Please wait - finding best movies...
In small-town Texas, high school football is a religion. The head coach is deified, as long as the team is winning and 17-year-old schoolboys carry the hopes of an entire community onto the gridiron every Friday night. In his 35th year as head coach, Bud Kilmer (Jon Voight) is trying to lead his Wes …t Canaan Coyotes to their 23rd division title. When star quarterback Lance Harbor (Paul Walker) suffers an injury, the Coyotes are forced to regroup under the questionable leadership of John Moxon (James Van Der Beek), a second-string quarterback with a slightly irreverent approach to the game. "Varsity Blues" explores our obsession with sports and how teenage athletes respond to the extraordinary pressures places on them. (Read More)
Subgenre: | football movieteen moviecoming of age |
Themes: | prejudiceobsessiontheftrobberydrunkennessdrinkingjealousyreligionfriendship |
Mood: | high school |
Locations: | car theftschool buspolice cartexasstrip clubtruckbussmall towncarrestaurantbarhospital |
Characters: | teenage girlsheriffteenage boychristianthiefpolice officerstudentnursegirlteacherboydoctorboyfriend girlfriend relationshipfriendafrican american …mother daughter relationshipfather daughter relationshipmother son relationshipfather son relationshipfamily relationshipspolice (See All) |
Story: | girl in braathletic scholarshipmale buttocksteenage rebellionfootball coachfemale stripteasepain killerblack brapickup truckchugging beertopless womanfemale studentadolescent girlhigh school girlcar driving …female teacherhigh school studentdrinking gameobese boyhigh school boyadolescent boyboy with glassespink pantiesblack pantiestopless female nuditywhite pantieswhipped cream bikinisports broadcasterfootball injuryfootball refereedriving in the nudebrown universitysports trainerice cream sundaetouch downhit with a ballscar tissuemini martcherriespep rallyblurry visionbare butt malenarrow mindednesssyruphail maryfootball practicemale bare buttknee injurysteroidfootball stadiumpeanut butterbelchinghigh school athletequarterbackhigh school footballwinningnaked butthigh school seniorfake breastsmusclecoyotemutinymascotwhipped creamwashing machinesex educationbreastbroken noserevoltrear nudityscholarshiphead injurypopularitymini dressvulgarityfencesports teamtrophysexual humorbarbecueheartdiscriminationfootball playerconvenience storehit in the crotchnipplewhiskeybroken legpicnicrebellionrebelamerican footballdrug abusebuttockscowboy hatcrucifixwoman with glassesfamecoachcircussurgeryclassprofanitychickenpighairy chestcrosscheerleaderinjectionbaseball batmini skirtlocker roomstripteasepublic nudityspiritualitystrippingargumentpainman with glassestoplessbrasubjective cameracleavagestripperprayerclassroomvoyeurcafetearsbeerriflevomitingbare buttthongundressingdrinkunderweardreambeatingcryingpantieserectionpartynipplescigarette smokingfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare chested malebare breastsbloodnuditysexkiss (See All) |
Film adaptation of street tough Jim Carroll's epistle about his kaleidoscopic free fall into the harrowing world of drug addiction. As a member of a seemingly unbeatable high school basketball squad, Jim's life centers around the basketball court and the court becomes a metaphor for the world in his … mind. A best friend who is dying of leukemia, a coach ("Swifty") who takes unacceptable liberties with the boys on his team, teenage sexual angst, and an unhealthy appetite for heroin -- all of these begin to encroach on young Jim's dream of becoming a basketball star. Soon, the dark streets of New York become a refuge from his mother's mounting concern for her son. He can't go home and his only escape from the reality of the streets is heroin for which he steals, robs and prostitutes himself. Only with the help of Reggie, an older neighborhood friend with whom Jim "picked up a game" now and then, is he able to begin the long journey back to sanity. (Read More)
Subgenre: | coming of ageindependent filmautobiographicalbased on autobiographyfamily tragedybasketball movie |
Themes: | theftrobberydrunkennessdrinkingreligionfriendshipmurderdeathdrugsmoneyprisonmemoryangercorruptionbrutality …drug usehumiliationillnessmental illnessabusedyingdrug addiction (See All) |
Mood: | high schoolrainnightmarenight |
Locations: | car theftpolice carbusrestauranthospitalnew york citychurchhotelsnowbathtubkitchenwheelchairurban settingapartmentcity …rooftopcatholic churchcatholic schoolschool shootingfire escape (See All) |
Characters: | teenage girlteenage boythiefstudentteacherfriendafrican americanmother son relationshippoliceteenagerbrother brother relationshipprostitutepolicemanwriter …priestbest friendbullylatinocatholicself destructiveness (See All) |
Story: | high school studenthigh school athletewhipped creamsports teamdrug abusecrucifixcoachclasscrossinjectionlocker roompublic nuditybrastripperprayer …classroomcafetearsriflevomitingundressingdrinkunderweardreambeatingcryingerectioncigarette smokingmale rear nudityfemale nuditymale nuditykisssexbloodbased on novelmasturbationgunfightphotographknifechasebased on true storytelephone callvoice over narrationbased on booktesticlesfoodshot in the chesturinationface slapshotgunslow motion scenewatching tvcondomarrestfalling from heightshootingrunningbathroomneighborprostitutionjailhallucinationrevolvermanhattan new york citytelephoneshot in the backswimminggangbasketballdeath of frienddrug dealereatingcocainedinertoiletcoffinspankinglooking at the cameratalking to the cameraracial slurconfessionparkdrug addicthotel roomprologuekeyfantasy sequencestorytellinglightningringdiaryprankscargympursuitthreatbasementstagepoetreference to william shakespeareheroinblack americanpoemapplausetv newspornographysyringeteen angstathletewhat happened to epilogueaddictionbreaking and enteringhypodermic needledruggroup of friendsice creamloss of friendstealingassaultnosebleedwristwatchdesperationjumping from heightaudiencestreet lifeapartment buildingdrug overdosestealing a carbloody nosepillshypocrisykickingjunkieschool uniformbilliardsraised middle fingerclassmatebigotrybroken armdead boyjuvenile delinquentferryreckless drivingphysical abusesandwichhigh school teachersnorting cocainejournalcorporal punishmentskinheadbitternessconfessionalgun held to headdegradationstonedhamburgermooningleukemiaracial prejudicebummale prostitutiondecadencehypocriteanguishsex shopmolestationbasketball playerjuvenile delinquencypool halldoormanfast food restaurantpeep holecasketdrug tripman in a wheelchairends with biographical notesbaldnessaddictfalling off a roofdrugstorepaddlehigh school friendgodfatherjumping off a cliffbasketball courtpadlockhand on crotchdrug withdrawalboys' schoolbasketball teaminnocence lostarm castcash registerdeliberate crueltyhigh school basketballpill poppingschool expulsionfalling downboyhood frienderotic dancingbasketball coachpastiesclimbing over a fencegodmotherhandwritingmedicine cabinet42nd street manhattan new york cityhigh school sportsirish accentarm in a castcold turkeytoilet sexhot wiring a cartheatre marqueebreaking into a carovercoatcliff divingtalking through a doorlistening at a doorbreaking a glass doorteenage rebellying in stateclimbing a fire escapeheroin detoxreference to wilt chamberlainrunning through fieldsboys' locker roomdiarist (See All) |
A day in the lives of a group of average teenage high school students. The film follows every character and shows their daily routines. However two of the students plan to do something that the student body won't forget.
Subgenre: | teen movieindependent filmexperimental filmpunk |
Themes: | drunkennessjealousyfriendshipmurderdeathrevengesuicidefearescapeangerbrutalitysadismbullyingphotographycruelty …panicvengeance (See All) |
Mood: | high school |
Locations: | carschoolschool shooting |
Characters: | teenage girlteenage boystudentgirlteacherboyboyfriend girlfriend relationshipfriendfather son relationshipphotographergay kissbullyteacher student relationship |
Story: | female studentadolescent girlhigh school girlcar drivingfemale teacherhigh school studenthigh school boyadolescent boylocker roomargumentman with glassesclassroomriflenudityblood …violencedoggunphotographexplosionpistolshowertelephone callfireshot to deathblood splattercar accidentshotgunwatching tvcamerashootingheld at gunpointbombanimal in titlerunningmarijuanabathroompianotelephonemassacrevideo cameraweaponnonlinear timelinegunshotlibraryscreamingscreamactor shares first name with characterlong takegymlaptopkillingpot smokingstreetragetimepart of trilogyhomicidegirl with glassesexplosivethunderbackpackmercilessnessdiscussionstairsthunderstormhandheld cameraone dayclassmatepsychoticlaptop computerswastikaoutcasthigh school teachercafeteriafirearmstaircaseadvicerestroomdrunk drivingconversationblackboardwalkingwarninghallwaydarkroomrunfrightbloodshedmultiple murderbaglunchdetentionbulimiascaregrudgedelivery manportland oregondisturbed individualcorridormultiple perspectivescity parkblond boycapfrisbeehigh school friendmultiple homicidemass killinghigh school principalteenage angstschool lockerdeanmurderer duoschool libraryschool cafeteriafitting introubled teenage boylunchroomdisturbed personfur elisefemale classmatemultiple killingschool gymfirst time actor (See All) |
At John Hughes High School, the students are the same as just about every other teenager in a teen movie. The popular jock, Jake, takes a bet from Austin, the cocky blonde guy, that he can transform Janey, the pretty ugly girl, into the prom queen before the prom. But two people are trying to stop J …ake from succeeding: his evil sister, Catherine, the cruelest girl in school, and Priscilla, the bitchy cheerleader. And all of their friends are the same as any other teen movie: Areola, the naked foreign exchange student, Les, the beautiful weirdo, Malik, the token black guy, the desperate virgins, Amanda Becker, the perfect girl, Ricky, Janey's obsessed best friend, and Sadie, the VERY old undercover reporter. (Read More)
Subgenre: | teen movieslapstick comedyteen sex comedy |
Themes: | incestrivalryunrequited love |
Mood: | high schoolspoofparodybreaking the fourth wall |
Locations: | schoolswimming poolairportsex in public |
Characters: | teenage girlteenage boystudentgirlfriendfather daughter relationshipfamily relationshipsbrother sister relationshippriestlustteacher student relationshipsingle fatherart student |
Story: | pink pantiestopless female nuditynaked buttbreastrear nuditypopularitysexual humorfootball playerhit in the crotchnippleamerican footballbuttockscheerleaderlocker roompublic nudity …toplesscleavageclassroomvoyeurbare buttpantiespartynipplesfemale frontal nudityfemale rear nudityfemale nuditymale nuditybare breastsnuditysexflashbackmasturbationlesbian kissslow motion scenefalling from heightbookvibratorrunningbirthdayjournalistscantily clad femaletransformationtalking to the cameraracial slurmoaningfemale full rear nudityglassesschoolgirlfreeze framedestinyteen angstdesiresexual attractionbisexual girlflatulencepart animationblack humorembarrassmentgirl with glasseswatching televisionstupiditysex talkscene after end creditshit on the headmusical numberschoolgirl uniformbetred pantiescrude humorlingerie slipexhibitionismsurprise after end creditsirreverencetorso cut in halfpervertvietnam veteranstereotypeblue pantiessexual perversionmakeoverlegscameo appearancemisfitexhibitionistnude girlflight attendanttopless girlpromscatological humorred bradetentionclumsinessincestuous desiresexual obsessiondiarrheaschool lifecheerleader uniformpillow fightidiottoilet humorexcrementgross out humorwoman moaning from pleasurewoman moaningmoaning womanstun gunsex with foodbutt nakedwoman's bare buttwoman in uniformexchange studentgirl toplesshit by a busbad smellsiamese twinscinderella storyincestuous kissscatologywoman wearing glassesblue brapurple branaked outdoorsdolly zoomconjoined twinspopular girlgross outforeign exchange studentgreen pantiesprom nighthuman excrementcovered in fecesgirl wearing glasseswalking around nudeslow clapundercover journalistwallflowergreen brayellow braeeny meeny miny moeexcrement on facefeces on faceawkward girlflight attendant uniformstereotypesthrowing pantiesexplosive diarrhea (See All) |
When her wealthy fiance breaks it off, gold digger Elizabeth Halsey returns to middle school: she's an awful teacher but wants to save for breast-implant surgery. She brightens when Scott, a new teacher, turns out to be rich, and she stops showing films and sleeping in class when told there's a bonu …s for the teacher whose class scores highest on the state exam. Her competition for Scott and the bonus is cheery and tightly wound Amy. Amy digs for dirt on Elizabeth who cheats her way toward Scott's bed and the money. Honesty with students seems to be her only skill. She ignores Russell, a droll gym teacher, who looks on. Will she succeed with Scott and get those new breasts? (Read More)
Subgenre: | black comedyabsurdism |
Themes: | theftdrunkennessdrinkingjealousyrevengeinfidelitydrugschristmasmoneydeceptionvoyeurismseductioncorruptionblackmailpoetry …rivalryunrequited lovebreak upcheating (See All) |
Locations: | school buspolice carbuscarrestaurantbarschoolsnowmotorcycleapartmentchicago illinoismuseumsinging in a carschool teachersinging on a bus …singing on busrussian in usa (See All) |
Characters: | teenage girlteenage boyteacherdoctorboyfriend girlfriend relationshipfriendpoliceteenagerfemale protagonistpolicemanlove trianglealcoholicprofessorfiance fiancee relationshipcolleague colleague relationship …crying girllow self esteempolice dogrussian abroadnew teacher (See All) |
Period: | christmas partysinging christmas carol |
Story: | black bratopless womancar drivingfemale teachertopless female nudityhit with a ballbreastvulgaritysexual humorwoman with glassessurgeryclassprofanitymini skirtman with glasses …bracleavageclassroomvoyeurdrinkcryingerectionpartycigarette smokingfemale frontal nuditymale rear nudityfemale nuditymale nuditybare breastsnudityf rateddogtwo word titlesex sceneejaculationphotographknifesurprise endingcell phonecar accidentblondeslow motion scenewatching tvarrestsunglassesbirthdaycar crashmarijuanapianohandcuffsguitarf wordbandconcertdisguisebasketballwomanmontagefalse accusationscantily clad femaleroommatefemme fatalecoffeeracial slurflash forwarddrug addictcostumeliarchampagnechristmas treemanipulationgymspeechwigsuspicionpoetkissing while having sexbirthday cakepoempot smokingsabotagefarcescene during opening creditsmagazinefraudeccentricbarefoot maleambitionapplejanitorintrigueironyballbribeframe upchristmas eveabsent fatherrivalturtlebarefoot femaleethnic slursurgeonlyingarrogancereference to barack obamadrugged drinkmarijuana jointbriberynew jobporn magazineteachingbongshortsdefecationcafeteriaglovesnudesarcasmdrunken manfriendship between womenhangovercamera shot of bare feetguitar playingstonerelementary schooldomineering motherrumorschool principalmasturbation referenceplaying guitarcar washenvydolphinnude girlnarcissismblackboardcookieexamhallwaycactuscrying femaleillinoissitting on a toiletawkward situationcheating boyfriendmanipulative behaviorbechdel test passedreference to abraham lincolnfully clothed sexseductive behaviorinformerwet clotheslack of moneytalking while drivingheadmasterfeet on tablefast food restaurantwrongful arrestswindlesmoking potseductive womangold diggerfemale antagonistdrinking from a bottleswindlerdrinking from bottleselfish womanfired from a joblearning the truthpretending to be someone elsemanipulative personmercedespsychological manipulationfalse nameplastic surgeonmanipulative womanbasketball courtlazinessantiherochristmas dinnergym teacheregoismmisanthropebustunfaithful boyfriendclassmate classmate relationshiptortoisetaking off shoescounting moneysubstitute teacherworkplace romanceflatmateplanting evidenceauditoriumlittle black dressreference to snow whiteroommate roommate relationshipspeeding vehicleegocentrismemotional blackmailmoney countingfake namebonuscar washingcheaterdodgeballdrunk manschool janitorschool tripcompulsive liardriving in reverseemployee dismissalprofessional rivalryemployee employee relationshipeating an applebreast enlargementcheating on a testdry humpingband membersinging alongtaking off bratrickeryerection visible through clothingreference to the three stoogeswomanchildacneegocentric womannarcissistic personality disordercompromising photographwashing carcoors lightobscene hand gesturereference to morgan freemanreference to tom sawyerconfidantfitness centerpoison applewearing a wigcompromising picturepoison ivyreference to michelle pfeifferdumped by boyfriendegocentricopening champagnesexy teacherboob jobbreast surgeryflatmate flatmate relationshipsuperintendentvulgar womanarrogant womandaisy dukesreference to pamela andersonspringfield illinoisfoul mouthsperm stainbreast examoxycontinreference to lionel richiesemen stainmanipulatorschool inspectorspreading a rumorteacher as protagonistbad teacherhistrionic personality disorderenvious womanface ticklazy woman (See All) |
Four members of a high school band called Mystery do everything they can to attend a KISS concert in Detroit. In order to make it to the show they must steal, cheat, strip, deal with an anti-rock mom and generally do whatever it takes to see the band that has inspired them to be musicians.
Subgenre: | teen moviecoming of agecult filmperiod pieceteen comedy |
Themes: | theftdrinkingfriendshipdrugsmoneydrug usehomophobia |
Mood: | high school |
Locations: | school busstrip clubcarrestaurantbarchurchelevatorcatholic churchsex in car |
Characters: | teenage girlteenage boythiefstudentteacherboyfriendfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipfamily relationshipspolicehomosexual …teenagersingerbrother brother relationshippolicemanpriestjewishcatholicolder woman younger man relationshipalcoholic drinkreligious mother (See All) |
Period: | 1970s |
Story: | black brahit in the crotchcrucifixclasscrossstripteasestrippingsubjective cameraclassroomcaferifledrinkunderwearbeatingerection …cigarette smokingfemale nuditykissbloodsexdogfightejaculationtitle spoken by charactersingingchasetelephone callfiresongcar accidenturinationslow motion scenelieplace name in titlerock musicmarijuanabathroomhallucinationhandcuffsguitargay slurwinebandconcertrock bandapologynunvanmicrophonevirginliarpay phonecity name in titlesplit screenrock 'n' rollobscene finger gesturerecord playerpizzanerddiscoloss of virginitylistening to musiccomic bookrecordingtitle based on songred dressvandalismflatulencevirginityheavy metalface paintrock concertfirst kisshot tubgeekreckless drivingposterdrumsstolen carreference to elvis presleyporn magazinebongmenstruationvomitcafeterialong hairdetroit michiganconfessionalfilm projectordomineering motherradio stationtape recordinglsdwetting pantsstonedreference to albert einsteinmushroomstation wagondisc jockeycar radiodetentiongynecologistfemale to male foot in crotchreference to richard nixoncleveland ohioloudspeakerpremature ejaculationattempted robberyboy bandguard dogpizza delivery boyswedishfemale sitting on a toiletfrisbeetamponmusic concertmusic groupcult music bandauto theftcrossing selfpainted facepinball machinebubble gumvolvogargoylepokiesgym classstage frightsparklerreference to andy warholchop shopbelchroadieprodigal sonlava lampreference to jimmy carteri.d.porno moviechain smoking8 trackreference to john travoltapolkaclassic rock musicgirls' bathroomkneed in the crotchfour best friendshustler magazinepimpleface paintingacnesmiley facereference to burt reynoldsbell bottomsreligious parentsreference to lassiereference to the village peoplereference to farrah fawcettbackstage passconcert ticketradio contestreference to richard pryortest tube babyreference to patty hearstday glokiss the bandorff carmina buranareference to bobby kennedyreference to general motorsreference to sonny and cherreference to the hulkreference to john belushireference to blue oyster cultreference to carly simonreference to henry winklerreference to lee majorsreference to steve martinreference to the bay city rollersreference to the carpentersst. bernard (See All) |
This is the story of three well-meaning but flawed people: Paul Rivers, an ailing mathematician lovelessly married to an English emigre; Christina Peck, an upper-middle-class suburban housewife, happily married homemaker with two young daughters, with hiding a secret past; and Jack Jordan, an ex-con …vict who has found in his Christian faith the strength to live a law-abiding life and raise a family. They will be brought together by a terrible accident that will change their lives. By the final frame, none of them will be the same as they will have learnt harsh truths about love, faith, courage, desire and guilt, and how chance can change our worlds irretrievably, forever. (Read More)
Subgenre: | independent filmsuspensetragedymelodrama |
Themes: | drunkennessdrinkingreligionmurderdeathloverevengesuicidemarriageinfidelitydrugsbetrayaladulteryprisonpregnancy …extramarital affairangerlonelinessdeath of motherdrug useredemptionguiltgriefunfaithfulnessillnessfaithalcoholismhopedyingabortionvengeancedrug addictiondeath of daughter (See All) |
Mood: | rain |
Locations: | car theftpolice carrestaurantbarhospitalchurchswimming poolsnowdesertbicyclemotelsuvnew mexico |
Characters: | sheriffteenage boynurseteacherboydoctormother daughter relationshipfather daughter relationshipmother son relationshipfather son relationshipfamily relationshipspolicehusband wife relationshiptattoopoliceman …lawyersister sister relationshipreference to godlittle girllittle boybibleprofessor (See All) |
Story: | pickup truckwashing machineheartdrug abusebuttockssurgeryclasscrosspaincleavageprayervoyeurcafetearsvomiting …drinkunderwearbeatingcryingpantiespartynipplescigarette smokingfemale frontal nuditymale rear nudityfemale nuditymale nuditykissbloodnumber in titleflashbackmasturbationtwo word titlegunphotographsingingknifepistoltelephone callvoice over narrationfondlingcell phonecorpsedigit in titlefoodcar accidentface slapwatching tvcomputersex in bedshootingbirthdaybathroomjailreference to jesus christrevolverswimmingbreast sucklingambulancebasketballwidowcocainesuicide attemptdinerprisonertoiletaccidentnonlinear timelinebirddrawinghit by a carbirthday partyunderwater scenelatex glovesgunshotflash forwardattempted murderdrug addictmicrophoneumbrellahangingscardeath of husbandex convicthandgunobscene finger gesturetherapyheart attackprivate detectivebirthday cakepoemgolfmedicinehypodermic needleslow motionsexual attractioncomapatientarchitectcaucasianlosstimeguardpillsministermourningdespairmedical examinationevidencethirty somethingmarital separationprison cellred pantiesbowlingloss of husbandrelease from prisonsirensymbolismhit and runsaving a lifehysteriamultiple storylinestoredinner partyplaying poolphysicianlighterloss of daughtermathematicsclinicnewspaper articlestonedinfertilityreverendbleedingmonitorgolf coursewakeallergyartificial inseminationswimmericonschizophrenicprivate eyemortalityfanaticasphyxiationliquor storenightgownmercyhamsterbedriddenfired from a jobwashingexaminationheart transplantrecovering alcoholicjoke tellingmathematicianpityorgan donationoxygen tankspeeding vehicleheart surgerychocolate barporn videoorgan donorrafflejail visitationbarbed wire fencehummingbirdorgan transplantationrefusing to eatheart failuresmall time crookketamineshot in sequenceborn againleaf blowerstepping on glasscutting selfracket ballheart donorsuicide attempt by hangingsports clubcutting armflatliningracquetskull fractureaccidentally shooting oneselfwork detailmouth sprayorgan rejection (See All) |
Echoes of "Madame Bovary" in the American suburbs. Sarah's in a loveless marriage to an advertising executive, long days with her young daughter at the park and the pool, wanting more. Brad is an immature househusband, married to a flinty documentary filmmaker. Ronnie is just out of prison - two yea …rs for indecent exposure to a minor - living with his elderly mother, May; Larry is a retired cop, fixated on driving Ronnie away. Sarah and Brad connect, a respite of adult companionship at the pool. Ronnie and Larry have their demons. Brad should be studying for the bar; Larry misses his job; Ronnie's mom thinks he needs a girlfriend. Sarah longs to refuse to be trapped in an unhappy life. Where can these tangled paths lead? (Read More)
Subgenre: | independent filmblack comedy |
Themes: | prejudicedrinkingfriendshipinfidelityadulteryfearextramarital affairdeath of fatherdeath of motherunfaithfulness |
Mood: | satirerain |
Locations: | small townrestaurantbarhospitaltrainswimming poolbicycletaxivillagestorm |
Characters: | boyboyfriend girlfriend relationshipfriendmother daughter relationshipmother son relationshipfamily relationshipspolicehusband wife relationshipbrother sister relationshippolicemanlawyerbullylustpsychiatrist …u.s. soldier (See All) |
Story: | topless womanpink pantiesblack pantiestopless female nuditywhite pantiestouch downmale bare buttnaked buttbreastrear nudityfencenippleamerican footballbuttockswoman with glasses …mini skirttoplesscafetearsbare buttundressingdrinkunderwearcryingpantiesnipplesfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare chested malebare breastskissnuditybased on novelflashbackmasturbationdogtwo word titlesex scenephotographleg spreadingshowervoice over narrationcell phonefoodslow motion scenewatching tvcomputerbikinikissingsex in bedsecretlettershootingbookliesex standing upswimmingambulancechild abusechildscantily clad femaleunderwater scenevannews reportconfessionlibrarybinocularssuburbliarsuitcasemoaningreadingfemale full rear nudityamerican flagfemale removes her clothessplit screensadnessfeminismtwinvigilantegraffiticheating wifeheart attackgirl in pantiestransvestitetv newspornographywaitersupermarketno pantiesnipples visible through clothingsexual abusesexual attractioncookvandalismexercisedemonstrationoverallsmagazinedysfunctional marriageswimsuitskateboardcommunitynaked womanclockretirementplaygroundboxer shortshypocrisymobile phoneunfaithful wifemiraclefeministpost traumatic stress disordermedicationcard playingskateboardingadvertisingpedophileperversionrainstormswingmarital separationmale full rear nuditycastrationnotedressing roomduct tapenervous breakdownbrushing teethreckless drivingpajamasirreverenceposterreflectionadulterous wifehandshakeharassmentunhappy marriagemultiple storylinegatepedophiliamisogynistparenthoodblue pantieschild molestationstairwaysexual tensionmalltv reporterloud sexknocked unconsciousmegaphoneemergency roomtow truckfootball teamchild molestercircular staircasenakedpolice sirenloudspeakerremarriageguard dogsexual pleasureswimwearsidewalkskateboarderforklifttalking to oneselfdocumentary filmmakerwoman moaning from pleasurewoman moaningmoaning womansee through pantiesbutt nakedwashing dishesextreme closeupprobationflyersex offendernational guardpurple pantiessearchlightfigurinetalking during sexcoin tosshomeland securityfilm editorrubber glovesstuffed toydeliberate crueltytoy traininternet pornographynaked mantemper tantrumfilm editingindecent exposurebaby strollerlifting up dressdiscontentsnorkelbook clubpromiscuous motherrest stopsnorkelingupper middle classediting roomcaught watching pornographykleenexcriminal recordretired policemanreference to michael mooresniffing pantiesunhappily married womancataloguebaby car seatwomen wearing a one piece swimsuitleftoverspublic swimming poolpedophile witchhuntprom kingsurrogate sisterbar examhouse husbandreference to madame bovaryreference to pbstouch footballcar impoundfed exconsulting firmdiving maskswim flipperswater wings (See All) |
After finding himself at the constant abuse of his best friend, Bobby, Marty has become fed up with his friend's twisted ways. His girlfriend, a victim of Bobby's often cruel ways, couldn't agree more and they strategize murdering Bobby, with a group of willing and unwilling participants in a small …Florida town. In the midst of their plotting, they find themselves contemplating with the possible aftermath of what could happen. (Read More)
Subgenre: | independent filmmurder conspiracy |
Themes: | theftdrunkennessdrinkingfriendshipmurderdeathrevengedrugsrapepregnancyparanoiadrug useabusebullyingcruelty …panicabortionrevenge murdercar sex (See All) |
Mood: | murder plot |
Locations: | small towncarbarbeachnightclubcourtroomgay barsex in carsex in a carsex on carsex in the backseat of a carsex on a car |
Characters: | teenage girlsheriffteenage boythiefstudentboyfriend girlfriend relationshipfriendmother daughter relationshipfather son relationshipmother son relationshipfamily relationshipspolicehomosexualteenagerbrother brother relationship …brother sister relationshipprostitutegay sexpolicemandancerbest friendbullyhitmanwaitresscatholiccousin cousin relationshipgay teenageraunt nephew relationshippolice arrestdirector on camerago go boy (See All) |
Story: | high school studenttopless female nuditywhite pantiesbreastrear nuditynippledrug abusebuttocksbaseball batstrippingtoplesscleavagevomitingbare buttdrink …underwearbeatingcryingpantiescigarette smokingfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare chested malebare breastsbloodnudityviolencemale frontal nuditydoggunsex scenedancingknifelesbian kissleg spreadingbased on true storytelephone callfondlingbased on bookcell phonemirrorurinationpunched in the facewatching tvarrestbirthdaydead bodymarijuanabathroombisexualgay slurstabbingdeath of friendthroat slittingstabbed to deathstabbed in the chestscantily clad femalebirthday partystabbed in the backsuburbpremarital sexteenage sexwaiterpot smokingsociopathstabbed in the stomachstealingnosebleedfloridasurfingskateboardrape victimrapistmale prostituterap musicsufferingunderage drinkingpunched in the stomachsex talkpanties pulled downblack eyecasual sexbruisephysical abusemarijuana jointteenage pregnancydirector cameopromiscuous womantrue crimeacidsurferbully comeuppancepregnancy teststabbed in the armpeer pressurelsdnude girlmale stripperstonednihilismwhite trashplaying a video gametopless girlcinema veritemale prostitutionford mustangsitting on a toiletdeath sentencenatural breastssmall breastswatching a videobronx new york cityabusive boyfriendelectric chairnakeddate rapecloseted gaytechno musiccanaldrug tripsittingcrotch shotbutt nakedsexual torturesnorricamvideo arcadeaccompliceclubbingcamel toeguilty consciencegirl toplessprison sentencedobermangay pornwatching pornographywashing handsgay for payrepressed homosexualgirl rear nudityunsafe sexcomic book shopdrinking and drivingduitelephone sexteenage rapedrug rehabwatching a porn videodangerous friendhallucinogenic drughigh school dropoutfriends falling outvictimizationclothespinacid the drugmortal kombatclothespin on nipplespolice busthot candle waxburyingroller bladingidle richbad parentsclubberpizza hutcrotch slipsex on the hood of a carmustang convertiblesandwich shopsitting on the toiletaccessory to murderexploitation of friendshipmale wearing thongsex in backseat of carteen pregnancywatching porn on tvwatching pornographic filmcutoff shortsfemale nudity reflected in a mirrorspinning camera shotwatching a music videonaked on the telephonestanding naked in front of a mirrorwatching a gay porn videowatching gay porn (See All) |
It's the last day of school at a high school in a small town in Texas in 1976. The upperclassmen are hazing the incoming freshmen, and everyone is trying to get stoned, drunk, or laid, even the football players that signed a pledge not to.
Subgenre: | teen moviecoming of ageindependent filmcult film |
Themes: | robberydrinkingfriendshiprevengedrugsracismdrug usegamblinghomophobia |
Mood: | high schoolcar chaseone night |
Locations: | texassmall towncarbarbicyclebaseballsinging in a carschool dancefire escape |
Characters: | teenage girlteenage boypolice officerstudentteacherboyfriend girlfriend relationshipfriendmother son relationshipfather son relationshippoliceteenagersingerbrother sister relationshipalienpoliceman …bully (See All) |
Period: | 1970syear 1976 |
Story: | pickup truckhigh school seniorwhipped creamconvenience storecoachclasscheerleaderclassroombeerrifledrinkdreambeatingpartycigarette smoking …kissgunfightsingingchasesongshotgunslow motion scenepunched in the faceliemarijuanaguitargay slurdrug dealerfootballdrivingspankingmarriage proposaljeanssuburbliarconvertiblegymrock 'n' rollredheadsexual fantasypot smokingcard gameteen angstbeer drinkinglistening to musicvandalismmale bondingoverallsvietnam warinterracial friendshipembarrassmentdrug dealingunderage drinkinghippienostalgiasexismsex talkcigarette lighterone dayslackerpublic humiliationreckless drivingsmokemarijuana jointvietnam veteranbonglong hairabuse of powerpaintname callingstoneridealismcar washstonedhazingmailboxguitar playerjockunderage smokingwet t shirtreference to abraham lincolncruisingdrug humordelivery manjunior high schooljuvenile delinquencypool hallbaseball fieldfamous linejerkaustin texasvolkswagen beetleliquor storeinitiationmidnightpaddlecliquereference to led zeppelinpinball machineleashreference to george washingtontrashcanrite of passageketchupbowling ballreference to isaac newtonstudent athletebroken windshieldfoosballfootball fieldmuscle carschool lockerdollar billrebelliousnessflourindependence daymustardbeer kegcut off jeans8 tracklast day of schoolclassic rock musicpaddlingpledgereference to gerald forddrive in restaurantpacifiermugglereference to deep throatwet hairdelivery truckreference to joseph mccarthybell bottomscar enginepontiac gtobicentennialjunior collegereference to bob woodwardreference to carl bernsteincollar and leashbottle caprecreation centerchevrolet chevellehigh school freshmanmood ringreference to aerosmith the band1968 democratic conventionhigh school juniorpolyesterbeer bustbeer runreference to the madonna (See All) |
After a little white lie about losing her virginity gets out, a clean cut high school girl sees her life paralleling Hester Prynne's in "The Scarlet Letter," which she is currently studying in school - until she decides to use the rumor mill to advance her social and financial standing.
Subgenre: | teen movieteen comedyteen sex comedy |
Themes: | drinkingreligionfriendshipmarriageinfidelityadulteryextramarital affairdivorceguiltunfaithfulnessdatinghomophobiaadoptiondevilreligious intolerance |
Mood: | high schoolsatire |
Locations: | restaurantschoolchurchswimming poolkitchensinging in the shower |
Characters: | teenage girlteenage boychristianstudentgirlteacherboyboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshipfather son relationshipfamily relationshipshusband wife relationship …homosexualteenagersingerbrother sister relationshipprostitutefemale protagonistpriestbest friendreference to godchristianityteacher student relationshipbiblecatholicolder man younger woman relationshipgay teenagerolder woman younger man relationshipgay friendreligious fanaticreligious teen (See All) |
Period: | 2010s |
Story: | high school girlhigh school studentpep rallymascotpopularityclasscrosscheerleadermini skirtlocker roomcleavagestripperprayerclassroomcafe …tearsbeerdrinkcryingpantiespartyfemale nuditybare chested malekissdogtwo word titlesex scenephotographsingingshowertelephone callcell phonesongmirrorface slapslow motion scenewatching tvcondomliesunglassesvibratorbirthdaymarijuanareference to jesus christguitargay slurbedroomcaliforniabasketballdinnerfalse accusationscantily clad femalespankingtalking to the cameraconfessionmicrophonevirginprotestliarmoaninggymamerican flaggardengraffitifreeze framemachismoscandalcloseted homosexualwaiterhuggingpot smokingloss of virginityfaintinghappinessdemonstrationgossipfloridaone night standvirginitypreacherembarrassmentmovie theatrebloody noserap musiccynicismhypocrisyministerpunched in the stomachaquariumtime lapse photographyhit on the headpanties pulled downbookstorebelief in godcliffred pantiesclassmatelooking at self in mirrorpastorbigotrypromiscuityfast motion scenesouthern accentoutcastreference to facebooksneakerswoman cryingcafeterianame callingconfessionallegsrumorpeer pressureschool principalfascistprincipalfriendship between girlsacceptanceadopted soncdman in swimsuitguitar playertolerancevolkswagenchick flickreference to googleweekendallergytextingsewingborn again christiandetentionunwanted kissinterracial adoptioncloseted gayinner title cardgay pridemotor scootercheerleader uniformvolkswagen beetleimplied nuditypreachingreputationhappy birthdayice cream coneenglish teachercliquejumping on a beddevil costumegeneration yreference to marlon brandoteen drinkingpetitiongazebospin the bottleabstinencereference to tom cruiseinfamyguidance counselorwebcastbelief in the afterlifespellingwater slidewatching a movie on tvinnuendoreference to mark twaingay man straight woman relationshipbelief in hellpunched in the gut22 year oldsleazecommunity collegevespastdreference to disneylandadoptive father adopted son relationshippicture framemopping a floorpuritangreeting cardcomedic sex sceneenglish classnotorietyprincipal's officeschool suspensionanagramgirls' bathroompledgereference to huckleberry finnpietyschool bandcouponorange the fruitschool boardchocolate milkmascot costumebelief in the deviladoptive mother adopted son relationshipcontact lensessatan worshipbumping into someonestudent councilbad reputationprayer groupreference to alfred kinseycarpoolstate flagthrowing a cell phonebirth control pillreference to home depothand signaljesus freakporno theatrereference to ashton kutcherreference to costcoreference to demi mooreearth dayreference to disney worldhigh school gymnasiumreference to john hughesschool mascotchlamydiafake sexkissing gamepeasrumor mongerschool detentionsharpening a penciltowel snappingcleaning a bathroomcommunity gardenreference to google earthreference to sylvia plathreference to the scarlet letterspreading rumorbreaking a picture framegift cardreference to nathaniel hawthorne (See All) |
Adele is a high school student who is beginning to explore herself as a woman. She dates men but finds no satisfaction with them sexually, and is rejected by a female friend who she does desire. She dreams of something more. She meets Emma who is a free spirited girl whom Adele's friends reject due …to her sexuality, and by association most begin to reject Adele. Her relationship with Emma grows into more than just friends as she is the only person with whom she can express herself openly. Together, Adele and Emma explore social acceptance, sexuality, and the emotional spectrum of their maturing relationship. (Read More)
Subgenre: | coming of age |
Themes: | loveinfidelitylesbianismunrequited lovehomophobiabreak upcheatingfirst lovelesbian love |
Mood: | high school |
Locations: | schoolfrancemuseumgay barschool teacherlesbian bar |
Characters: | teenage girlstudentgirlteacherboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshipteenagerchildrenfemale protagonistactorartistlustfrench …lesbian relationshipgay friendcheating girlfriendhomosexual teenagerhomosexual kisssame sex kiss (See All) |
Period: | 2010s |
Story: | female teacherhigh school studenttopless female nuditywhite pantiesnaked buttbreastrear nuditymini dressnipplebuttocksclasstoplesscleavageclassroomtears …bare buttcryingpantieserectionpartynipplescigarette smokingfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare chested malebare breastskissnudityf ratedcharacter name in titlemale frontal nuditymasturbationsex scenefemale full frontal nudityfingeringlesbian kissleg spreadingbreast suckingface slapkissingsex in bedpainting69 sex positionmale pubic haircolor in titlecookingbased on comic bookbreast sucklinglesbian cunnilingusdinnerno opening creditsscantily clad femaledrawingbirthday partycontroversylesbian interestfive word titleparksmokingprotestmoaningfull frontal female nuditydatekissing while having sexteenage sexfull frontal nuditygirl in pantiessexual fantasyfemale stockinged legslgbtno pantiesdemonstrationcrying womanbuttteenage protagonistart gallerysexual desiremovie theatrebreakupco workerlesbian couplepanties pulled downsketchfamily dinnerbenchfemale in showerseparationexplicit sexfemale female kisssexual awakeningheartbreakfingering vaginateenage loveloud sexsolitude18 year oldyoung womannude girlcigarettebased on graphic novelactress shares first name with characterteenage sexualitygay clubtopless girlhouse partyart exhibitionteenage crushnude modelingspaghetticourtshipaspiring actorposing nudewoman moaning from pleasurewoman moaningblue hairmoaning womanbutt nakeddinner tablekindergartenfemale artistwoman's bare buttoysterfingering a vaginagirl toplesshomophobic slurpurple pantiespastaestranged couplesocial classteenage romancegirl rear nudity9 11bare butt womanfemale tearslesbian loverscissoringlesbian teenspooningbare assteen sexualitygay pride paradeyoung female sexualitybutt grabaspiring artistsitting on a benchmanifestationsexual orgasmwhite winekindergarten teacherreference to jean paul sartretouching breasttoasting with a drinklicking nipplenipple lickingobject of desirepassionate kissingsucking breastsblack tightspantingpainter as artistsleeping on a benchlicking someone's nippleslesbian sex scenelicking nipplesmultiple sex positionsopening creditsportrait drawingposing for a portraitmerkin wigpassionate lesbian sexreference to gustav klimtreference to louise brookslille francescissors sex positionliterature classbare bottomgirl on topreference to egon schieleromantic literaturespooning nudethrown out of apartment (See All) |
Jim, Oz, Finch and Kevin are four friends who make a pact that before they graduate they will all lose their virginity. The hard job now is how to reach that goal by prom night. Whilst Oz begins singing to grab attention and Kevin tries to persuade his girlfriend, Finch tries any easy route of sprea …ding rumors and Jim fails miserably. Whether it is being caught on top of a pie or on the Internet, Jim always ends up with his trusty sex advice from his father. Will they achieve their goal of getting laid by prom night? Or will they learn something much different? (Read More)
Subgenre: | teen moviecoming of agecult filmfairy talesex comedyteen comedyteen sex comedycoming of age film |
Themes: | drunkennessfriendshipvoyeurismredemptionhumiliationfirst love |
Mood: | high schoolpoetic justice |
Characters: | teenage girlteenage boystudentboyfriend girlfriend relationshipfriendfather son relationshipteenagerbrother brother relationshipmusicianbullylustolder woman younger man relationshipself discovery |
Period: | 1990s |
Story: | high school studenttopless female nuditywhite pantiesbreastmini dressnipplemini skirtlocker roomstripteasepublic nuditystrippingtoplessbracleavagevoyeur …beerundressingpantieserectionpartynipplesfemale frontal nudityfemale nuditymale nuditybare chested malebare breastsnuditysexflashbackmasturbationtwo word titledancingtitle spoken by characterleg spreadingslow motion scenevideo cameradinertoiletinternetscantily clad femalelibraryvirginfirst of seriesmoaningfemale removes her clothespremarital sexmonkeygirl in pantiesdestinyteen angstcountry name in titleno pantiesnipples visible through clothingloss of virginitysexual attractiontitle based on songmale bondingcaucasianvirginitypeeping tomfood in titlesexual desirestupiditybra and pantiesmale masturbationinnocenceunderage drinkingpool tablesex talkpanties pulled downchoircrude humorgraduationporn magazineoutcasthiding in a closetvomitdefecationgolf clubwebcamidealismsexual promiscuitymisfitwetting pantspietopless girlpromjockmichiganunderage sexfablebra removingscatological humorangsthedonismnakeddiarrheapremature ejaculationpanties hit the flooridiotgross out humorwoman moaning from pleasurewoman moaningmoaning womangirl stripped down to pantiessex with foodsex on pool tablelosing virginityexchange studentgirl toplesswatching pornographyauditoriumpactlake houselaxativelacrossefemales talking about sexremoving a braspy cameraunconventional masturbationfour best friendsprom nightfoolishsupergluereference to casanovapush up brakeg partysex discussionreference to jurassic parkband camp (See All) |
Sutter Keely lives in the now. It's a good place for him. A high school senior, charming and self-possessed, he's the life of the party, loves his job at a men's clothing store, and has no plans for the future. A budding alcoholic, he's never far from his supersized, whiskey-fortified thirst-master …cup. But after being dumped by his girlfriend, Sutter gets drunk and wakes up on a lawn with Aimee Finecky hovering over him. She's different: the "nice girl" who reads science fiction and doesn't have a boyfriend. While Aimee has dreams of a future, Sutter lives in the impressive delusion of a spectacular now, yet somehow, they're drawn together. (Read More)
Subgenre: | coming of age |
Themes: | drunkennessdrinkingjealousyfriendshipmarriagemoneydancememorydivorcedeath of fatherdatingbreak upalcoholismfalling in lovesuicide of father |
Mood: | high school |
Locations: | barhospitalswimming poolbaseballbus driverwater gun |
Characters: | teenage girlteenage boygirlteacherboyfriend girlfriend relationshipfriendafrican americanmother daughter relationshipmother son relationshipfather son relationshipfamily relationshipshusband wife relationshipteenagerbrother sister relationshipdancer …best friendreference to godsingle motherteacher student relationshipex boyfriend ex girlfriend relationship (See All) |
Story: | pain killerpickup truckhigh school seniorconvenience storewhiskeyclassbraclassroomtearsbeerdrinkcryingpartycigarette smokingfemale nudity …bare chested malekisssexbased on novelflashbackdancingshowertelephone callvoice over narrationcell phonecar accidentslow motion scenecomputersecretliesunglassesreference to jesus christalcoholtelephonef wordmontageapologyhit by a carbartenderflash forwardprologuefired from the jobstorytellingreadingwaterfallsleepingtrustteenage sexblack americanhuggingloss of virginitycomic bookhappinesscheating husbandcrying manpromiseunderage drinkingbackpackfirst kissabsent fatherpridebookstorephiladelphia pennsylvaniareckless drivingwoman in underweartext messaginghandshakeloss of jobdead fatherjukeboxhangover17 year oldflask18 year oldknocking on a doorwoman in bra and pantiesunhappinessgiving a toastpromsecond chancecollege campusbouncerfather son reunionwhite brabeggingmiserystudyinghomeworkhigh school graduationtelephone numberpassing outstore clerkgeneration ykiss on the foreheadfootball fieldporchabandoned by fatherdumped by girlfriendhigh school prompart time jobi.d.big sisterfirst sexreference to nasateenage drinkingjumping into a swimming poolbreakfast cerealgeometryschool cafeteriayellow dresstutoringbaseball pitcherarm in a slingcollege applicationreference to californiareference to texasfear of failuredrinking on the jobhip flaskmen's clothing storedelivering newspaperreference to mexicoprom datewaiting for someonerefusing a handshakedrunken drivinglooking into a window (See All) |
Camden College. Sean Bateman is the younger brother of depraved Wall Street broker Patrick Bateman. He's also a drug dealer who owes a lot of money to "fellow" dealer Rupert Guest, as well as a well-known womanizer, for he sleeps with nearly half of the female population on campus. Lauren Hynde is, …technically, a virgin. She's saving herself for her shallow boyfriend, Victor Johnson, who's left the States to backpack across Europe. Her slutty roommate, Lara, has the hots for Victor as well. Paul Denton, who used to date Lauren, is openly bisexual and attracted to Mitchell Allen, who's dating Candice to prove to Paul that he's not gay. Sean loves Lauren. Paul loves Sean. And Lauren may love Sean. (Read More)
Subgenre: | independent filmcult film |
Themes: | drunkennessdrinkingdeathsuicidedrugsrapemoneyvoyeurismseductiondrug usedatingunrequited lovecheating |
Mood: | satire |
Locations: | buscarrestauranthospitalhotelsnowmotorcycleparis francebathtublondon englandbathtub suicide |
Characters: | studentdoctormother son relationshiphomosexualsingerdancerlove trianglegay kissprofessorlove lettersuicide by slashing one's wrists |
Story: | black bratopless female nudityhit in the crotchnippledrug abusebaseball batpublic nuditytoplessbrasubjective cameracleavagevoyeurcafetearsbeer …vomitingbare buttthongundressingdrinkunderwearbeatingcryingpantiespartynipplescigarette smokingfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare breastsnuditybloodkisssexbased on novelflashbackmale frontal nuditymasturbationdoggunfemale full frontal nuditydancingsingingknifetelephone callvoice over narrationsongmirrorurinationblondepunched in the facewatching tvcomputercondommasksunglasseslingeriemarijuanabathroomcollegemale pubic hairguitarbisexualgay slurcandlevideo cameraambulancedrug dealermontagecocainesuicide attemptnonlinear timelinescantily clad femaleroommatespankingcharacter repeating someone else's dialoguevirginprologuekaratefantasy sequencecharacter's point of view camera shotsplit screenrock 'n' rolleuropefreeze framegirl in pantiessexual fantasyno pantiesloss of virginitymacheterome italyskateboardblack humorvirginityend of the worlddead womantoweldrug dealingdrug overdosereverse footagebloody nosepillsboxer shortstime lapse photographyraised middle fingerlens flareswitzerlandbrushing teethpromiscuitywoman in bathtubdesert eagledormitorymultiple storylinebongplaying pooldefecationcafeteriaeiffel tower parisnudeanal rapepush upsnude girlamsterdam netherlandswetting pantsvenice italywrist slittingmailmailboxpipetopless girlnaked dead womandublin irelandcollege campusfootball teamrepeated linebarcelona spainreference to michael jacksonteen suicidedate rapejack o'lanternburning manmultiple perspectivesfilm studentflorence italyclarinetlaundry drying on clothes lineshooting uplawn sprinklerwoman in a bathtubabstinencevenereal diseasewhitespitting on someonemultiple narratorsecstasy the drugfag hagcollege girlcollege freshmandead body in a bathtubstream of consciousnessbleachersrewinddead woman in bath tubdead body in bathtubpurplereference to johnny deppsoft focuskegbelly buttoncredits rolling downinner monologuekleenexfreebasingbloody bathtubreference to clara bowreference to gabriel garcia marqueztheme partytowel on headcommitting suicide while nakeddead woman in bathtubdartmouth collegekegger (See All) |
This story is a narration from an Australian man who falls in love with two kinds of Candy: a woman of the same name and heroin. The narrator changes from a smart-aleck to someone trying to find a vein to inject, while Candy changes from an actress, call girl, streetwalker, and then a madwoman. Star …ting in Sydney, the two eventually end up in Melbourne to go clean, but they fail. This leads them to turn to finding money and heroin, while other posessions and attachments become unimportant. (Read More)
Themes: | theftrobberydrinkingdeathmarriagedrugsmoneyadulterypregnancyweddingdrug usemental illnessabortiondrug addictionmadness |
Mood: | rain |
Locations: | restauranthospitalswimming poolbathtubkitchenwheelchairaustraliabrothelsex in carsex in a toilet |
Characters: | thiefgirldoctorboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipfamily relationshipshusband wife relationshiphomosexualtattooprostitutegay sexbabyartistlust …professorpregnant wifeself destructivenessart student (See All) |
Story: | pickup truckpink pantiesblurry visionwhipped creamwashing machinehead injurychickenmini skirtpainbracleavagecafetearsbeervomiting …bare buttundressingdrinkunderwearcryingpantiesnipplescigarette smokingfemale frontal nudityfemale rear nudityfemale nuditymale nuditybare breastskisssexbloodcharacter name in titlebased on novelone word titlefightphotographtitle spoken by characterleg spreadingsurprise endingshowertelephone callvoice over narrationfoodmirrorface slapwatching tvcameracondompaintingbookliesunglassesmarijuanabathroomprostitutionswimmingcookingwinevideo cameradrug dealerapologypainterscantily clad femaleunderwater scenemarriage proposalparkdrug addictumbrellareadingbankringflowersfemale removes her clotheschildbirthheroineyeglassesshavingpot smokingsupermarketsyringeaddictionhypodermic needledrugstealingmale underweardrug overdosemental institutionmale prostitutehookershopliftingjunkiemental hospitaldespairamusement parkred pantiesnervous breakdownbenchalarm clockwedding receptionhustlermiscarriagemarijuana jointreal estate agentgirl in bra and pantiesneedlemoney problemsmental breakdownevictionsydney australiaoverdosewalletcall girlcar washpharmacystonedecstasybaseball capjointrazor bladeurinalmale prostitutionpawnshopescortaspiring actressmorphineheroin addictwaitingfetussmoking potmcdonald's restaurantsurrogate fatherchopping wooddrugstorecrossword puzzlestealing moneymelbourne australiahoneyice cubeautomated teller machinebohemianwriting on a wallpublic toiletdishwasherdrug rehabilitationdrug withdrawalshooting upbank tellerdrug pushergay hustlerconfettireference to tarzanstreet walkermen's toiletpillow talkstitchescompulsionpawnbrokerskylightamusement park ridecredit card fraudjamwatching a cartoon on tvcold turkeysugar daddydetoxmethadonecrackerhemorrhagemaking a bedstillborn childco dependencydishwashingwriting in lipstickmale wearing a thongripping a telephone from the wallheroin withdrawalreference to e.e. cummingsfrozen chickenhay balingheroin detoxsex for moneyinside a car in a car washintravenous injection (See All) |
Jim Levenstein has finally found the courage to ask his girlfriend, Michelle Flaherty to marry him. She agrees to get married, but the problems don't stop there for Jim. Now along with Paul Finch and Kevin Myers, Jim must plan the wedding. Unfortunately Steve Stifler is in town and won't let the wed …ding go past without having some fun himself, which includes setting up a secret bachelor party. (Read More)
Subgenre: | cult filmsex comedyslapstick comedy |
Themes: | drinkingfriendshipmarriageweddingvoyeurismredemptionhumiliation |
Locations: | school bussmall townrestaurantbarbeachbathtubairportwheelchairchicago illinoisgay barsex in publicsex in a bathtubsex in a restaurant |
Characters: | teenage girlteenage boyfriendfather daughter relationshipmother daughter relationshipmother son relationshipfather son relationshipfamily relationshipshomosexualdancersister sister relationshiplove trianglejewishlustolder woman younger man relationship …fiance fiancee relationship (See All) |
Period: | 2000s |
Story: | black pantieswhite pantiesfootball practicemini dresssexual humorfootball playerhit in the crotchamerican footballcoachmini skirtpublic nuditystrippingcleavagestrippervoyeur …drinkunderwearpantieserectionpartyfemale frontal nudityfemale nuditymale nuditykisssexsequelthreesomemasturbationbondagedogtwo word titledancingleg spreadingtelephone callfondlingcell phonetesticlesfoodbathroomhandcuffsgay slurbandold manmontageeatingdinnerapologyscantily clad femalespankingthird partold womanmarriage proposalduelpay phoneon the roadmistaken identityflowersgymfemale removes her clothespremarital sexobscene finger gesturegrandmotherwhippingrecord playergirl in pantiestransvestiteeavesdroppingwaitercountry name in titlenipples visible through clothingfarcecakesexual attractionred dressanimal attacks&mpeeping tomsexual desirestupiditypet dogsexy womandeceitwedding ringwedding dresscrude humorwedding receptionwoman in bathtubdjgirl in bra and pantiesillusionirish americanexotic dancerfemale removes her dressredheaded womanwoman in bra and pantiesmooningcdtransvestismrole reversalmichiganbestialityhorninessnymphomaniacfootball teambachelor partyriding cropthird in seriesangstbride and groomsexual humiliationsausagedance lessonwedding cakesexual pleasureidiotgross out humorpayphonedouble entendresee through pantiesbridesmaidsex with foodhighway travelfemale in bra and pantiesfloristmaid uniformreference to platorite of passageleather pantsreference to aristotledog fecesengagement partylaw schoolsex with an animaluninvited guestair ventgingerbuffetnew york universityparty crashinggraduation partyreference to voltairedog licking someonesex with a doggentiledog humping someone's legfamily dogpants around anklesresort hotelinterfaith marriagesporting goods storedog licks someonefuture in lawspet dogspolicewoman costumelicking dogpost collegeben wa ballsbody shavingjew gentile relationshipreference to descartesmistaken assumptionoral sex under a tablereference to ron jeremyblow job under a tablegoylost trousersvows (See All) |
In tiny Anarene, Texas, in the lull between World War Two and the Korean Conflict, Sonny and Duane are best friends. Enduring that awkward period of life between boyhood and manhood, the two pass their time the best way they know how -- with the movie house, football, and girls. Jacey is Duane's ste …ady, wanted by every boy in school, and she knows it. Her daddy is rich and her mom is good looking and loose. It's the general consensus that whoever wins Jacey's heart will be set for life. But Anarene is dying a quiet death as folks head for the big cities to make their livings and raise their kids. The boys are torn between a future somewhere out there beyond the borders of town or making do with their inheritance of a run-down pool hall and a decrepit movie house -- the legacy of their friend and mentor, Sam the Lion. As high school graduation approaches, they learn some difficult lessons about love, loneliness, and jealousy. Then folks stop attending the second-run features at the movie house and the time comes for the last picture show. With the closure of the movie house, the boys feel that a stage of their lives is closing. They stand uneasily on the threshold of the rest of their lives. (The movie was adapted from the novel by Larry McMurtry). (Read More)
Subgenre: | teen moviecoming of age |
Themes: | jealousyfriendshipdeathlovekidnappingmarriageinfidelitychristmasmoneyadulteryfuneralextramarital affairdepressionguiltunfaithfulness …illnesswealth (See All) |
Mood: | high school |
Locations: | texasbussmall townrestaurantcemeterylakemotelmexicosex in a car |
Characters: | teenage girlsheriffteenage boychristianteacherboydoctorboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipfamily relationships …husband wife relationshiphomosexualteenagersingerbrother brother relationshipdancerwaitressalcoholicolder man younger woman relationshipemployer employee relationshipolder woman younger man relationshipself discoverystepfather stepdaughter relationshipu.s. soldieramerican dream (See All) |
Period: | 1950s |
Story: | pickup truckhigh school studentquarterbackhigh school footballheartfootball playeramerican footballcoachclasscheerleadersubjective cameraclassroomcafebeerrifle …bare buttundressingcryingpartycigarette smokingfemale frontal nudityfemale nuditymale nuditykissbased on novelmale frontal nuditygunfightdancingejaculationsingingchasesongblondewatching tvsecretbookcollegeprostitutionjailbasketballapologycoffinfishinggarter beltfemme fatalegraveyardcoffeeskinny dippingvirgincowboycharacter's point of view camera shotdebtbankconvertiblegymdeath of brotherdeath of sonrecord playerflirtingpoemteen angstrecordingcooksanta clausmovie theaterwristwatchvirginitypreachermexicanbloody noseunderage drinkingnostalgiamutementorfather figureraised middle fingerbeteye patchstadiumadolescentpillpiano playerimpotencenude swimmingsexual awakeninganniversarypresentgraduationchristmas presentplaying pooltexanjukeboxhangovernaivetycattlefish tankflaskpeer pressuremaking outlistening to a radiohit by a truckdamamericanarodeochewing gumperfumefootball teamdisillusionmentchild molesterneglected wifemarital infidelitypool hallbreaking a bottle over someone's headoklahomakorean warelopementforty somethinghigh school graduationbroomenglish teacherensemble filmlorddoctor's officehard hatgym classchristmas decorationtrystdiving boardoil companysombrerobourbonmilitary enlistmentwallpaperyear 1952highway patrolrolling a cigaretteretardationstop signtumbleweedyear 1951hero worshipschool banddrive in restaurantpoetry quotesex on a billiard tablephysical educationwardmaturationwestern musicabandoned theatrementally handicapped personflatbed truck45rpm recordneckingthe one that got awaymercury the carreference to john keatstowel snappingathletic coachgraduation presentoilmanpopcorn machine (See All) |
Dawn grows up in the shadow of a nuclear power plant. In high school, while her biology class studies evolution, she realizes she may have a hidden curse, an "adaptation." She lives with her mom, step-father, and hard-edged step-brother. She likes Tobey, a guy at school, and he likes her. She takes …a pledge to remain chaste until marriage, so they date in groups, watch G-rated films, and don't kiss, but the power of teen hormones is great, so temptation beckons. Dawn has an admirer in Ryan, and when when things have an unexpected twist with Tobey, she turns to Ryan for help. Will he be her mythical hero and rescue her? Or can she find her way as her own hero, turning the curse into an asset? (Read More)
Subgenre: | coming of ageindependent filmblack comedypunk |
Themes: | religionmurderdeathloverevengerapedeceptionseductionlonelinessdysfunctional familyguiltsexualityillnessevilvengeance …police investigationmythologyevolutionfear of sex (See All) |
Mood: | high schoolgorerainnightmaremythblood and goreancient myth |
Locations: | police carhospitalbathtubbicyclecavegas station |
Characters: | teenage girlteenage boystudentnursegirlteacherboydoctorboyfriend girlfriend relationshipfriendmother daughter relationshipfather son relationshippolicehusband wife relationshiptattoo …dancerstepfather stepdaughter relationshipstepbrother stepsister relationshipstepmother stepson relationship (See All) |
Story: | female studentadolescent girlhigh school girlhigh school studenthigh school boyadolescent boysex educationvulgaritysexual humorsurgeryclassprofanitylocker roomclassroombeer …dreamcigarette smokingfemale frontal nuditymale rear nuditynuditykissbloodviolenceflashbackmale frontal nuditymasturbationdogsex scenefightfingeringdancingtitle spoken by charactershowercell phonecorpseblood splattermirrorpunched in the facewatching tvcomputercondombookvibratorbedmale pubic hairguitarswimmingbedroomflashlightcandledrawingbathsearchmicrophonevirginchampagnelightningringattempted rapescargymspeechgiftdatepremarital sexwaterfalldismembermentteenage sexsexual fantasypot smokingjeeplistening to musicpropagandamutantmutilationmorguewatching a movieswimsuitvirginityhitchhikingmoralitypromisemovie theatrepillssevered fingerresearchdark humorlove at first sightfirst kissperversiondeceitturtlecliffbetcastrationclassmatelooking at self in mirrormutationsexual assaultstolen carsexual awakeningbonghigh school teachermetaphortemptationsexual perversionself defensemaking outknocking on a doorbubble bathpiercinggiving a toastbitten in the neckbody bagteethhorninesspondbleeding to deathfilling stationgropingsexual repressionrattlesnakedeath by drowningtoy gunhymntalking about sexgynecologistdog attackgrudgebitecandlelightsurgical operationbitingsexual arousalsexual intercoursefingerstrobe lightnuclear power plantstepsisterfemale sexualityoverheard conversationgynecological examfemale empowermentserpentsevered penisdog bitefinger cutconservatismindoctrinationchastity beltscuba diverfinger bitten offteenage rapestepbrotherblood spurtingintelligent designbb gunchastitypurityschool assemblyheavy metal musicill motherpledgeclimbing a ropevoice over readingrebellious sondysfunctionalitygynecologyspilling a drinkself disciplinevagina dentatafemale classmatemale sexualitysexual abstinenceneck woundtoy rabbitself repressionsex education bookwatching a cartoonfinger bite (See All) |
Seth and Evan are best friends, inseparable, navigating the last weeks of high school. Usually shunned by the popular kids, Seth and Evan luck into an invitation to a party, and spend a long day, with the help of their nerdy friend Fogell, trying to score enough alcohol to lubricate the party and in …ebriate two girls, Jules and Becca, so they can kick-start their sex lives and go off to college with a summer full of experience and new skills. Their quest is complicated by Fogell's falling in with two inept cops who both slow and assist the plan. If they do get the liquor to the party, what then? Is sex the only rite of passage at hand? (Read More)
Subgenre: | teen moviecoming of agecult filmblack comedyteen comedy |
Themes: | robberydrunkennessjealousyfriendshipdrugsdancevoyeurism |
Mood: | high schoolone night |
Locations: | police carbusrestaurantbarschool |
Characters: | teenage girlteenage boypolice officerfriendmother son relationshipteenagerbest friendpolice chasefrench kiss |
Period: | 2000s |
Story: | high school girlhigh school boyboy with glasseshigh school seniormini skirtstripteaseman with glassesbracleavageclassroomvoyeurthongundressingpantiesparty …cigarette smokingkisssexviolenceone word titleflashbackmasturbationsex scenedancingsinginglabiapistolcell phonecar accidentslow motion scenepunched in the facebrawlmarijuanagay slurcookingthroat slittingcocainescantily clad femaledrawinghit by a carsuburbfantasy sequenceproduct placementkicked in the facepremarital sexsexual fantasysupermarketteen angsthead buttdesireloss of virginitybeer drinkingcaught having sexcrushembarrassmentbra and pantiesunderage drinkingshopping mallhawaiiblack eyeone dayvodkainterrupted sexintimidationvideo surveillancebongmenstruationmolotov cocktailspit in the facevomitblue pantieshot dogdepartment storeunderage sexunderage smokingspitcar set on firesoccer balldrug humortalking about sexclumsinessbromancecamera focus on female butttribadismliquor storewoman initiating sexgirl stripped down to pantiesstudio logo segues into filmcamel toegeneration yburning cargangsta gripvhs tapefake idpink brapopsicledrunken sexgirl stripped down to bramenstrual bloodbourboninternet pornographyphallusdorkvestartificial legsobrietywoman undressing for a manparty invitationcell phone camerafoot racesleep overasthma inhalerunexpected kissadult magazinejoyridingmyspacepumapanties slipfunky musicman refusing sexteetotalerstill images during end creditsflip phoneimitating fellatiobaking a cakegrindingcrotch sliptalking about pornstealing alcoholdetergenthome economicsvisible thong strapsbeer runcamera focus on female chest (See All) |
Erin Grant loses care and custody of her daughter when she's divorced from her husband Darrell, a small-time thief. Struggling for money, she is a dancer at a nightclub, where one night Congressman Dilbeck (in disguise) attacks another member of the audience. A spectator, who recognizes Dilbeck and …is fond of Erin, offers to get back her daughter by blackmailing Dilbeck. Things do not work out as planned, though. (Read More)
Subgenre: | cult filmblack comedyconspiracy |
Themes: | drunkennessmurderdeathkidnappinggangsterdeceptiondivorceblackmailmafia |
Mood: | satireneo noir |
Locations: | strip clubhospitalbeachhotelboatwheelchairlakemotelyacht |
Characters: | christianthiefpolice officerfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistdetectivesingle motherpolice detectiveemployer employee relationshipex husband ex wife relationshipcoroner |
Period: | 1990s |
Story: | female stripteaseblack bratopless womanblack pantiestopless female nudityfake breastsbreastnipplehairy cheststripteasestrippingtoplessstripperbare buttthong …beatingnipplescigarette smokingfemale frontal nudityfemale rear nudityfemale nuditybare chested malebare breastsnuditybased on novelflashbackdoggundancingphotographknifesurprise endingpistolcorpseslow motion scenearrestletterheld at gunpointsunglassesdead bodyhandcuffsrevolvercriminalf wordaxedisguisewomanpoliticiansnakefishjudgedisarming someonecontroversyvancigar smokingmarriage proposallimousineorganized crimebinocularsfactorypay phonebuxomproduct placementcover upknocked outcourtbodyguardthreatened with a knifemonkeyheart attacksingle parentcrime bosscard gamesabotagefarceheavy rainlooking at oneself in a mirrortape recorderfaintingwalkie talkiemorgueeccentricfloridadesperationpress conferenceteddy bearembarrassmentmale underwearredneckboxer shortsfanitalian americanmiami floridaaquariumhit on the headcon artistdressing roombroken armblack bra and pantiessouthern accentchauffeurmob bosscartoon on tvloss of jobexotic dancervideo storecockroachgolf clubabandoned housetrailer homeinformantlaundromatsweatdolphinconservativeinfatuationoffscreen killingwhite trashchild custodybra removingmafia bossbouncercorrupt officialboard gamepole dancerfundraiserpole dancingsugar555 phone numbercongressmanknife held to throatenvelopered carpetreference to winston churchillrearview mirrorsecret service agentcustodypower drilltrailer trashphone bookdead fishwearing a sound wiresignaturetopless dancingchristian fundamentalismreal life mother and daughter playing mother and daughterwoman in a towelyarmulkefamily valuesreference to michael jordanemployee employee relationshipdancing aloneyogurtpet snaketelepromptervaselinereference to george bushpet monkeyfemale attempts to seduce maletic tacsprivate dancerreference to barbara bushcandy land (See All) |
In rural Tennessee, Lazarus, a former blues musician who survives by truck farming, finds a young girl nearly beaten to death near his home. She's the white-trash town tramp, molded by a life of sexual abuse at the hands of her father and verbal abuse from her mother, who seems to delight in remindi …ng Rae of her mistake in not aborting her. Lazarus, who is also facing personal crisis at the dissolution of his marriage, nurses Rae back to health, providing her with gentle, fatherly advice as well as an education in blues music. Rae's boyfriend, Ronnie, goaded by the man who nearly beat Rae to death, misunderstands the relationship between Lazarus and Rae, and vows to kill him. Lazarus, exhibiting a street-smart understanding of violence and its motives, calls Ronnie's bluff, senses that he is as troubled as Rae, and becomes a guiding force in the young couple's resurrection. (Read More)
Themes: | drunkennessdrinkingfriendshiplovemarriagedrugspregnancyweddingdeceptionseductionangerdrug useredemptioninsanityillness …faithabuseexploitationabortiontraumafreedom (See All) |
Mood: | nightmarearchive footage |
Locations: | truckbussmall townrestaurantbarchurchbathtubrural settingkitchenmotelstormsex outsidesex outdoors |
Characters: | girlboyboyfriend girlfriend relationshipfriendafrican americanmother daughter relationshiphusband wife relationshiptattoosingerprostitutedancermusicianlustbiblecousin cousin relationship …ex husband ex wife relationshippimpu.s. soldier (See All) |
Story: | pickup trucktopless womantopless female nuditywhite pantiesbreastnipplemini skirtpublic nuditybracleavageprayercafetearsbeerrifle …vomitingundressingdrinkunderwearbeatingcryingpantiespartynipplescigarette smokingfemale frontal nudityfemale nuditybare breastsbloodnuditykissflashbackdoggunsex scenefightinterracial sexdancingtitle spoken by charactersingingleg spreadingthree word titletelephone callfondlingsongfoodslow motion scenekissinganimal in titlemarijuanahallucinationcolor in titleguitarbandconcertdrug dealermontageeatingprisonerchild abusescantily clad femalecoffeebartenderracial slurcursevirginprologueattempted rapefarmergardenobscene finger gesturekissing while having sexgaragegirl in pantiessupermarketnipples visible through clothingwoundloss of virginitydressrace relationssexual abusecaptiveguitaristcaucasianwristwatchnaked womanpreacherrear entry sexgrocery storebloody noseu.s. armyministerkickingsex talkanxietyfather figurecigarette lighterthunderstormroseblack eyehealingcapturewedding dressnervous breakdownchainholding handssouthern accentpromiscuous womanfarmingshortstractorchild molestationtemptationfarmhousetrailer homesexual promiscuitycowboy bootspharmacytennesseecoughingreverendtopless girlfeverauto mechanicwoman wearing only a man's shirtnymphomaniacfilm starts with sexsalvationhymnblues musicunwanted kissfirst sexual experiencepool hallbride and groombroken bottleclothing storesex from behindzippo lighterguard dogpanic attackamerican southbarber shopsaying gracepharmacistdrugstoresex act reflected in mirrorsex addictmoonshinenymphomaniahot pantsleft for deadrecovering alcoholicgirl toplessunfaithful girlfriendchurch choirwoman in a bathtubsouthern gothicanxiety attackmultiple loversstomachnaked outdoorsblack man white woman relationshippoor white trashreformradiatorbare breastice bathcorn on the cobrose gardenblues singersexual innuendo in titlewickednessanxiety disorderflower gardenwatchdogvegetable farmheavy machinerysex act reflected in a mirrorchained to a radiatorsex reflected in mirrorsexual hysteria (See All) |
A comedy about bending the rules to reach your goal, Bend It Like Beckham explores the world of women's football, from kick-abouts in the park to freekicks in the Final. Set in Hounslow, West London and Hamburg, the film follows two 18 year olds with their hearts set on a future in professional socc …er. Heart-stopping talent doesn't seem to be enough when your parents want you to hang up your football boots, find a nice boyfriend and learn to cook the perfect chapatti. (Read More)
Subgenre: | teen moviecoming of agetv sports programsoccer movie |
Themes: | drinkingjealousyreligionfriendshipmarriagepregnancydanceweddingdeceptiontravelracismparanoia |
Mood: | archive footage |
Locations: | cartrainhotelairplanenightclublondon englandairportenglandgermany |
Characters: | teenage girlteenage boystudentfriendmother daughter relationshipfather daughter relationshipmother son relationshipfather son relationshipfamily relationshipshusband wife relationshipdancersister sister relationshiplove trianglegay friend …mother in law daughter in law relationship (See All) |
Story: | hit with a ballmusclescholarshipsports teamdiscriminationhit in the crotchcoachlocker roomstrippingbrasubjective cameracleavageprayertearsdrink …underwearcryingpantiespartykissf ratedcharacter name in titlefightdancingtitle spoken by charactertelephone callfirecell phonetitle directed by femalefoodwatching tvcameralierunninglingeriebedbedroomsoccercookingvideo cameramontagehouseimmigrantsubwayritualracial slurfantasy sequencescene during end creditsuniversityscarsadnessstrong female charactertwenty somethingcloseted homosexualtraditiondiscodressinjurytempleculture clashstrong female leadinterracial friendshipcelebrationshoesteamkickingnewsreel footageshoppingliving roomlaughingethnic slurbenchwedding receptionposterrefereet shirtjoyunderdogceremonywomen's rightsbloopers during creditsimperative in titleshortsescalatorhindutomboydance clubgeneration gapteenage daughtercricket the gameshirtfashion modeltv studiomarriage engagementhamburg germanymatchsoccer ballsoccer playersoccer matchpark benchbechdel test passedcultural differencejumpingmulticulturalracial discriminationvictorybride and groomveilcanceled weddinghinduismsikhdefeatsoccer footballsoccer fansoccer teamasian indianteenage angstfoosballsit upssoccer coachinterracial lovepunjabibritish asiangoalkeeperlondon undergroundfake illnessburn scarindian pakistanisoccer goalburn injuryracist insultwedding invitation360 degree well shotsoccer starlebanesenubile womanfashion magazinesports bragirls' soccersports announcerlingerie storepenalty kicksarireference to george michaelwomen's soccerbridal showerbandstandfamily traditionsbritish indiansoccer trainingkneerubbing nosessoccer practicesuspected lesbianwater sprinklerbroken marriage engagementanglo indianbritish soccergoal keeperletter of acceptancewest london (See All) |
In a 1950's mining town called Coalwood, Homer Hickam is a kid with only one future in sight, to work in the local coal mine like his father. However in October 1957, everything changes when the first artificial satellite, Sputnik goes into orbit. With that event, Homer becomes inspired to learn how … to build rockets. With his friends and the local nerd, Homer sets to do just that by trial and a lot of error. Unfortunately, most of the town and especially Homer's father thinks that they are wasting their time. Only one teacher in the high school understands their efforts and lets them know that they could become contenders in the national science fair with college scholarships being the prize. Now the gang must learn to perfect their craft and overcome the many problems facing them as they shoot for the stars. (Read More)
Subgenre: | historical event |
Themes: | theftrobberydrunkennessdrinkingjealousyfriendshipdeathdanceherodeath of fatherabusehope |
Mood: | high schoolrain |
Locations: | bussmall townhospitaltrainschoolforestwoodswheelchairforest fireshooting a car |
Characters: | teenage boythiefstudentteacherfriendafrican americanfather son relationshipmother son relationshipfamily relationshipspoliceteenagerbrother brother relationshipdancerteacher student relationshipgerman …chinese (See All) |
Period: | world war two1950s |
Story: | football coachfootball practicehigh school footballscholarshipfencefootball playeramerican footballcoachclassclassroomtearsrifledrinkcryingtwo word title …dancingtitle spoken by characterexplosionbased on true storyfirebased on bookwatching tvbombcollegehandcuffssciencecompetitiontelephonescientistradiogymbasementblack americanrecord playercold warnerdrecordingdemonstrationhome movietarget practiceminegeekrocketsatelliteunderdogminingcafeteriabarbermathematicslistening to a radiogeneration gaptrain tracksmarching bandminerlabor unioncar radioradio newscold war eracoaldeterminationmonth in titlelabor strikecoal minehigh school principalwest virginiatriumphwelderfootball fieldappalachialayoffsteelspace racecoal miningyear 1957cementrocket launchingscience fairindianapolis indianasputnikrocket scientistchemistry classmining accidentpushing a vehiclecalculusguided missilemine disaster45 recordinghigh school gymhodgkin's diseasereference to wernher von braunspace satellitecoal industryheadlampmine collapse (See All) |
When Sam Merrick is beaten up by local bully George Tooney, Sam's older brother Rocky and his friends Clyde and Marty plan to pretend it's Sam's birthday to "invite" George on a boat trip in which they would dare him to strip naked, jump in the lake, and run home naked. But when Sam, his girlfriend …Millie, Rocky, and Clyde see George as not much of a bad guy, they want to call off the plan, but Marty refuses. Will the plan go ahead as planned? (Read More)
Subgenre: | independent film |
Themes: | theftrobberydrunkennessdrinkingfriendshipdeathrevengesuicidedrugsdeath of fatherdrug useguilthumiliationdyingamnesia …forgivenessfirst lovesuicide of father (See All) |
Locations: | small townbarschoolforestboatbicyclewoodsrural settinggas stationwater gunpolice boat |
Characters: | sheriffteenage boythiefstudentteacherfriendfather son relationshipmother son relationshippolicehomosexualteenagerchildrentattoobrother brother relationship …policemanbullyteacher student relationshipfrench kiss (See All) |
Story: | pickup truckconvenience storebaseball batpublic nuditytearsbeervomitingbare buttundressingdrinkbeatingcryingerectionpartycigarette smoking …male rear nuditymale nuditykissbloodviolenceone word titlemasturbationtwo word titlegunknifeurinationface slapsecretliebirthdayinterrogationmarijuanarivergay slurvideo camerabasketballbirdunderwater scenedrowningliarpranktragic eventdateobscene finger gestureballoonaccidental deathgay parentwatching televisiontarget practiceunderage drinkingloss of sonobesityrowboatdeceitdeermormonbirthday presentdrunk drivingtween girlpeer pressuredamchewing gumunderage smokingstation wagonoregontolerancefilling stationvideo footagehold upsorrowsnailjunior high schooldarereference to martin luther king jr.pocket knifecreektruth or dareexercisingdyslexiafinger cutboatingmouth to mouth resuscitationshallow gravewet jeanscherry blossomlearning disabilityoarmoral choicebumper stickersoaked clothesblood brotherinsect stinglyme diseasepoison oak (See All) |
Although cheerful, friendly, intelligent, well-dressed, authentic and wealthy, Charlie Bartlett has problems. With his father gone and his mother loopy and clueless, he's been expelled from every private school for his victimless crimes. Now he's in a public school getting punched out daily by the s …chool thug. He ever longs to be popular - the go-to guy - and the true crux of his troubles is that he invariably finds the means to this end, whatever that might be. At Western Summit High, he makes peace with his tormentor by going into business with him - listening to kids' problems and selling them prescription drugs. Charlie's a hit, but attraction to Susan (daughter of the school's laissez-faire principal), new security cameras on campus, a student's overdose, and Charlie's open world view all converge to get him in serious trouble. Can this self-made physician possibly heal himself and just be a kid? (Read More)
Subgenre: | teen moviecoming of age |
Themes: | drunkennessdrinkingfriendshipinfidelitydrugsmoneyadulteryprisonextramarital affairdivorcedepressiondrug usedysfunctional familyunfaithfulnessdating …humiliationbullyingabductionalcoholismwealth (See All) |
Mood: | high school |
Locations: | school buspolice carsmall townrestaurantbarswimming poolsex in a carschool bus driver |
Characters: | teenage girlteenage boystudentteacherboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshippolicesingerpolicemandancerwriter …bullysingle motheralcoholicpsychiatristtalking to oneself in a mirrorstudent protest (See All) |
Story: | popularityfootball playeramerican footballclasscheerleaderman with glassesclassroomcafetearsundressingdrinkunderwearbeatingcryingparty …cigarette smokingfemale nuditybare chested malekissbloodsexcharacter name in titlegundancingtitle spoken by charactersingingpistoltelephone callcell phonesongmirrorpunched in the facecomputerarrestbooksunglassesmarijuanapianojailrevolverguitartelephonewinebandconcertmansionbasketballdrug dealermontagesuicide attempttoiletrock bandinternetanti herounderwater scenelimousinemicrophonevirgincoming outprotestfired from the jobfantasy sequenceauditionbodyguardsplit screendateloss of fatherhandgunclass differencesteenage sexgarageriotteen angstloss of virginityice creamjail cellvandalismdemonstrationassaulttherapistfraudtennisskateboardcompassiondrug overdoserampageremote controlpillssurveillance cameraresearchbackstagepool tablemedicationfirst kissschool uniformdaydreamblack eyelonerclassmatebriefcasebrushing teethpajamaschauffeurpiano playervideo tapeteenage loveoverdoseconfessionalplaywrightpeer pressurebare chested boymegaphonelollipoppsychiatryprivate schoolfootball teamsexual repressionwatching a videorescue from drowningteen suicideloudspeakersuicidal thoughtsvillain turns gooddriver's licensefrench accentbritish accenthigh school principalsocial outcastpetitionfake idsedativepenitentiarytoilet stallfalling into a swimming poolanti depressantdestruction of propertystreakingtoilet bowlgiving the fingerschool expulsionmentally challenged personprescription drugsfake doctortax evasionboys' bathroomsexual confusionprozacchauffeured limousineattention deficit disorderhead in toiletkid outsmarts adultrailroad tracksritalintoy boatgarage doorxanaxdrive in movie theatrepsychiatric institutionbackseatmodel boatzoloftschool blazerdestructivenessfight in men's roomnicotine gumpassing notehigh school playrave the partysocial acceptanceschool superintendentchuck taylor gym shoesfake psychiatristmisdiagnosis (See All) |
To escape an abusive boyfriend, without announcing her plans in advance, Jean Gilkyson takes her young daughter Griff to the Wyoming ranch of her father-in-law, Einar. Jean and Einar are disaffected, as he blames her for the death of his son in a car accident. Einar is taking care of his friend Mitc …h, who was attacked by a bear, and Einar does not know that he has a granddaughter. While Mitch heals and forgives the bear, Einar also changes his feelings regarding Jean, finally understanding that accidents happen and accepting her and loving Griff. (Read More)
Themes: | theftrobberydrunkennessdrinkingjealousyfriendshiplovememorydeath of fatherredemptiongriefvengeanceforgivenesscamping |
Mood: | rain |
Locations: | bussmall towncarrestaurantbarhospitalbicyclerural settingfarmmotellog cabinshooting a car |
Characters: | teenage girlsheriffthiefpolice officergirlboydoctorboyfriend girlfriend relationshipfriendmother daughter relationshipfamily relationshipspolicehusband wife relationshiphomosexual …teenagerfemale protagonistpolicemanbullywaitressgrandfather granddaughter relationshipdysfunctional relationship (See All) |
Story: | pickup trucktrophyinjectioncaferifledrinkunderweardreambeatingcigarette smokingsexf ratedviolencegun …fightphotographhorsecar accidentmirrorcomputercatsecretliewomanbinocularsliarcowboyscardeath of sondeath of husbandhorse ridingbasementflowerbearcowrunawayropeshavingpokerhypodermic needlebarnloss of wifepool tablezoocaneranchchainplaying cardstombdonkeysandwichplaying poolmeatcrutchesloss of daughterabandoned houseloss of childrodeodomestic abusegravestonetreehousecar breakdownmorphineabusive boyfriendiowasnailraccoonfootprintfather in law daughter in law relationshiplassowyominghoneypadlockbreaking a car windowmilking a cowanimal cagetalking to the deadprinterlearning to drivedry cleanersmaulingreference to mcdonald's restaurantlong underwearwichita kansascalgary alberta canadacigarette buttbroken ribemotional healingbroken platereference to winnie the poohcamera focus on a female butttin snipsescargotinterstate highwaycheyenne wyomingbutte montana (See All) |
When Ruby Baker's parents are killed in a car accident, she and her brother, Rhett, must travel to Malibu, to live with Terrence and Erin Glass, their former neighbors. At first, all seems well. Ruby is making new friends at school and Rhett is getting more video games and flashy toys than he's ever … had in his life. When Ruby speaks to her family's estate lawyer, he tells her that her parents have left Rhett and her $4 million. Suddenly, Ruby begins to notice odd behavior from Terry and Erin. (Read More)
Subgenre: | suspensepsycho thriller |
Themes: | drunkennessdrinkingfriendshipmurderdeathsuicidedrugsfuneraldeath of fatherdeath of motherdrug useadoptionwealthcheatinginheritance …murder of a police officerclaustrophobia (See All) |
Mood: | high schoolrainnightmare |
Locations: | police cartruckcarrestaurantschoolchurchswimming poolcemeteryschool teachercar explosiontruck accident |
Characters: | teenage girlteenage boypolice officergirlboydoctorfriendmother daughter relationshipfather daughter relationshipfather son relationshipmother son relationshipfamily relationshipspolicebrother sister relationshipfemale protagonist …policemanpriestlawyermaiduncle nephew relationshipuncle niece relationship (See All) |
Story: | high school studentclassinjectionargumentbracleavageclassroomcafetearsdrinkdreamcryingcigarette smokingbloodgun …explosionknifecorpsecar accidentwatching tvcomputerbikinicar crashdead bodyswimmingorphanflashlightcaliforniamansionstabbingstabbed to deathinternetchild abusedrivingdrawinghit by a cargraveyardgravedrug addictscreamingdebtlightningfilm within a filmloss of fathersuspicionloss of motherreference to william shakespearetrusthypodermic needlemachetefaintingcaptiveloss of loved onewatching a moviearchitecthome moviescamdrug overdosemovie theatreswitchbladetensionbroken glassjunkietheatre audiencee mailsocial workerdeath of loved onereckless drivingnintendo 64flat tiremenstruationtombstonedrunk drivingpopcornloanglassloan sharkguardianreference to shakespeare's hamletbmwcruisingmorphineloss of parentsvideo cassetteplagiarismcar wreckapple computercaregiverdriving lessondiabeticillegal drugseulogydead parentsperilinsulinshooting uplife insurancetrust fundseat beltgourmetsocial servicesunlikely criminalreference to meryl streepcheating on a testelectric drillbrake failurecar hit by a trucksaablegal guardianglass housestepfamilycar over a cliffferrari testarossadeviousnessmulholland driveradio producerdriver's educationsan bernardino californiaaol (See All) |
Mia, an aggressive fifteen-year-old girl, lives on an Essex estate with her tarty mother, Joanne, and precocious little sister Tyler. She has been thrown out of school and is awaiting admission to a referrals unit and spends her days aimlessly. She begins an uneasy friendship with Joanne's slick boy …friend, Connor, who encourages her one interest, dancing. (Read More)
Subgenre: | teen moviecoming of agemusic videofish out of water |
Themes: | theftdrunkennessdrinkingfriendshipinfidelitymoneyadulteryextramarital affairdysfunctional familyunfaithfulnessabduction |
Mood: | rainhip hopambiguous ending |
Locations: | cartrainkitchenurban settingapartmentlaketrain stationsinging in a car |
Characters: | teenage girlteenage boythiefgirlboyfriend girlfriend relationshipmother daughter relationshipfamily relationshipsteenagerchildrentattoodancersister sister relationshiplittle girlsingle motherolder man younger woman relationship …alcoholic motherdaughter seeing mother have sex (See All) |
Period: | 2000s |
Story: | teenage rebellionwhite pantiesfenceconvenience storesubjective cameravoyeurtearsbeerbare buttundressingdrinkunderwearbeatingcryingpanties …partycigarette smokingfemale rear nudityfemale nuditymale nuditybare chested malesexnuditykissf rateddogfightdancingphotographsingingtelephone callcell phonetitle directed by femalesex on couchhorsemirrorurinationface slapslow motion scenewatching tvarrestsunglassesanimal in titlerunningrivertelevisionbedroomflashlightcookingvideo camerainternetfishchild abusedrivingspankingvirginscreamingsuburbauditionsleepingsingle parentgirl in pantieshuggingteen angsthead buttbreaking and enteringwarehouseballoonloss of virginitylistening to musicsexual attractionrecordingstealingworking classyoutubestreet lifeapartment buildingbarefoottensionbloody noserap musicthundercouchunderage drinkingbalconyswingsocial workerlooking at self in mirrorsunbathingposterparking lotvodkatriple f ratedgatejunkyardbandagegerman shepherdwalletlooking out a windowdouble lifetrailer homeclimbing through a windowponytail15 year oldunconsciousnessteenage daughtercdmailboxactual animal killedwindmillteenage crushgame playingsex with a minorwatching a videorescue from drowningundressing someoneteenage girl in underwearhoodieswingingtrespassingchild abductionpackingsleeping on a couchdiyguard dogoverhearing sexabusive motherbrickhardware storeleaving homeliquor store19 year olddance contesthamsterclothes linealcohol abuseapplying makeupwatching sexplastic bagpadlockhand on crotchrottweilerdead fishhousing projectteen drinkingstatutory rapevoice maillaundry drying on clothes linelimpinglittle sisterprincess costumehigh risespying on couple having sexlower classpiggy back rideband aidswing setmother's boyfriendclimbing a fencefish in titleinternet cafelistening to sexmother and daughter have sex with the same manpitbullschool expulsionfoot injurymother daughter estrangementafrican anglopushed into watertoolscouncil estateabandoned apartmenturban violenceshooting a horsehousing estatechild smoking a cigaretteessexsound of sexrunning mascaraunwanted childwant adautomobile junkyardhand cutnagging motherwrecking yardid badgehigh rise apartment buildingtossing rocks at a windowdance auditiondeath of a horsesony video camerahandfishingtaking off someone's shoesfoot woundfoot cutnegligent mothercarrying a girldrinking water from a faucethead slap (See All) |
Aspiring emcee DJay works the angles to get his first record made with help from assorted people in his Memphis 'hood. And when he hears that hip-hop superstar Skinny Black is heading to his area, he throws together a supreme hustle to grab Skinny's attention.
Subgenre: | tragedy |
Themes: | drunkennessdrinkingreligionfriendshipmurderdeathlovechristmasmoneyprisonpregnancydrug usesamurai |
Mood: | high schoolrainhip hop |
Locations: | school buspolice carstrip clubrestaurantbarchurchnightclub |
Characters: | friendafrican americanfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipfamily relationshipspolicehusband wife relationshipsingerprostitutepolicemandancermusicianbaby …reference to godinterracial relationshippimpgo go dancer (See All) |
Story: | convenience storelocker roomstripperprayercafetearsdrinkunderweardreambeatingcryingcigarette smokingfemale nuditysexblood …kissviolencedoggunfightdancingsingingthree word titlepistoltelephone callpunctuation in titlesongshootoutface slappunched in the facearrestshootingmarijuananeighborpianojailreference to jesus christbridgetoiletbartenderlimousinemicrophonepianisthandgunblack americanampersand in titledrug dealinghookerprison guardrap musicegyptpool tablemakeuprapperchoirsongwriterclassmatemidlife crisishustlerchauffeurdjmarijuana jointearphonesplaying pooleiffel tower parisevictionexotic dancermen's bathroomjukeboxradio stationdrug dealflarelistening to a radiourinetennesseepyramidstatue of liberty new york citybumpawnshopcar radiopole dancervending machinekeyboardmemphis tennesseerentradio djtruck stopcassette tapetricyclesongwritingomenpopsiclechurch choirmount everestlava lampprison visitationcutlasssound engineercrotch rubreference to the easter bunnysound proofingmeat loaf (See All) |
High school student Ferris Bueller wants a day off from school and he's developed an incredibly sophisticated plan to pull it off. He talks his friend Cameron into taking his father's prized Ferrari and with his girlfriend Sloane head into Chicago for the day. While they are taking in what the city …has to offer school principal Ed Rooney is convinced that Ferris is, not for the first time, playing hooky for the day and is hell bent to catch him out. Ferris has anticipated that, much to Rooney's chagrin. (Read More)
Subgenre: | teen moviecoming of agecult filmteen comedy |
Themes: | friendshiphome invasion |
Mood: | high schoolbreaking the fourth wallaffection |
Locations: | school buscarrestaurantschoolswimming poolpolice stationofficechicago illinoismuseumsinging in shower |
Characters: | teenage girlteenage boypolice officerstudentboyfriend girlfriend relationshipfriendpoliceteenagerbrother sister relationshipbest friendteacher student relationshipsecretary |
Period: | 1980s |
Story: | teenage rebellionhigh school girlcar drivinghigh school studenthigh school boyhigh school seniorpopularityrebellionrebelclassroomkisscharacter name in titledogdancingshower …telephone callslow motion scenecomputerpaintingbedapostrophe in titlebathroomtelephonebedroomdrug dealerhouseanti herolooking at the cameratalking to the camerakicked in the facescene during end creditsconvertiblegarageanswering machineteen angststreetimpersonationparking garageart galleryblack humorparadehomecameoscene after end creditssibling rivalryone dayclassmatelaughingsports carneighborhoodsurprise after end creditsirreverencemudjoyhigh school teacherschemewalletadviceschool principalcameo appearanceprincipalcoughinggeneration gapmarching bandhallwaybackyarddeskferraridog attackspringsmilingswimming in underwearreference to john lennonhigh school principalhypochondriacteenage angstthe beatles songdowntownclarinetsynthesizerskipping schooldiving boardcomputer screentalking to the audiencecatatoniafake illnessanti authoritycar damagetruancyfaking illnessprincipal's officechicago cubsjersey the garmentjoyridemusical sequence in non musical workreference to dirty harryon screen narrationnarrated by title charactertruantpretending to be sickstudent principal relationshipwrigley fieldday offfoot popping kissfake nursegummi bearshermer illinoiscalling someone a heroexpensive carthriller dancevoice sampling (See All) |
Ben has recently graduated from college, with his parents now expecting great things from him. At his "Homecoming" party, Mrs. Robinson, the wife of his father's business partner, has Ben drive her home, which leads to an affair between the two. The affair eventually ends, but comes back to haunt hi …m when he finds himself falling for Elaine, Mrs. Robinson's daughter. (Read More)
Subgenre: | coming of ageindependent filmcult filmmelodramacoming of age film |
Themes: | obsessiondrinkingjealousymarriageinfidelityadulteryweddingseductionextramarital affairdivorcedysfunctional familyunfaithfulnesshumiliationbreak up |
Mood: | satirerain |
Locations: | strip clubbuscarbarchurchswimming poolhotelairplanelos angeles californiaairportgas station |
Characters: | boyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshippolicehusband wife relationshiplawyerlove trianglealcoholicolder woman younger man relationshipalcoholic motheralcoholic drink |
Period: | 1960s |
Story: | car drivingtopless female nudityrebellioncrosssubjective cameracleavagestrippertearsbeerundressingdrinkunderwearcryingpartynipples …female frontal nudityfemale nuditybare chested malebare breastsnuditykissbased on noveltwo word titleleg spreadingtelephone callface slapwatching tvsunglassesrunningwomandrivingapologyscantily clad femalebirthday partyunderwater scenemarriage proposalsmokinglibraryhotel roomvirginpay phonecharacter's point of view camera shotcollege studentscreamconvertiblepursuitautomobiledatemonkeytwenty somethingshavingbreaking and enteringblockbusterphone boothdriving a carforbidden lovevirginitypromisezoohousewifeanxietymay december romancepriderainstormwedding dresssports cartan linelandlordsunbathingmale virginunhappy marriageface maskrunning awaytelephone boothnudegorillafish tankunited states of americanude girlhamburgerfamous scorechimpanzeenervousnessbus ridegolden gate bridgeneuroticbride and groomfamous linetoothbrushvolkswagen beetlerunning out of gasfrench friesbusiness partnerred carblood testplastic21 year oldgraduatebourbonadulteressberkeley californiascotchrape accusationscubacollege graduatedeadpandry humorwestern u.s.graduation partyrunaway bridefraternity housedesk clerkdrive in restaurantsanta barbara californiabridal gownalfa romeopresbyteriantadpolingwedding ceremony gone awryboredwomen's basketballpeople moveruc berkeleywoman putting on pantyhose (See All) |
Astrid Magnussen is a 15 year old girl, living in California. Her mother, Ingrid, is a beautiful, free-spirited poet. Their life, though unusual, is satisfying until one day, a man named Barry Kolker (that her mother refers to at first as "The goat man") comes into their lives, and Ingrid falls madl …y in love with him, only to have her heart broken, and her life ruined. For revenge, Ingrid murders Barry with the deadly poison of her favourite flower: The White Oleander. She is sent to prison for life, and Astrid has to go through foster home after foster home. Throughout nearly a decade she experiences forbidden love, religion, near-death experiences, drugs, starvation, and how it feels to be loved. But throughout these years, she keeps in touch with her mother via letters to prison. And while Ingrid's gift is to give Astrid the power to survive, Astrid's gift is to teach her Mother about love. (Read More)
Subgenre: | coming of agemelodramapunk |
Themes: | drunkennessdrinkingjealousyreligionfriendshipmurderlovesuicideinfidelitychristmasmoneyadulteryprisonpregnancyextramarital affair …angerdivorcelonelinessdeath of motherparanoiadysfunctional familyredemptionunfaithfulnessgamblingevilcrueltywealthfirst love (See All) |
Mood: | high schoolnightmare |
Locations: | school busbusrestaurantbeachschoolswimming poollos angeles californiacourtroomrooftopmexicoforest fire |
Characters: | teenage girlteenage boychristianpolice officergirlteacherboyboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipfamily relationshipspolice …husband wife relationshiptattoosingerbrother sister relationshipprostitutephotographerlawyerartistactressreference to godsingle motherbibleolder man younger woman relationshiprussianreligious fanatic (See All) |
Story: | barbecueheartclasscrossbraclassroomcafetearsbeerthongdrinkunderweardreamcryingpanties …partycigarette smokingkisssexbloodbased on novelviolenceinterviewflashbacktwo word titlegunfightphotographfirevoice over narrationwatching tvcomputerarrestsecretlettershootingpaintingjailhandcuffsreference to jesus christcolor in titlerevolvershot in the backswimmingwinecaliforniaambulancecocainenonlinear timelinechild abusejudgetrialpainterdrawinggunshotflash forwardpoisonrabbitcourtmanipulationpremarital sexreunionflowerheroinchessrunawayteen angstcomic bookjoggingvideotapecompassiontowelmilkdrug overdosehaircutprison guardwindbraveryconstruction sitehypocrisyministerhatredjunkiebible quoteamusement parkwomen's prisonabsent fatherjuvenile delinquenthysteriajewelrycartoon on tvtestimonyconstruction workerbaptismmakeoverroller coasterpolaroiddomineering motherparamedic15 year oldadult actress playing teenage girlreverendpalm treebullet woundprison visithonestycarpentersex with a minorsalvationaccusationastrologycheckcollageeggsjail breakborderline personality disorderrearview mirrorfoster childsnowglobefoster homeart classnova scotiatrailer trashdrug rehabilitationfoster familybad motherjuvenile detentionfoster parentwashing handsinnocence lostjuicetopless dancingbible studyflea marketwatercolorpepsi colameteor showercomic book artcomic book shoppoker the card gameart showsocial servicesgarbage collectorpoor white trashchild carefeng shuigreyhound busfdawomen's studiesbarrenesschristmas pageantnarcissistic personality disordersound of sexborn againfoster parentingfalling starmurder of loverjuvenile hallhanging mobilegirls' dormitoryjesus freaksanta monica pierflip flops the shoesairbrushdeath by drug overdose (See All) |
The Rizzos, a family who doesn't share their habits, aspirations, and careers with one another, find their delicate web of lies disturbed by the arrival of a young ex-con (Strait) brought home by Vince (Garcia), the patriarch of the family, who is a corrections officer in real life, and a hopeful ac …tor in private. (Read More)
Themes: | theftrobberydrunkennessdrinkingprisonfilmmakingdeceptionvoyeurismangerchildhood dream |
Mood: | high school |
Locations: | strip clubbusnew york citybeachboatrooftopusashedfishing village |
Characters: | teenage boythiefstudentmother daughter relationshipfather daughter relationshipfather son relationshipmother son relationshipfamily relationshipshusband wife relationshipteenagertattoobrother sister relationshipprostitutecatholic |
Story: | high school studentscholarshipbarbecueclasshairy chestlocker roomsubjective camerastripperprayervoyeurtearsvomitingthongdrinkbeating …cryingcigarette smokingbare chested malekisstitle spoken by characterknifetelephone callvoice over narrationcell phonefoodcar accidentface slapwatching tvsecretliesunglassesmarijuanabathroomcollegeneighborhandcuffsislandmanhattan new york cityalcoholcookingwinevideo camerabridgeeatingtoiletinternetconfessionliarauditionreadingcollege studentconvertibleactingtrusteyeglassesapplausehuggingpot smokingsexual attractionmonologueexercisebeardcrying womanimprovisationladdercrying manpeeping tombikerremote controlgrocery storeprison guardmisunderstandingobesitykickingkicked in the crotchconvictprison cellpierfamily dinnerpassionate kissrelease from prisonbenchfamily secretreckless drivingshot multiple timeslaptop computernarrated by characterwebsitefamily reunionlate nightseagullmaking outpush upscredit cardquarrelvhssecond chancewoman in a bikinifather son reunionbronx new york cityferrarifirst person narrationpole dancercocktailfordworking outoverhead shotsaying graceaspiring actor19 year oldillegitimate sonwardenapple computermovie makingwoman smoking cigarettereference to marlon brandovhs tapefat girlgazebonew york city skylinegrocery shoppinglong lost fathercasting directoracting classhalf brother half brother relationshiphalf brother half sister relationshipabandoned by motherinternet pornographypoker the card gamecasting callfamily argumentoverweight womanreference to wikipediathrowing a knife24 year oldlong lost sonpull upsacting teacherwaiting in lineschool suspensionlawn chairattacked with a knifefender bendermatchbookdinner guesthunkkicked in the shinhandcuffed togetherreference to martin scorsesereference to robert denirofat jokefelonreference to the new york yankeescorrectional officertryoutfamily quarrelsitting on a rooftoptv cooking showsuspicion of adulteryapple laptopkeeping a secretroll callboat yardrear ending a carwashington heights manhattan new york citychevrolet impalawestchester new yorkmug shottalent manageracting studentblow dryerlove childreference to molly ringwaldsquibcamera shot between legslying to wifebronxchubby chaserschenectady new yorkupside down imagecamden new jerseyfat fetishsilicone implantlicense plate numberlying on a beachsnake tattoo (See All) |
Brandy Klark ('Aubrey Plaza (I)' (qv)) has just graduated from high school where she excelled in every subject, except real-life sexual education. When her older sister tells her how important it is to be experienced, Brandy writes out a sex to do list for herself for the summer. Her friend Cameron …might be the perfect guinea pig while she sets her sights on the popular and sexy Rusty Waters as the ultimate end goal. But once feelings get in the way, it becomes much harder for Brandy to check off the remaining items on her sex to do list. (Read More)
Themes: | drinkingfriendshipsexuality |
Mood: | high school |
Locations: | swimming poolsex in a van |
Characters: | teenage girlteenage boygirlboyfriendfather daughter relationshipfemale protagonistsister sister relationshipbest friendbest friends |
Period: | 1990syear 1993 |
Story: | high school studentwhite pantieshigh school seniorsexual humorpigmini skirtpublic nudityargumentcleavagebeerdrinkpantiespartybare chested malesex …kissf ratedmasturbationbikinibedbedroomfour word titlescantily clad femaleprankgirl in pantiesdesiredressswimsuitblack humorvirginityembarrassmentgirl with glassesironylaughingcrowdjoypractical jokemale objectificationshortsblue pantiessarcasmthong pantiesnaivetyhanging upside downmegaphoneimmaturityawkwardnesswoman in a bikinilifeguardclumsinesswoman wearing black lingeriefemale vomitingfemale sexualityplaying acoustic guitarbullhornlistsexual experimentationupside downhandwritingto do listgraduation ceremonyboise idahowomen wearing a one piece swimsuitgraduation speechfeces in a swimming pool (See All) |
Finding himself in considerable debt, Chris, a Texan drug dealer, decides the only solution is to murder his mother to collect the insurance money. Getting together with his father, the ex-husband of Chris' mother, they decide to hire Joe Cooper (a contract killer) who also happens to be a police de …tective. The plan is that the money will go to Chris' sister Dottie. However due to the size of the contract fee, Chris agrees that Joe can take Dottie as a retainer until the insurance comes through. (Read More)
Subgenre: | martial artsblack comedy |
Themes: | drunkennessdrinkingmurderdeathinfidelitydrugsmoneyadulterypregnancyfuneralgangsterextramarital affairpsychopathdeath of motherdrug use …dysfunctional familyunfaithfulnessgamblingexploitationcrueltyfalling in lovemurder of mother (See All) |
Mood: | rainneo noirnightmareambiguous ending |
Locations: | texasstrip clubrestaurantbartrainmotorcyclecemeterypolice stationmotelcar explosionmotorcycle chasecar on firecar fire |
Characters: | teenage girlboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshipmother son relationshipfather son relationshippolicehusband wife relationshipbrother sister relationshippolicemanbabyreference to godhitmanwaitressalcoholic …police detectiveex husband ex wife relationshipaunt niece relationshipstepmother stepdaughter relationshipstepmother stepson relationship (See All) |
Story: | pickup truckpink pantiesbroken nosecowboy hathairy chestcrossstripperprayervoyeurcafetearsbeervomitingbare buttundressing …drinkbeatingcryingpartycigarette smokingfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditybare chested malebare breastsbloodnuditysexcharacter name in titleviolencedogtwo word titlegunphotographtitle spoken by characterchasepistolbased on playtelephone callshot to deathblood splatterfoodmirrorshot in the chesturinationblondeface slapshot in the headpunched in the facewatching tvsecretshootingliesunglassesbirthdaylingeriemarijuanajailhallucinationhandcuffsreference to jesus christtelephonef wordflashlightstabbingdrug dealereatingfemale pubic hairapologycoffinfishingbirthday partygraveyardmarriage proposalgravecharacter repeating someone else's dialoguevirginkaratestorytellingdebtkicked in the facerabbitlightningpursuitfemale removes her clothestrustcheating wifearsoncorrupt copgaragehatehenchmanpizzapot smokingloss of virginitylooking at oneself in a mirrorlistening to musicshot in the stomachburialbikermechanicstupiditypromisebra and pantiesrear entry sexbloody noseplaygroundpool tablepunched in the stomachcigarette lightercellphonelens flaresports carholding handsmarijuana jointabandoned buildingbarking doghandshake12 year oldfirst datehorse racingdisposing of a dead bodynaivetytrailer homeknocking on a doorcowboy bootsbody in a trunkbaseball captrailer parktrain trackswhite trashauto mechanicstabbed in the shoulderwoman in lingeriedallas texasdistrustspitting bloodpole dancerwoman slaps a manblack dressman hits a womanbreaking a bottle over someone's headsleepwalkingoklahomasexual humiliationnude photographzippo lighterguard dognightgownbloody facehit with a chairthreat to killsnowglobehand on crotchman punches a womantrailer trashlimpingsouthern gothicpizza parlorplaying against typereference to bruce leelittle black dressslip the undergarmentlife insuranceinsurance investigatorblack leather jacketfried chickendead body in a car trunkincest subtextfacial cutdancing in the streetwoman undressing for a manfacial bruisekicking someoneinsurance scambutt grabremoving a brawatching a cartoon on tvstanding in the rainpit bullthrift storekentucky fried chickeninsurance claimpounding on a doorwalking on train trackslighter fluidrunning mascarawoman changing clothesthrown to the floorbuying a gunsetting a car on firebeneficiarylife insurance policycasserolemerkin wigpotato saladreference to mexicosmashing a tv setcollateralreference to south americareference to christopher leebetting on a horsereference to budweiserengaged to be married (See All) |
At the edge of adolescence, Tracy is a smart straight-A student--if not a little naive (it seems...she smokes and she cuts to alleviate the emotional pain she suffers from having a broken home and hating her mom's boyfriend, Brady.) When she befriends Evie, the most popular and beautiful girl in sch …ool, Evie leads Tracy down a path of sex, drugs and petty crime (like stealing money from purses and from stores). As Tracy transforms herself and her identity, her world becomes a boiling, emotional cauldron fueled by new tensions between her and her mother--as well as, teachers and old friends. (Read More)
Subgenre: | coming of ageindependent film |
Themes: | theftrobberydrunkennessdrinkingfriendshipdeathlesbianismseductiondivorcedeath of motherdrug usedysfunctional familyhollywoodadoptiondrug addiction …cheatingself harm (See All) |
Locations: | los angeles californiaurban setting |
Characters: | teenage girlteenage boythiefstudentgirlteacherfriendfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipfamily relationshipshusband wife relationshiptattoobrother sister relationship …female protagonistdanceractresssingle motherinterracial relationshipteacher student relationshipself mutilationself destructivenessself injury (See All) |
Story: | teenage rebellionpopularitydrug abuseclasschickenpainbraclassroomthongdrinkunderwearpantiescigarette smokingfemale frontal nudityfemale nudity …sexbloodkissf ratednumber in titleone word titlethreesomeflashbackdogsex scenefightdancinglesbian kissshowertelephone callcell phonetitle directed by femaleface slapliesunglassesmarijuanabisexualcandlecocainenonlinear timelinechild abusemodelvanjeansliarpay phonedomestic violenceobscene finger gestureteen angsteggbabysitterwatching a moviemovie theaterskateboardstreet lifedrug dealingdrug overdosehaircutshopliftingrap musicunderage drinkingshoppingdeceitclassmategrowing upjuvenile delinquenttank tophairdressermarijuana jointsexual awakeningtriple f ratedbongneedleplastic surgerypubertyadolescencechild molestationmakeovermasochismpeer pressure13 year oldlsdteenage daughterrazor bladeexamchewing gumunderage smokingsurrogate mothereating disorderclothinglifeguardspoonjunior high schooljuvenile delinquencyabsent motherhomeworkflashingpinball machinetattoo parlorrecovering alcoholicreference to frankensteinshoe storefake idlawn sprinklerhockey stickbody piercingpiggy back rideearsurrogate familyhollywood boulevardvenice beach californiadress shopgirls' bathroompromiscuous mothertongue piercingglue sniffingbad influencelatenessstashbelly button piercingephebophiliastuffed toy animalchildhood sexual abusehuffingoverachievermorley cigarettescutting selfflunking out of schoolskating ramp (See All) |
Vincent is an old Vietnam vet whose stubbornly hedonistic ways have left him without money or a future. Things change when his new next-door neighbor's son, Oliver, needs a babysitter and Vince is willing enough for a fee. From that self-serving act, an unexpected friendship forms as Vincent and Oli …ver find so much of each other's needs through each other. As Vincent mentors Oliver in street survival and other worldly ways, Oliver begins to see more in the old man than just his foibles. When life takes a turn for the worse for Vincent, both them find the best in each other than no one around them suspects. (Read More)
Subgenre: | coming of age |
Themes: | theftdrunkennessdrinkingreligionfriendshipmoneypregnancyvoyeurismdivorcedrug usegamblingbullyingadoptiondeath of wifedying |
Locations: | school busstrip clubbusbarhospitalnew york cityschoolbicycletaxicourtroomcatholic schoolnew school |
Characters: | nurseteacherboyfriendfather son relationshipmother son relationshiphusband wife relationshipprostitutedancerlawyerjewishreference to godsingle mothercatholicrussian …russian americanex u.s. soldier (See All) |
Period: | year 1965 |
Story: | pink pantiesbroken nosemini dressfenceclassmini skirtlocker roomcleavagestripperprayerclassroomvoyeurtearsdrinkbeating …cryingpantiescigarette smokingsexbloodcharacter name in titletwo word titlefightdancingphotographtitle spoken by charactertelephone callfoodurinationblondeface slapwatching tvcatsex in bedbooksunglassesrunningneighbortelephonef wordnewspaperold manmontageeatingapologyscantily clad femalebinocularspay phonesuitcasebankconvertiblechildbirthsadnesssleepingnewspaper headlinegirl in pantieseyeglassesanswering machinereference to adolf hitlerlistening to musicbabysitterscene during opening creditsbrooklyn new york citycoitusskateboardstreet lifebreakfastretirementremote controlbloody nosepillscynicismcigarette lightercellphoneraised middle fingercanered pantiesabbreviation in titlecopulationparking lotnew job12 year oldgamblerlaundryhit in the facebreast feedingreading aloudname callinghorse racinglooking out a windowjukeboxdrunk drivingvacuum cleanerlaundromatschool principaldrug dealknocking on a doorloanfacebookstethoscopestrokeunhappinessmailboxchild custodyreading a booknursing homeemergency roomnewborn babyprivate schoolsushidivorced parentshorse racemailmansaintgambling debtrace trackwalkmanvietnam war veteranhomeworkoverhead shotbaptistlawn mowernecktiewater hoserearview mirrordoorbellman boy relationshipblue collarhand kissingnext door neighborhospital gownjoke tellinghead bandagegym classmisanthropepenis slurbank tellernew york city skylinesit upshand woundabandoned by fatherreference to the vietnam warmementobourbonretireesex with a pregnant womangarbage baghealth insurancerussian immigrantyear 1946reference to lyndon johnsonbank clerkdodgeballagnosticbicycle helmetcrossing oneselfcat scanmarbleslawn chairreference to las vegas nevadatoy dinosaurgrumpy old manreference to jane fondairish immigrantphysical rehabilitationwatering a plantgymnasiumhard of hearingphysiotherapyspeech therapyhedonistreference to abbott and costelloreference to mother theresasainthoodbronze starcustody hearingcutting one's handold man young boy relationshipchin upsbaby cribschool report (See All) |
The plot revolves around a young married woman whose mundane life takes a turn for the worse when she strikes up a passionate and illicit affair with an oddball discount-store stock boy who thinks he's Holden Caulfield.
Subgenre: | independent filmblack comedy |
Themes: | theftdrunkennessdrinkingjealousyfriendshipdeathlovesuicidemarriageinfidelitydrugsadulterypregnancydeceptionextramarital affair …depressionblackmaildrug useguiltunfaithfulnessillnessmental illnesssuicide of friend (See All) |
Mood: | rain |
Locations: | texassmall towncarhospitalchurchbathtubmotelsex in a motelsex in a store |
Characters: | christianthiefgirlboyboyfriend girlfriend relationshipfriendmother son relationshipfather son relationshipfamily relationshipspolicehusband wife relationshipbabywriterchristianitysecurity guard …bibleemployer employee relationshipolder woman younger man relationshippregnant wifesuicide by gunshotsuicide by shooting one's self in the headsuicide of lover (See All) |
Story: | pickup truckpaintearsbeervomitingbare buttdrinkdreambeatingcryingcigarette smokingmale rear nudityfemale nuditymale nuditybare chested male …kissf ratedflashbackmale frontal nuditymasturbationdoggunsex scenemale full frontal nuditythree word titlevoice over narrationface slapwatching tvsex in bedliebedmarijuanareference to jesus christswimminghalloweendrivingpainterbathnews reportgunshotspermliaruniformkissing while having sexhatetwenty somethingoverallsdysfunctional marriagemale masturbationburglarypet dogmental hospitalco workermakeupthirty somethinglonernotenervous breakdownadulterous wifewomen's rightsbarking dogstorecartoon on tvstabbed in the handgerman shepherdpaintmotel roompregnancy teststonedinfertilitysecond chancepsychiatric hospitalparasitelimpborn again christianliberationloudspeakerman slaps a womanwomen's bathroomfemale sitting on a toiletaspiring writerfemale vomitingpagancashierapplying makeupfood poisoninglife supportreference to the ten commandmentsbacteriafertilitybible studysex at workwatching news on tvadulteresscosmetics22 year old30 year oldstore roomfacial bruisepublic address systemtwisted ankletalking in bedblackberryhouse painterretailsperm samplereference to catcher in the ryediscovering one is pregnantdeath of a co workerpicnic tablealsatiandiscount storetalking in bed after sexdevil worshipertrying to conceiveheavy makeupretail storesalespersonsex with a coworkersperm countreference to holden caulfieldhand on a breastmotel desk clerkautomatic doorloudspeaker announcementsex with husband's best friendsuicide of colleague (See All) |
In Johannesburg, a small time criminal, Tsotsi, is a teenager without feelings, hardened by his tough life. After a series of violent gang hits, Tsotsi hijacks a car. However, whilst driving, Tsotsi finds that there is a baby on the back seat. He brings the baby to his house in the slum. The next si …x days bring about a change in him that couldn't be foreseen. (Read More)
Themes: | theftrobberydrunkennessdrinkingfriendshipmurderdeathkidnappingmoneygangsterdeath of motherredemptionguiltyouthgambling …illnessdyingfalling in love (See All) |
Mood: | rain |
Locations: | car theftpolice carcarbarhospitaltrainnightclubwheelchairsewerslumshed |
Characters: | teenage boythiefteacherfriendmother son relationshipfather son relationshippolicepolicemandancerbabyartistbullywaitress |
Story: | car drivingchickenpainsubjective cameratearsbeervomitingdrinkunderwearbeatingcryingcigarette smokingfemale nuditymale nudityblood …character name in titlebased on novelone word titleflashbackmale frontal nuditydoggunfightdancingphotographknifeblood splatterfoodpunched in the faceshootingrunningcar crashreference to jesus christcriminalnewspaperwineold manstabbingsubwayapologyradiobartenderlightningdeath of husbandsadnessobscene finger gesturegraffititeabreaking and enteringhappinessrailway stationsouth africafollowing someonecompassionstreet lifethugthunderbroken glassinsectsafeinfectionfriendship between boysreckless drivingcoinspittingminingparalysisgatebreast feedingdefecationbeggarwalletgun held to headbugwetting pantslistening to radioanttrain trackscripplepipeexammercedes benzsewing machinesorrowbmwinformerdicegang leaderfleeingintercomdriver's licensebucketkeysmirror balldiapertownshipchange of heartcaught in the rainfingerprintscar alarmeye injuryburglar alarmchop shophandsfootpaperboygrand theft autosurrogate familyice pickmobileshantytownbaby bottlechicken coopjohannesburg south africapaper bagurban violencebead curtainfaucetunderpasschange of mindshiveringmining accidentbaby nurseryfeeding a babykicking a dogpost apartheidsafety beltchained doorcondensed milkcutting armgarbage can lidrolling dicebaby snatcherhands held over head (See All) |
At 16, Nick Twisp is wry about his teen funk: he lives in Oakland with his sex-addled mother; his father's child support is her meal ticket. While camping in Ukiah, Nick meets Sheeni: for him, it's love at first sight. Nick has to figure out how to get his father a job in Ukiah, then how to get sent … to live with his father, then how to get close to Sheeni, whose religious parents may want her sent away from temptation to a boarding school. There's also Sheeni's all-American boyfriend to contend with. Overwhelmed by the challenges, Nick's about to give up when he conjures an alter ego who whispers revolt into his ear. Nick is not altogether hapless, but can this end well? (Read More)
Subgenre: | teen moviecoming of age |
Themes: | obsessionfriendshipinfidelityadulterydeceptionextramarital affairguiltgriefunfaithfulness |
Mood: | high school |
Locations: | police carrestaurantbeachforestwoodsfrancelakesex in shower |
Characters: | teenage girlteenage boypolice officerstudentboyfriend girlfriend relationshipfriendmother daughter relationshipfather daughter relationshipmother son relationshipfather son relationshipteenagerbrother sister relationshippolicemanbest friendbible …older man younger woman relationshipfrencholder woman younger man relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshiptruck driverlove letterreligious fanaticdream girl (See All) |
Story: | teenage rebellionpain killerblack brablack pantiesdriving in the nudesteroidrevoltbracafevomitingundressingunderwearpantieserectioncigarette smoking …sexkissbased on novelflashbackmasturbationdoggunfightphotographexplosionchaseshowertelephone callfirevoice over narrationcell phonefoodcar accidenturinationslow motion scenepunched in the facecomputerarrestbikiniletterbookliesunglassesrunningmarijuanabathroomneighborjailf wordeatingexploding carapologyspankingon the runbinocularsvirginprologuepay phonetentreadingscene during end creditsconvertibleamerican flagpursuitwigsplit screencabinpoetteenage sexpoempot smokingteen angstloss of virginitylistening to musicsociopathcaught having sexvandalismexploding buildingphone boothswimsuitbreakfastgrocery storeboxer shortsbackpackanimated sequencefirst kisscard playingboarding schoolalternate realitycliffnotefamily dinnerholding handsthanksgivingmale virginnarrated by charactercar troublerunning awayteenage lovevideo storeadolescencejournalhikinglegssplit personalitymaking outknocking on a door16 year oldstonedbathrobebunk bedwhite trashmushroomdeath of boyfriendmoustachebeltlighting a cigarettealter egodivorced parentspolitical activistbmwmiseryclothing storedonutpolice sirenplagiarismdrug tripman in dragwoman in bikinisleeping bagtamponaspiring writerrunning out of gasreference to frank sinatraanimated opening creditssleeping pillsslumber partymobile homeloss of boyfriendlaundry drying on clothes linelooking for a jobjuvenile detentionsuicide contemplationfilm fanschool lockeroakland californiamagic mushroomdestruction of propertymother's boyfriendpart time jobschool expulsionthanksgiving dinnerberkeley californiagrocerieswashing a cartrailer houseinvented languagetripping and fallingbroken down carschool cafeteriabeating with a beltpipe organu.s. sailorsedationvandalizing a carexploding trailerfamily portraitreciting poetrychild supportgarden hosepathological liarreference to federico fellinireference to albert camuspastry shopdestroying a cardoughnut shopgasoline cansetting a car on firecar over a cliffmischievous boyreference to jean paul belmondosanta cruz californiavenetian blindsslurpingrunaway carbloggingfalling asleep in classsex manualthree headed monsterlove childlp recordingreference to john dillingerascotfather's girlfriendreference to robert bressonfinger in someone's anusfictional tv news showcar inside a househand on someone's thighreference to serge gainsbourgwindsurfer (See All) |
At the age of 38, Mark O'Brien, a man who uses an iron lung, decides he no longer wishes to be a virgin. With the help of his therapist and his priest, he contacts Cheryl Cohen-Greene, a professional sex surrogate and a typical soccer mom with a house, a mortgage and a husband. Inspired by a true st …ory, The Sessions, follows the fascinating relationship which evolves between Cheryl and Mark as she takes him on his journey to manhood. (Read More)
Themes: | drinkingjealousyfriendshiprevengemoneyfearfuneralguiltsexualitypoetrydisabilityfalling in lovenear death experience |
Locations: | restauranthospitalbeachchurchhotelbathtubbicycleelevatorwheelchairbaseballmotelsan francisco californiacatholic churchrunning on a beach |
Characters: | teenage boygirlboyboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipfamily relationshipshusband wife relationshiptattoosingerprostitutewriter …priestbest friendreference to godjewcatholiccatholic priestself pitysex therapistself deprecation (See All) |
Period: | year 1988 |
Story: | white pantiespicnicbuttocksspiritualitypainman with glassesbrasubjective cameracleavageprayervoyeurcafetearsbeerundressing …drinkpantieserectionpartynipplescigarette smokingfemale rear nudityfemale nuditybare chested malekisssexflashbackmasturbationtwo word titlesex scenefemale full frontal nudityejaculationsingingleg spreadingtelephone callvoice over narrationsongwoman on topfoodurinationblondecatwritten by directorsex in bedbooksunglassesrunningmarijuanacollegereference to jesus christtelephonef wordnewspaperambulancewomaneatingfemale pubic hairapologyscantily clad femalecoffinunderwater scenemarriage proposalcoffeeflash forwardconfessioncursevirginfired from the jobfantasy sequencereadingcollege studentfemale removes her clothessadnesspoetsleepingtypewritereyeglassespoemhugginganswering machinepot smokingloss of virginitytape recordertherapisthome movieforbidden lovechokingpromisejob interviewpower outagesex talkanxietydespairpanties pulled downtan linemale virginwoman in bathtubsermonsexual awakeningnarrated by characterprayingjudaismparalysistelevision newsfemale genitalianaivetymasochismnewspaper articleecstasyreading a bookkarmashirtgurneyloss of sisterstation wagonsexual repressionundressing someonegolden gate bridgeintimacyreference to the virgin maryshared bathwoman undressingfirst sexual experiencephilosopherpremature ejaculationsexual pleasureman in a wheelchairjealous husbandsynagogueimplied nudityweepingsexual explorationsexual arousal911power failuretrolleyvoice over inner thoughtsdoorbellsaying goodbyeoxygenreference to the bibleactress breaking typecaststrong sexual contentcolognelogicpoliosex therapyearmale with long hairwoman wearing glassesberkeley californiajewish manbed riddenoutdoor cafescratching6 year oldcollege graduationsense of touchspeaker phonevoice over writingmotorized wheelchairthrift storeweeping womangirl wearing pantiesshaving someonesponge bathfutonrespiratordifficulty breathingsex surrogatehandicap seximplied male nuditylove poempity sexreading a poemwriting a poemiron lunguniversity of california berkeleyitch38 year oldreference to boston massachusettsjewish convertpower blackoutmotel desk clerk49 year oldkissing someone's chestorange tabby catoxygen tentpolio victimmikvah (See All) |
A suburban Chicago teenager's parents leave on vacation, and he cuts loose. An unauthorised trip in his father's Porsche means a sudden need for lots of money, which he raises in a creative way.
Subgenre: | teen moviecult filmerotic fantasy |
Themes: | robberyjealousyfriendshipdrugsmoneyvoyeurismwrestling |
Mood: | high schoolcar chase |
Locations: | cartaxiairportchicago illinoiscar in waterschool nursesex in a chair |
Characters: | teenage boyfriendmother son relationshipfather son relationshipteenagerprostitutepimpdancing in underwear |
Period: | 1980s |
Story: | car drivingadolescent boywhite pantiesmini dresssexual humorstrippingcleavagevoyeurundressingunderwearpantiespartyfemale frontal nudityfemale nuditymale nudity …bare chested malesexmasturbationtwo word titlesex scenedancingshowertelephone callwoman on topblondeslow motion scenebedmarijuanabathroomprostitutiontelephonebedroomhousesubwayscantily clad femalefantasy sequenceprankpremarital sexdirectorial debutclass differencesteenage sexsexual fantasyshavingteen angstdesirenipples visible through clothingpokersexual attractiongroup of friendsice creamred dressblockbusterblack humormale underwearsexual desireunderage drinkingburglarysex talkpanties pulled downattractionextortionliving roombriefswrestlermale in showerclose up of eyespractical jokedockfemale removes her dressstairwaycall girlbikeporschewhite briefsdrug humorsex on stairspoker gameoverhearing sexsubway trainshort shortsfemale in a showerhome alonesodasexual jokecounting moneylifting weightsburgermale in a showerkissing in publicauto repairdark glassesbutt grabelectric razorwearing sunglasses at nightweight trainingtransvestite prostitutelake michiganfifty dollar billcollege boundfaberge egghigh school wrestlingalone in houseadult actor playing minorbaby picturecollege interviewtrashed housepop quiz (See All) |
Teenager Andie is one of the not-so-popular girls in high school. She usually hangs out with her friends Iona or Duckie. Duckie has always had a crush on her, but now she has met a new guy at school, Blane. He's one of the rich and popular guys but can the two worlds meet?
Subgenre: | teen moviecoming of ageindependent filmcult filmteen romanceteen comedy |
Themes: | drunkennessdrinkingfriendshipdanceangerpovertydysfunctional familydatingunrequited lovefashionwealthfirst love |
Mood: | high school |
Locations: | trainschoolnightclubschool teacherschool dance |
Characters: | teenage girlteenage boystudentboyfriend girlfriend relationshipfather daughter relationshipteenagersingermusicianlustteacher student relationshipchinesesingle father |
Period: | 1980s |
Story: | high school girlhigh school studenthigh school boywhite pantiesargumentbracleavagetearsunderwearcryingpantieskissdancingphotographsinging …three word titlefistfightblondewatching tvcomputermarijuanacolor in titlerock bandlibrarymicrophoneconvertiblegymclass differencesredheadrecord playergirl in pantieseyeglassesnerdtraditionanswering machineteen angstdresstitle based on songcrushforbidden lovepet dogshoppingposterplaying cardscartoon on tvteenage lovelockeralarmbicyclingmaking outvolleyballlistening to radiogeneration gapteenage daughterpromaudio cassettehouse partysewing machinedesigneropposites attracthomeworkreference to madonnasuitorrecord storemusic storedance contestsnobphonograph recorddevotionreference to karl marxhigh school danceslumber partyyearbooknylonsrich snobwashroomteenage romancehalljuvenilehigh school promteen lovereference to franklin d. rooseveltunderageparty dressbrat packwrong side of the tracksrich man poor womanshy girlschool yearbookrailroad tracksreference to david lettermanmusic albumhigh school sweetheartsprom dressbreasts growingsocial consciousnessreference to tina turnertwo suitorspreppiesingle dadreference to lionel richieshermer illinois (See All) |
After being rejected from every college he applied, Bartleby Gaines decided to create a fictitious university, South Harmon Institute of Technology, with his friends, to fool their parents. But when their deception works too well and every other college rejects starts to apply to his school, B. must … find a way to give the education and future his students and friends deserves, including his own, while trying to win the heart of the girl next door. (Read More)
Themes: | theftdrinkinglovemoneyfearbullyingeducationphotography |
Mood: | high school |
Locations: | hospitalswimming poolmotorcyclebicycle |
Characters: | teenage girlteenage boythiefstudentgirlteacherboyafrican americanfather daughter relationshipmother daughter relationshipmother son relationshipfather son relationshipfamily relationshipsteenagersinger …brother sister relationshipphotographerbullyuncle nephew relationship (See All) |
Story: | boy with glassesscholarshipheartfootball playeramerican footballclassman with glassesbraclassroombeerdrinkpartysexone word titlemasturbation …title spoken by characterexplosionsingingtelephone callcell phonesongfoodmirrorcomputercamerabikiniletterbathroomcollegeflashlightbandvideo cameramontagebinocularsfired from the jobproduct placementcollege studentscreamuniversityciablack americandiscobreaking and enteringfraudskateboardscamremote controlshoesrejectionanxietyskateboardingsexual harassmentmeditationbilliardswilhelm screammannequintelepathyhandshakeohioplaying poolurban legendwebsitecrutchestrailer homefraternitycostume partystrait jacketmailhazingimmaturitymailboxreference to albert einsteinspitcollege campussushibody painthigh school graduationwoman in bikinidriver's licensefire alarmrenovationapple computerlawn mowergeneration ywood carvingfake idhearingharvard universityshrimphigh school promcroquetsprinkler systembeer kegtromboneadhdarchitectural modelcollege deanyale universityelectro shockfraternity housepogo stickattention deficit disorderkoshershoe salesmanprinceton universityanti gayattention deficit hyperactivity disorderbased on urban legendcollege entrancehalfpipeinkblotbreaking through wallreference to pocahontassat testglee clubhot dog costumecollege tuitiontheme partyweinersetting off a sprinkler system (See All) |
When art student Ben Willis is dumped by his girlfriend Suzy, he develops chronic insomnia after finding out how quickly she moved on. To pass the long hours of the night, he starts working the late night shift at the local supermarket. There he meets a colorful cast of characters, all of whom have …their own 'art' in dealing with the boredom of an eight-hour-shift. Ben's art is that he imagines himself stopping time. This way, he can appreciate the artistic beauty of the frozen world and the people inside it - especially Sharon, the pretty and quiet checkout girl, who perhaps holds the answer to solving the problem of Ben's insomnia. (Read More)
Themes: | jealousyartmemoryangerbreak upregret |
Locations: | strip clubbarsnowlondon englandbicycleart school |
Characters: | teenage girlteenage boystudentgirlteacherboyfriend girlfriend relationshipfriendartistbest friendlittle girllittle boylustmotheremployer employee relationshipex boyfriend ex girlfriend relationship …writer director (See All) |
Story: | white pantiesbuttocksmini skirtlocker roombracleavagestripperclassroomvoyeurtearsthongundressingdreamcryingpanties …erectionpartynipplesfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditynuditybloodone word titleflashbackmasturbationfemale full frontal nuditydancingphotographtitle spoken by characterleg spreadinglabiatelephone callvoice over narrationblondeslow motion scenewatching tvcomputercamerawritten by directorletterpaintingsex standing upcollegekung fusoccerfootballdinerfemale pubic hairmodelapologyscantily clad femaledrawingbirthday partybartenderuniformfantasy sequencecollege studentprankfilm within a filmsadnessmanagereuropefreeze framesexual fantasygamesupermarketraceslow motionnude modelsexual attractionenemyflatulencetimeart gallerymilkbossclockfull moonmovie theatregrocery storesurveillance camerabreakupmisunderstandingspanishco workertime lapse photographyfirst kissdeerhustlerrefereebullet timedormitorynarrated by charactervideo surveillanceboredomsandwichcafeteriaexotic dancerfirst dateblue pantiessubtitlesdiscoverysexual tensionthong pantiesscooterinsomniadepartment storeblizzardplaying a video gamebased on short filmmonitorhouse partycustomerholesleeplessnesstoy gunneck bracepigtailsshopping cartslapswedishdefeatsoccer footballfootball gamephonograph recordgalleryfemale explicit nuditycashierdorm roomlongingart classfemalepokiesexchange studentfemale underwearplaying chessgay jokenight shiftsketchingphallic symbolshampoointrospectionarm castbraidsexhibittime freezewoman wearing a thongart shownude drawingprank calljob applicationtravel agentstopped timehustler magazinelift skirtman undressing a womanfrozen timemateexposed underwearfast motionbolerofawnexposed thong underwearlife drawingreference to russell croweaccommodationgallery showinghead slap (See All) |
Lil ('Naomi Watts' (qv)) and Roz ('Robin Wright (V)' (qv)) are two lifelong friends, having grown up together as neighbors in an idyllic beach town. As adults, their sons have developed a friendship as strong as that which binds their mothers. One summer, all four are confronted by simmering emotion …s that have been mounting between them, and each find unexpected happiness in relationships that cross the bounds of convention. (Read More)
Themes: | drunkennessdrinkingjealousyfriendshipdeathrevengemarriageinfidelityadulterypregnancyfearweddingvoyeurismmemoryextramarital affair …divorcelonelinessdeath of fatherguiltunfaithfulnesstheatre (See All) |
Locations: | busbarhospitalbeachhotelcemeterykitchenaustraliafranceofficeoceantownsuvrunning on a beach |
Characters: | teenage girlteenage boyboyboyfriend girlfriend relationshipfriendfather son relationshipmother son relationshipfamily relationshipshusband wife relationshipsingerdanceractorbabyactressbest friend …reference to godaustralianex husband ex wife relationshipolder woman younger man relationshipgrandmother granddaughter relationshipyounger version of charactertheatre director (See All) |
Period: | summer |
Story: | black pantiesbroken legcrosscleavagevoyeurtearsbeervomitingbare buttdrinkdreamcryingpantiescigarette smokingfemale rear nudity …male rear nudityfemale nuditymale nuditybare chested malekissnuditysexf ratedflashbackfightdancingphotographsingingleg spreadingtelephone callcell phonesongwoman on toptitle directed by femalefoodmirrorblondeface slapcomputerbikinisex in bedsecretbookliesunglassesrunningbirthdaysex standing upneighborreference to jesus christtelephonef wordswimmingwineeatingwidowapologychildscantily clad femalebirthday partyunderwater scenegraveyardbartenderflash forwardjeansgravechampagneauditionflowersdeath of husbandlaptopsadnessreunionsuspiciontearevelationlooking at oneself in a mirrorlistening to musichappinessagingwatching a movieswimsuitsurfingaudiencecoitusforbidden loveart galleryburialbald manministercard playingseasidecliffcopulationwedding receptionsunbathingphoto albumfemale female kissnew jobbirthday presentsydney australiaremorsereading aloudcrutcheslost lovesurferraft18 year oldtheatre productiondolphingiving a toastmother in lawbeach houselollipopswimming underwaterreverendsurfboardreading a booksurrogate motherlesbian subtextleg injuryleg woundremarriageoverhead shotbedtime storyhappy birthdayrearview mirrorsaying goodbyeplay rehearsalbreaking upsidewalk cafebased on novellatryst20 year oldunderwater fightsurrogate sonwoman directorleg in a casttravel agentcurtain callwetsuitphysical rehabilitationbank checkloversreference to george gershwin21st birthdaymusical productionreflection in a rearview mirrorantisepticreading a book to a childsurfing accidentwater wings (See All) |
1954. The sexual hijinks of a group of mid-teen male students of Angel Beach High School in Florida are presented. Their main goal is to lose their collective virginity. In the process, they embark on games of sexual innuendo with their female classmates, as witnessed by the activities of Billy, Tom …my and Pee Wee in their secret surveillance. Pee Wee is the most desperate, that desperation which gets him into one predicament after another, especially as he is the butt of many a prank. A side issue for Tim, basically a good guy, is dealing with his learned racism, which comes to the surface with the arrival to their school of new student, Jewish Brian Schwartz. The sexual pursuits at the school are not limited to the student body as new boys Phys Ed coach, Roy Brackett, has a mutual attraction with cheer-leading coach, Miss Lynn Honeywell, who doesn't want to go all the way; Coach Brackett's goal is to find out why Coach Warren has nicknamed Miss Honeywell "Lassie". All these goings-on offend the sensibilities of female Phys Ed coach, Miss Beulah Balbricker, who takes it upon herself to maintain the moral standards of the school. The boys' mission seems to be stalled, so Mickey, whose brother Ted is the local sheriff, suggests they go to Porky's, a bar and unofficial brothel in neighboring Wallacetown in the middle of the Everglades, to lose their virginity. Porky's is owned by the violent Porky, whose actions are supported by his sheriff brother. The boys' experience at Porky… (Read More)
Subgenre: | teen moviemartial artscult filmteen comedyteen sex comedyhigh school comedy |
Themes: | revengevoyeurismracism |
Mood: | high school |
Locations: | school busstrip clubtruckbuscarbarschoolforestmotorcycleboatwoods |
Characters: | sheriffstudentteacherpoliceteenagerprostitutejewishlustteacher student relationship |
Period: | 1950s |
Story: | high school studentcowboy hatcoachpigcheerleadermini skirtlocker roompublic nuditycleavagestrippervoyeurbeerbare buttpantieserection …partyfemale frontal nudityfemale rear nudityfemale nuditymale nuditybare breastsone word titlemale frontal nuditymasturbationgunsex scenefightfemale full frontal nuditydancingsingingleg spreadingshowermachine gunshotguncondomrevolvergay slurbasketballbridgeboxingfemale pubic hairscantily clad femalecigar smokingsmokingvirginmoaningprankconvertiblegymcabinhandguncorrupt copgirl in pantieschainsawnerdloss of virginityboxerfraudblockbusterfloridavirginitytowelpeeping tomredneckanti semitismunderage drinkingswampcon artistfat manpanties pulled downred pantiesfemale in showerpractical jokeflagteachingexotic dancerloud sextrapdoorjujitsucheerleader uniformfat womanwoman moaning from pleasurewoman moaningmoaning womancrookhigh school dancegym classfat girlconfederate flagnightclub ownerfake bloodyellow pantieserotic dancingvestprank telephone callyear 1954anti semitic slurlocker room sexroadhousereference to lassiemeasuring peniscrude humourexotica dancingrebel flag (See All) |
After his wife, Alice, tells him about her sexual fantasies, William Harford sets out for a night of sexual adventure. After several less than successful encounters, he meets an old friend, Nick Nightingale - now a musician - who tells him of strange sex parties when he is required to play the piano … blindfolded. All the men at the party are costumed and wear masks while the women are all young and beautiful. Harford manages to find an appropriate costume and heads out to the party. Once there, however, he is warned by someone who recognizes him, despite the mask, that he is in great danger. He manages to extricate himself but the threats prove to be quite real and sinister. (Read More)
Subgenre: | cult filmsuspenseconspiracyerotic thriller |
Themes: | obsessiondrunkennessdrinkingjealousyfriendshipmurderdeathmarriageinfidelitydrugschristmasmoneyadulteryfeardance …deceptionvoyeurismmemoryextramarital affaircorruptiondeath of fatherparanoiadrug useredemptionguiltcrueltywealthmysterious death (See All) |
Mood: | neo noirnightmarenight |
Locations: | restaurantnew york cityhoteltaxiurban settingcitytaxi driversex in public |
Characters: | nursegirlboydoctorboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipprostitutedancermusicianwaitresslustpsychiatrist …self discoveryfiance fiancee relationship (See All) |
Period: | 1990s |
Story: | black pantieswhite pantiesdrug abusewoman with glassespublic nuditystrippingman with glassescleavagevoyeurcafebeerthongundressingdrinkunderwear …dreamcryingpantiespartynipplescigarette smokingfemale frontal nudityfemale rear nuditymale rear nudityfemale nuditymale nuditykisssexbased on novelfemale full frontal nuditydancingleg spreadingthree word titletelephone callfondlingmirrorurinationwatching tvmasklingeriebeddead body69 sex positionmarijuanasex standing upbathroompianoprostitutionhallucinationorgymanhattan new york citynewspaperbedroomcandlebanddisguisemansioncocainetoiletfemale pubic hairlesbian cunnilingusmodelcultno opening creditsscantily clad femaleforeign language adaptationritualroommateconfessiondrug addictcostumechampagnestorytellingreadingchristmas treepianistfemale removes her clothesblindfoldcult directorsacrificeheroinbralesspowergirl in pantiessexual fantasyflirtingpot smokingrevelationno pantiesdesirenipples visible through clothingbabysittersexual attractionpatientmorguetherapistdysfunctional marriageaudienceteddy bearcoitusart galleryvirginitydead womanmasked mandrug overdoserole playingsexual desirebra and pantieshookerrear entry sexsurveillance cameraguestpool tablesex talkjunkiesculpturepanties pulled downfrustrationdeceitwedding ringsailortuxedolooking at self in mirrorbruisenude woman murderedcopulationmannequincoffee shopgirl in bra and pantiesmysterious mang stringdirector cameocartoon on tvchristmas presentpromiscuous womancentral park manhattan new york citydoubtfemale removes her dressjazz musicbitternesssexual tensionthong pantiessex orgyunconsciousnessreceptioniststonedmissingmarriage problemsnaked dead womanrainbownude with glassespasswordritecaressteenage girl in underwearblack dressrehablolitasexual obsessionhungariansubculturefemale sitting on a toilettrophy wifehiv positivecuriositymarital crisisgreenwich village manhattan new york cityjazz clubtoy storecamel toemedical schoolguilty conscienceilluminatishooting upmasked womantaking off pantieslynchianuninvited guesthotel desk clerkpramsociologistprivilegedead woman in morguesexual curiositymasked ballpromiscuous daughtercape cod massachusettslooking in mirror while nudesoho manhattan new york cityex classmateunwanted guestcostume shopwife and husband lead actorsblue lightrockefeller center manhattan new york citysecret clubchristmas shoppingreal life husband and wife play husband and wifechristmas starosteopathhouse callreference to the nutcrackerlaughing fitsex act reflected in a mirrorbackground music score revealed to be source musicbald spotdog muzzlereference to ovid (See All) |
The story of John Lennon's childhood and teenage years from 1944 to 1960, his relationship with his aunt Mimi and his mother Julia -the two dominant women in the first part of his life-, his first meeting with Paul McCartney and George Harrison, their friendship, their love for music and the birth o …f The Beatles. (Read More)
Subgenre: | coming of agetragedy |
Themes: | theftdrunkennessdrinkingfriendshipdeathmoneyfuneralangerdeath of motherdepressiondeath of wifechildhood |
Mood: | nightmareaffection |
Locations: | busrestaurantschoolcemeterybicycle |
Characters: | teenage girlteenage boythiefstudentgirlteacherboyboyfriend girlfriend relationshipfriendmother son relationshipfather son relationshiphusband wife relationshipsingerdancermusician …babysister sister relationshipbest friendreference to godlittle boycousin cousin relationshipuncle nephew relationshipaunt nephew relationship (See All) |
Period: | 1960s1940s1950s |
Story: | boy with glassessexual humorwoman with glassesargumentcafetearsbeerdrinkunderweardreamcryingpartycigarette smokingkisssex …bloodf ratedflashbackmasturbationtwo word titlefingeringdancingphotographsingingbased on true storytelephone callfondlingbased on booksongtitle directed by femalefoodmirrorurinationpunched in the facesecretletterbooklierunningbirthdayrock musiccollegepianoguitartelephonebedroombandambulancemontageeatingwidowhouserock banddrawinghit by a carbirthday partygraveyardflash forwardmicrophonereadinguniversitydeath of husbandrock 'n' rollsadnesscharacter says i love yousleepingpubrecord playerbirthday caketeateen angstwhat happened to epiloguehead buttdesirelistening to musictape recorderrecordingtitle based on songgroup of friendsrageguitaristaudienceblack humorpassportmovie theatreswitchbladebloody noseshopliftingbackstagedrummertheatre audienceabsent fatherschool uniformsongwriterpierattractiondark pastdressing roomrecording studiolaughingdead motherpajamascrowdexhibitionismnew zealandmusic bandfast motion scenedrumsjoypiano playerreference to elvis presleyporn magazinedark secretadolescencejazz musiclooking out a windowguitar playingharmonicabus stopflasklistening to a radiowrathguitar playerurinalguardianhamburg germanypawnshopwakegravestoneoutdoor oral sexmailmanthe beatlesgrudgedoormanabsent motherwaveoverhearing sexmusical instrumentrecord storemusic storebanjomusic groupreference to winston churchillrock groupliverpooloverheard conversationdouble decker busbloody mouthboardwalkcollapsesketchingdeath of uncleabandoned by fatherillegitimacygarden shearshalf brother half sister relationshipabandoned by motherbirth certificatechildhood memoriesboys' bathroomband managerlodgerschool suspensionlawn chairfish and chipsknocking on doortroubled teenage boyblackpool englandabandoned by husbandreference to buddy hollyreference to little richardsleeping on a benchreference to tchaikovskysinging along with a recordbiochemistryseaside resortbanjo playerschool blazerbrain hemorrhagewashboardlistening to classical musicclipping a hedgemerchant navy (See All) |