mood: | gorenightmareambiguous ending |
| Locations: | gas stationbarbathtubpolice stationfarmroad tripmoteltexasbrothel |
| Characters: | serial killerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officernurse …hostagetough guyvillainmaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
| Period: | 1970syear 1978 |
| Story: | axe murderfemale psychopathfemale serial killerfemale killerdeath of friendstabbed in the stomachimpalementaxestrangulationbound and gaggedvomitingblood splattercorpsepistolchase …sex sceneflashbackviolencebloodsequelmale rear nuditydogbare chested malefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionknifepantiesshowerfireshootoutwoman on topbeatingdreamshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurambushdrug dealerthroat slittingcocainestabbed to deathstabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatkicked in the stomachphone boothcovered in bloodgrindhouserapistinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgaritytrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnfsexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | slasher flickteen horrorcult filmsupernaturalparanormalparanormal phenomenabody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | psychopathmurderdeathrevengefriendshipsurrealismkidnappingghostfearescapemonstervoyeurismbrutalitysupernatural powerparanoia …sadismevilpanicmysterious deathshower murder (See All) |
| Mood: | slasherraingorehigh schoolnightmaredarknesspoetic justice |
| Locations: | swimming poolbarschoolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
| Characters: | serial killerfriendteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boy …teachergirlstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | crying for helplifting a male into the airvillain not really dead clicheurban legendrainstormstabbed in the stomachlifting someone into the airgothiclightningimpalementblood splattersurprise endingchasepartyblood …violencecharacter name in titlenuditynumber in titlemale nuditysequelmale rear nuditybondagedogbare chested malefightcigarette smokingknifeshowertelephone callfirecryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facescreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggay characterlooking at oneself in a mirrorlistening to musicjoggingmutilationmousebarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodybreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting faceexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
| Themes: | psychopathdeathmurderghostfuneralmonstersupernatural powerinsanitysadismevil |
| Mood: | slashergorenightmare |
| Locations: | barchurchcemeteryschool boy |
| Characters: | serial killerteenagerfather daughter relationshipmother daughter relationshipdoctornursetough guylittle girlsingle motherkillervillainterrorself mutilationslasher killeralcoholic father …serial murdererevil nurse (See All) |
| Period: | 1980s |
| Story: | dead teenagerhanged boyvillain not really dead clichebody in a trunkscalpelcharacters killed one by onedeath of friendlifting someone into the airtied to a bedradioimpalementdecapitationfalling from heightblood splattercorpse …surprise endingviolencefemale nuditynumber in titlesequelbondagebare chested malecigarette smokingfiredreamdigit in titleslow motion scenethongbedrock musicbathroomnumbered sequeldemonfoot chasenewspaperstabbingstabbed to deathsuicide attemptstabbed in the chestnundream sequencechild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youkillingundeadsplattermaniacfalling down stairsteen angstelectronic music scorecomaragecrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countkilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt faceone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreeghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdisturbingboneslifting a female into the airbad motherdemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
The hacker Josh invades the computer of Douglas Ziegler, who is developing a powerful wireless signal, and accidentally releases a mysterious force that takes the will to live of human beings, generating a suicide epidemic and increasing the force. His girlfriend and student of psychology, Mattie, s …ees each one of their common friends die and the destruction of the modern world, and together with her new acquaintance Dexter, they try to plan a virus developed by Josh in the network to shutdown the system and save mankind. (Read More)
| Subgenre: | teen horrorteen moviesuspensesupernaturalpsychological thriller |
| Themes: | deathsurrealismsuicideghostfearescapeparanoiaguiltsurveillanceapocalypsetechnologynear death experience |
| Mood: | nightmarehorror movie remake |
| Locations: | barhelicopterairplanebathtubbuselevatorapartment |
| Characters: | professorsecurity guardboyfriend girlfriend relationshippsychiatrist |
| Period: | 2000s |
| Story: | college campuscall for helpcampusdeath of friendhangingimpalementcollegefalling from heightcomputersurprise endingflashbackone word titletitle spoken by characterfirecell phone …remakebeercar crashdemonhallucinationsubjective camerasurvivaldinerinternetfalse accusationbathnews reportcoffeelibraryscreamingkeylocker roomfantasy sequencecharacter's point of view camera shotrace against timecollege studentscreamstalkinghandgunpizzaanswering machinevirussecurity camerapsychologyjumping from heightend of the worldinterracial friendshipsocial commentarymechanicalien invasionreverse footagestealing a carpower outageblack bratime lapse photographyairplane crashe maillooking at self in mirrorduct tapealarm clockmedia coveragepostertext messaginggothdeadvideo surveillancelaundryohioepidemiceyecockroachevil spiritcomputer crackerportaltelevision newsrestroomlaundromatbubble bathcomputer hackerlandladydeath of boyfriendfilmed killingmetal detectormaggotnewscastopen endedparasitesome scenes in black and whitecar radiopsychotherapyoverhead camera shottapeexploding airplanepeep hole555 phone numberstairwellvolkswagen beetlecomputer virusdecomposing bodyrunning for your lifeflash drivevideo recordingstartledmass deathhanged by the neckinstructionconquestlaundry roompersonal computeruh 60 blackhawk helicopterinstant messagingdisintegrationlovecraftianbead curtainthe color redremake of japanese filmremake of asian filmlesionspecterhigh jumpsome scenes in sepiano cell phone signalriding buswashing laundrybounced checkapplying mascaracolor redbook bagdripping faucetlife force sucked outmap of united statespsychology classbehavior changeplead for helptransomwalking alone at night (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com