Please wait - finding best movies...
WADJDA is a 10-year-old girl living in a suburb of Riyadh, the capital of Saudi Arabia. Although she lives in a conservative world, Wadjda is fun loving, entrepreneurial and always pushing the boundaries of what she can get away with. After a fight with her friend Abdullah, a neighborhood boy she sh β¦ouldn't be playing with, Wadjda sees a beautiful green bicycle for sale. She wants the bicycle desperately so that she can beat Abdullah in a race. But Wadjda's mother won't allow it, fearing repercussions from a society that sees bicycles as dangerous to a girl's virtue. So Wadjda decides to try and raise the money herself. At first, Wadjda's mother is too preoccupied with convincing her husband not to take a second wife to realize what's going on. And soon enough Wadjda's plans are thwarted when she is caught running various schemes at school. Just as she is losing hope of raising enough money, she hears of a cash prize for a Koran recitation competition at her school. She devotes herself to the memorization and recitation of Koranic verses, and her teachers begin to see Wadjda as a model pious girl. The competition isn't going to be easy, especially for a troublemaker like Wadjda, but she refuses to give in. She is determined to continue fighting for her dreams... (Read More)
Subgenre: | coming of age |
Themes: | religious fundamentalismreligious prejudicereligious bigotryreligious intoleranceweddingmoneyreligionfriendship |
Mood: | religious educationreligious |
Locations: | religious schoolschool buskitchenbicyclebusschoolhospital |
Characters: | religious fundamentalistreligious zealotmuslim girldrivermuslimbest friendlittle boylittle girlteacherfemale protagonistchildrenfriendmother daughter relationshipfamily relationships |
Story: | bicycle helmetschool principalcoffee mugtoy storereligious disciplinewomen in islamradical islamrock throwingmuslim womenred dresslearning to ride a bicyclefalling off a bicycleriding a bicyclegirls' schoolsaving money β¦raising moneyprize moneyfundamentalist religionschool uniformreference to the matrixchuck taylor gym shoeswoman wearing a veiltraining wheelsritual cleansingsubmissive womenskinned kneesocial pressureprize winnerbelief in the devilmix tapego betweenchild marriagepainting toenailsmemorizationbroken dishyarnvice squadrecitationwomen in societyfamily treechild bridequr'anbelief in the afterlifeburqamughopscotchpatriarchykoransaudi arabiahead scarfnail polishfundamentalismestranged fatherwater fountainhijabloudspeaker10 year oldfriendship between girlspolygamyaudio cassetteplaying a video gameinfertilityblackboardprincipaltomboyconstruction workerstonesneakerswomen's rightsstoresandwichbelief in godtitle appears in writingshopping mallchild protagonistsexismconstruction sitechild's point of viewbackpackplaygroundcrushislamlistening to musictape recorderhelmetdresshuggingrockscandaldirectorial debutfireworkselectionbraceletvanradiofalse accusationcookingsoccerbedroomcompetitionprayerclassroomcryingtelephone callsingingtitle spoken by characterphotographcharacter name in titleone word titlef rated (See All) |
Matilda Wormwood is an exquisite and intelligent little girl. Unfortunately, Matilda is misunderstood by her family because she is very different from their ways of life. As time passes, Matilda finally starts school that has a kindly teacher, loyal friends and a sadistic principal. As she gets fed β¦up with the constant cruelty, Matilda begins to realize that she has a gift of telekinetic powers. After some days of practice, Matilda suddenly turns the tables to stand up to her parents and outwit the principal. (Read More)
Subgenre: | cult filmblack comedydark comedy |
Themes: | friendshipangersupernatural powerdysfunctional familyadoptioncruelty |
Locations: | schoolwater |
Characters: | best friendlittle girlteacherfemale protagonistmother daughter relationshipfamily relationshipsfather daughter relationshipafrican americanbrother sister relationshipbabysingle mothervillainteacher student relationshipaunt niece relationshipbaby girl |
Story: | school principalhopscotchblackboardprincipalchild protagonistchild's point of viewdresscookingclassroomcryingtitle spoken by charactercharacter name in titleone word titlef ratedbased on novel β¦based on bookcatbookchild abuselibraryfbidollreadingdirected by starsingle parentflyingwoman with glasseslifting someone into the airfbi agentstealingoverallsvillainessmilkgirl with glasseswatching televisionmisunderstandingironytime lapse photographythrown through a windowtelekinesisgeniusclose up of eyesforename as titlereading aloudsarcasmmathematicslibrarianelementary schoolcottageglassfemale heroroller skatingadopted daughtercarrotfemale athleteswingingprecocious childchild prodigyfat womanglobepancakewagonhung upside downcerealfederal bureau of investigationphone bookhula hooplifting a female into the airbraided hairgluefirst day of schoolchalkspellingpsionic powerneglected childribbonchild neglectreference to moby dickadoptive motheroverweight childdisbelieving adultsiren the alarmadoptive mother adopted daughter relationshipspinningdedicated teacherprincipal's officechocolate cakelibrary bookthrowing foodroller bladessix year oldchild geniussleepmaskbad parentssupergluecharacter calls female sirhair ribbonshot putbad parentingegg beatermunich olympicsnewtfirst grade teacherhammer throwreference to ishmaelteaching oneself to read (See All) |
Nader ('Payman Maadi' (qv)) and Simin ('Leila Hatami' (qv)) argue about living abroad. Simin prefers to live abroad to provide better opportunities for their only daughter, Termeh. However, Nader refuses to go because he thinks he must stay in Iran and take care of his father (Ali-Asghar Shahbazi), β¦who suffers from Alzheimers. However, Simin is determined to get a divorce and leave the country with her daughter. (Read More)
Subgenre: | coming of age |
Themes: | religious intolerancemoneyreligionmurderdeathmarriagepregnancyfearinvestigationmemorydivorcetheftpovertydepressioninheritance |
Locations: | kitchenbusschoolhospitalelevatorwheelchairgas stationschool teacher |
Characters: | muslimlittle girlteacherfemale protagonistmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipdoctorbrother sister relationshipgirlthiefreference to godmaid β¦daughterfathergrandfather granddaughter relationshipmother in law son in law relationshipasking for forgiveness (See All) |
Story: | girls' schoolqur'ankoranhead scarfwater fountainhijabblackboardislamfalse accusationcryingtelephone callphotographcharacter name in titlef ratedbare chested male β¦fightcell phonecar accidentarrestlietearssunglassesrunninglow budget filmbathroompianojailhandcuffstelephonesubjective cameranewspaperold manwomanjudgeapologydrawinghit by a carlooking at the camerapainimmigrationconfessionprologuekeyfired from the jobliarsuitcasedebtbankscene during end creditsdomestic violencecourtwitnesssuspicionclasssleepingclass differencescouplesurgeryeyeglassesteahead buttlawscene during opening creditsdiseasetied to a bedteddy bearhonoriranpassportgirl with glassespromisebloody nosepillsmobile phonethirty somethingalzheimer's diseasebalconymarital separationbenchmarital problemmiscarriageseparationsinislamicshameethicstestimonyrunning awayemigrationdoubtreading aloudstairwaylooking out a windowmarried coupleknocking on a doorbankeriranianscene of the crimecdtutorwrathresponsibility11 year oldcircular staircasegynecologistjunior high schoolstudyinghomeworkfather in law daughter in law relationship19 year oldhumanitytehran iranarabicwife leaves husbandbailfired from a jobshacklescaregiverdoorbellpersianvisadead babyoxygen maskcompact discoxygencivilizationhearingtemperbed wettingjudgmentreference to allahsister in law sister in law relationshipwetting oneselfabandoned by motherbad temperoverhearing a conversationcopy machineslamming a doorwanting a divorcerugsocial differencesdizzinessfalling out of bedseventy somethingbody searchdirty moneyhot tempercompensationjoblessnesscourt of lawshaving someonelocking a dooreighty somethinglying in waitmedical examgiving someone a bathopen endingcommutingtirednessmutismunbornunhappily married womancreditorvenetian blindsabandoned by wifeblood moneydrinking fountainelder carehitting someoneobligationselling a carcobblerwindow blindschadordisturbing the peacefalling on the floorfalse accusation of stealingsitting in a car (See All) |
After a little white lie about losing her virginity gets out, a clean cut high school girl sees her life paralleling Hester Prynne's in "The Scarlet Letter," which she is currently studying in school - until she decides to use the rumor mill to advance her social and financial standing.
Subgenre: | teen movieteen comedyteen sex comedy |
Themes: | religious intolerancereligionfriendshipmarriageinfidelityadulterydrinkingextramarital affairdivorceguiltunfaithfulnessdatinghomophobiaadoptiondevil |
Mood: | satirehigh school |
Locations: | kitchenschoolrestaurantchurchswimming poolsinging in the shower |
Characters: | best friendteacherfemale protagonistfriendmother daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipfather daughter relationshipteenagerboyfriend girlfriend relationshipsingerboy β¦brother sister relationshipteenage girlprostituteteenage boygirlstudentpriestchristianreference to godchristianityteacher student relationshipbiblecatholicolder man younger woman relationshipgay teenagerolder woman younger man relationshipgay friendreligious fanaticreligious teen (See All) |
Period: | 2010s |
Story: | school principalbelief in the devilbelief in the afterlifefriendship between girlsprincipalsneakersbelief in godhuggingscandalfalse accusationbedroomprayerclassroomcryingtelephone call β¦singingphotographfemale nuditydogtwo word titlebare chested malesex scenekisspartypantiesshowercell phonesongmirrorface slapslow motion scenewatching tvdrinkcondomliebeertearssunglassesvibratorbirthdaycafemarijuanareference to jesus christguitarstrippercleavagegay slurcaliforniabasketballdinnerscantily clad femalespankingtalking to the cameraconfessionmicrophonevirginprotestlocker roomliarmini skirtmoaninggymamerican flaghigh school studentcheerleadercrossgardenclassgraffitifreeze framemachismocloseted homosexualwaiterpot smokingloss of virginityfaintinghappinessdemonstrationgossipfloridaone night standvirginitypreacherembarrassmentmovie theatrebloody noserap musiccynicismhypocrisyministerpunched in the stomachaquariumtime lapse photographyhit on the headpanties pulled downbookstorecliffred pantiesclassmatelooking at self in mirrorpastorbigotrypromiscuityfast motion scenesouthern accentoutcastreference to facebookwoman cryingcafeterianame callingconfessionallegsrumorpeer pressurefascistacceptanceadopted sonpopularitycdman in swimsuitguitar playertolerancevolkswagenchick flickreference to googleweekendallergytextingsewingborn again christiandetentionunwanted kissinterracial adoptioncloseted gayinner title cardgay pridemotor scootercheerleader uniformvolkswagen beetleimplied nuditypreachingreputationhappy birthdayice cream coneenglish teachermascotcliquejumping on a beddevil costumegeneration yreference to marlon brandoteen drinkingpetitiongazebospin the bottleabstinencereference to tom cruiseinfamyguidance counselorwebcastspellingwater slidewatching a movie on tvinnuendoreference to mark twaingay man straight woman relationshipbelief in hellpunched in the gut22 year oldsleazecommunity collegevespastdreference to disneylandadoptive father adopted son relationshippicture framemopping a floorpuritangreeting cardcomedic sex sceneenglish classnotorietyprincipal's officeschool suspensionanagramgirls' bathroompledgereference to huckleberry finnpietyschool bandcouponorange the fruitschool boardchocolate milkmascot costumepep rallyadoptive mother adopted son relationshipcontact lensessatan worshipbumping into someonestudent councilbad reputationprayer groupreference to alfred kinseycarpoolstate flagthrowing a cell phonebirth control pillreference to home depothand signaljesus freakporno theatrereference to ashton kutcherreference to costcoreference to demi mooreearth dayreference to disney worldhigh school gymnasiumreference to john hughesschool mascotchlamydiafake sexkissing gamepeasrumor mongerschool detentionsharpening a penciltowel snappingcleaning a bathroomcommunity gardenreference to google earthreference to sylvia plathreference to the scarlet letterspreading rumorbreaking a picture framegift cardreference to nathaniel hawthorne (See All) |
Down and out rock star Dewey Finn gets fired from his band, and he faces a mountain of debts and depression. He takes a job as a 4th grade substitute teacher at an uptight private school where his attitude and hijinx have a powerful effect on his students. He also meets Zack, a 10-year-old guitar pr β¦odigy, who could help Dewey win a "battle of the bands" competition, which would solve his financial problems and put him back in the spotlight. (Read More)
Subgenre: | cult film |
Themes: | friendshipdrinkingdrunkennessdeceptionangerillnesseducationdyingfashion |
Mood: | high school |
Locations: | school busschoolbarsnowsmall townlos angeles californianightclubschool teacher |
Characters: | best friendteacherfriendfamily relationshipspolicesingerboygirlstudentmusicianalcoholicteacher student relationship |
Period: | 2000s |
Story: | school principalschool uniformblackboardrockvancompetitionclassroomtelephone callsingingtitle spoken by charactersongfoodurinationcomputerdrink β¦secretlierock musicpianoguitarbandnew yorkmontagedinertoiletrock bandapologychildroommatefired from the jobliarscene during end creditspianistcheerleadercontestrock 'n' rolldarkschoolgirlclassterminal illnesseyeglassesfarcewoman with glassesscene during opening creditsguitaristrehearsalimpersonationrebellionembarrassmentrock concertbootsimpostordrummerdeceitslackerraised middle fingermusic bandsurprise after end creditsposterdrumsjoyvideo surveillancehangovertween girlidealismboy with glassesdrumschoolboysororitymtvelectric guitarcellomale protagonistprivate schooldeskrock musiciangroupiecommitmentmusic historydiarrheakeyboardrock singermusical instrumentrock groupreference to led zeppelinlazinesspreparatory schoolclarinetweightfield tripsubstitute teacherroadiebass guitarknee socksband managerbattle of the bandsanti authoritysong lyricsrock clubmusic competitioncrowd surfingmusic clubbreaking the rulesbroken rulecymbalmosh pitreference to liza minnellirock guitarfaculty loungereference to stevie nicksreference to aretha franklinreference to puff daddyschool recesscode of conductfreeloading (See All) |
After a bleak childhood, Jane Eyre goes out into the world to become a governess. As she lives happily in her new position at Thornfield Hall, she meets the dark, cold, and abrupt master of the house, Mr. Rochester. Jane and her employer grow close in friendship and she soon finds herself falling in β¦ love with him. Happiness seems to have found Jane at last, but could Mr. Rochester's terrible secret be about to destroy it forever? (Read More)
Subgenre: | coming of ageperiod drama |
Themes: | religionfriendshipsuicidedeceptionmemoryparanoiainsanityillnessmental illnessabusecrueltyblindnessinheritancemadness |
Mood: | rain |
Locations: | schoolchurchsnowenglandstorm |
Characters: | little girlteacherfemale protagonistchildrenfriendbrother sister relationshipteenage girlgirlolder man younger woman relationshipfrenchemployer employee relationshipaunt niece relationship |
Period: | 19th century1840s |
Story: | girls' schoolschool uniformbelief in goddresshuggingbedroomprayerclassroomcryingsingingtitle spoken by charactercharacter name in titlef ratedbased on novelblood β¦flashbackdogtwo word titlegunkissdancingfirehorsesecretletterpaintingbookpianoorphancandledeath of friendbridgechild abusedrawingcigar smokingmarriage proposalgunshotflash forwardreadingcountrysidefireplacedesirewoundgothicheavy rainhatservantforbidden lovehaunted by the pastthunderministerfirst kisshit on the headboarding schoolwedding dresssnowinghousekeeperfieldhorse and carriagechildhood memoryhorseback ridingdormitorysexual awakeningauntwedding ceremonyestatecorporal punishmentabandonmentstrokelocked doorbroken heartguardiancountry housestar crossed loverscaretakerlocked in a roomhouse fireveilcanceled weddingsaying graceglobenightgown19 year oldcapgovernesscountry estatedollhouserite of passageorphan girlbelief in heavenfalling off horsebelief in hellribbonfree willbadmintonenglish countrysidebonnettyphuswedding veilgirls' boarding schoolmoor the landscapedying in someone's armswardyearningkeeping a secretone room schoolhouseservitudebridal veilhair ribbonhit with a booknursing someone back to healthhit on the head with a book (See All) |
Zahra's shoes are gone; her older brother Ali lost them. They are poor, there are no shoes for Zahra until they come up with an idea: they will share one pair of shoes, Ali's. School awaits. Will the plan succeed?
Themes: | religionfriendshiplovepovertyillness |
Mood: | rain |
Locations: | bicycleschoolwaterurban settinglakestormbicycle accident |
Characters: | little boylittle girlchildrenfriendmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboybrother sister relationshipgirlstudentphotographer β¦babyteacher student relationship (See All) |
Story: | hijabblackboardprincipalsneakerschild's point of viewsoccercompetitionclassroomcryingdogwatching tvcamerasecretlietears β¦runninglow budget filmneighborrivervideo camerabridgeunderwater scenesearchliarlightningbrotherclassracingtrusttearaceslow motionhonorstreet lifeiranpromiseshoesintriguelostblind mantrophylandlordceremonygardeninglaundrysubtitlesbicyclinggardenerprizegoldfishshoeiranianbakerymosqueschoolteacherjumpingsaltvictorypotatocommitmentpencilwinnersugartehran iranbubblesocksschoolyardperseverancesibling relationshipbullhornneorealismgarbage collectorrugolder brotherfoot racegrocerblisterlistening to the radioshoemakerlatenesscouponfingernailrelay racebrake failurelong distance runnerballpoint penlate for schoollost shoeslippersoaking feetgutterpair of shoestime watchkoi pondholiday campcobbler the shoemakerschool recessdistance runninglong distance race (See All) |
In 1970s Iran, Marjane 'Marji' Statrapi watches events through her young eyes and her idealistic family of a long dream being fulfilled of the hated Shah's defeat in the Iranian Revolution of 1979. However as Marji grows up, she witnesses first hand how the new Iran, now ruled by Islamic fundamental β¦ists, has become a repressive tyranny on its own. With Marji dangerously refusing to remain silent at this injustice, her parents send her abroad to Vienna to study for a better life. However, this change proves an equally difficult trial with the young woman finding herself in a different culture loaded with abrasive characters and profound disappointments that deeply trouble her. Even when she returns home, Marji finds that both she and homeland have changed too much and the young woman and her loving family must decide where she truly belongs. (Read More)
Subgenre: | coming of agemartial artsautobiographicaladult animationbased on autobiography |
Themes: | religious intoleranceweddingreligionfriendshipmurderdeathlovesurrealismmarriageinfidelitychristmaspoliticsprisondrinkingfear β¦torturefuneralmemorytravelangerdivorcetheftdepressionblackmaildrug useguiltunfaithfulnessexecutionchildhoodhomelessnessfreedomjusticephilosophyforgivenessrevolutionfirst loveclaustrophobiamurder of sister (See All) |
Mood: | rainhigh schoolnightmare |
Locations: | bicycleschoolhospitalrestaurantsnowmotorcyclecemeteryparis francebathtubnightclubtaxiairportwheelchaircityfrance β¦rooftopschool teacher (See All) |
Characters: | muslimteacherfemale protagonistchildrenfriendmother daughter relationshipfamily relationshipshomosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctor β¦boyteenage girlprostituteteenage boygirlsoldierstudentpolicemandancerthiefreference to godcousin cousin relationshipuncle nephew relationshipgrandmother granddaughter relationshipuncle niece relationshipgrandfather granddaughter relationshipbakerart studentcheating on one's girlfriendphilosophy teacher (See All) |
Period: | 1980s1990s1970syear 1986year 1982year 1992year 1978 |
Story: | burqahead scarfloudspeakersneakerswomen's rightssexismislamhuggingelectionfalse accusationcookingprayerclassroomcryingtelephone call β¦one word titlef ratedbloodflashbackdogkissfightcigarette smokingdancingexplosionpartychaseshowervoice over narrationtitle directed by femaledreamcorpsefoodwatching tvcatdrinkbattlearrestfalling from heightshootingbookvomitinglieriflebeertearsrunningbeddead bodycafemarijuananeighborjailhallucinationsurvivalnewspaperflashlightbrawinebased on comic bookold manmountaineatingarmysuicide attempttoiletfishmodelnunbirdold womandrowningpainflash forwardgravekarateprotestkeyliarpay phonestorytellingsuitcasereadingtankhanginguniversitypursuitcrossfilm within a filmbasementpremarital sexflowerclassobscene finger gesturewhippingrefugeeciatherapyheart attacktwenty somethingsurgerymissiletraitorsupermarketgrenadewoundfaintinglawsurvivorjail celldemonstrationcommunistdrug abusehidingwatching a movietherapistpsychologistvirginityburialiraqmoralitycannongas maskiranpassportmovie theatrecensorshipheavy metalgrocery storebombingpillssufferingbraveryhypocrisyhippiebroken glassfalling to deathbutcherdespairsculptureoilswampexilebutterflyswedendeath of sistermusical numberyoung lovedemocracypunk rockpolice raidwar veteransirenreckless drivingpajamasturkey the countrypipe smokingplaying cardsmoscow russiaintimidationrevolutionarybriberyearphonestriple f ratedpubertybeggarrepressionselfishnesstombstoneblack marketidealismplaywrightconventtape recordingaustriacredit cardvienna austriabased on graphic novelnihilismblizzardrazoranarchistpolitical prisonervolkswagenhonestymartyrtitle same as bookpsychotherapyair raidchoicenationalismfiring squadnewlywedussrreference to michael jacksoncoughing bloodprophetsecret policecheckpointshopping cartdiabetesveilfleeingswansolidaritydignitysubcultureexpatriatesurgical operationcowardicebedtime storycustomsbirthmarktehran iranpenis joketrolleyart historycuriositypolitical repressionsnowballpuppet showhashishnailtyrannyart classhomeless womanideologyreference to karl marxazerbaijanartillerymarxismmohawk haircutreference to leninprotest marchunfaithful boyfriendloud musicreference to saddam husseiniraq iran warseparation from familyadaptation directed by original authorreference to che guevarapolitical rallyfarewellfalse passportcyanideexecution by hangingprescription drugsmarxisttalking to godair guitardrowning in a bathtubgroceriron maidenyodelingreference to godzillarubblewindow washeriranian revolutionwine makingdog humping someone's legbroochislamic revolutionwar ruinsnunneryproletariatleningrad russiashahpolitical exilereference to abbaliberatorstudy abroadlife drawingreference to the bee geesshah of irangovernment repressionopen heart surgeryataturkbronchitiscoronaryjasmineyodeliranian historymultiple amputeereference to botticellisifting through garbageiranian soldierlong distance telephone callreference to iron maidenreference to romy schneideramputated arm and legbeauty spotnailed to a wallorly airport paristoppling a statue (See All) |
Ishaan Awasthi is an eight-year-old child whose world is filled with wonders that no one else seems to appreciate; colours, fish, dogs and kites are just not important in the world of adults, who are much more interested in things like homework, marks and neatness. And Ishaan just cannot seem to get β¦ anything right in class. When he gets into far more trouble than his parents can handle, he is packed off to a boarding school to 'be disciplined'. Things are no different at his new school, and Ishaan has to contend with the added trauma of separation from his family. One day a new art teacher bursts onto the scene, Ram Shankar Nikumbh, who infects the students with joy and optimism. He breaks all the rules of 'how things are done' by asking them to think, dream and imagine, and all the children respond with enthusiasm, all except Ishaan. Nikumbh soon realizes that Ishaan is very unhappy, and he sets out to discover why. With time, patience and care, he ultimately helps Ishaan find himself. (Read More)
Subgenre: | fish out of waterclaymationdocumentary footage |
Themes: | friendshipjealousydrinkingfeartortureangerlonelinessdepressionpoetrybullyinghopechildhoodprejudiceautism |
Mood: | nightmare |
Locations: | school busbicyclebusschooltrainhelicoptertaxirooftopindiatrain stationnew school |
Characters: | little boyteacherchildrenfriendfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipsingerbrother brother relationshipstudentdancermusicianbabybully β¦teacher student relationshipfatherparent child relationshiplow self esteemself confidencecrying boyart teacher (See All) |
Story: | school principalschool uniformplaying a video gameblackboardchild protagonistchild's point of viewbackpackdirectorial debutfireworkscookingcompetitionclassroomcryingtelephone callsinging β¦photographdogkissfightdancingshowersongdreamfoodmirrorface slappaintinglietearsrunningfightingtelephonesubjective cameranewspaperbasketballmontageeatinginternetfishchild abuseapologychildbirdpainterdrawingprologueliarcharacter's point of view camera shotscene during end creditsdirected by starsadnessclassfreeze frameeyeglassesapplauseshavinglooking at oneself in a mirrorlawlifting someone into the airhappinesstoycrying womanhome movietennisfestivalfollowing someonecompassionstreet lifesocial commentaryimaginationsufferinganimated sequencedespairaquariumhit on the headlaughtercartoonboarding schoolbrushing teethalarm clockpigeonpostershamejoybeing followedunderdogdormitoryearphonespresentshynessgardeningapparitionsuccessflutereading aloudcrutchesstairwayname callingstreet marketintolerancecomic reliefsolitudeprizeknocking on a doorgoldfishmisfitteasingconservativedisciplineunhappinesswhistlingcreativitycricket the gamehead injurybunk bedcripplekitereference to albert einsteintutorbare feetilliteracyreading a bookpondfailurereference to googlemumbai indiareading a newspaperestrangementwaking upanguishironingsnailhopelessnessheadmastergurupencildressingfirecrackeroptimismstory tellingdomineering fatherhomeworkoverhead shotexpressionismmentor protege relationshipstrawberrytennis courtkneelingcuriositydoorbellreference to pablo picassorubik's cubelongingapplying makeupart classbasketball courtchild's drawingmodel airplanereference to mickey mouseanimated title sequencedouble decker busclown costumejigsaw puzzlemarchingcalling someone an idiothomesicknessreference to walt disneyintrovertleg bracedining hallimpressionismimitationmotivationalboys' schooldyslexiahummingwashing handswanderingseparation from familystickskipping schoolneurologyreference to leonardo da vincieight year old9 year oldcheeringneglected childclaysketchbookburpingcartoon rabbitagainst the oddsreference to vincent van goghreference to oscar wildevisual metaphorwaving goodbyefishing net8 year oldbowingpuddlelearning disability360 degree well shotyawningalphabetfacial bruisegrammarstop motion sceneprincipal's officedrainflowerpotrestlessnessschool yearbookmental abusespecial educationreference to agatha christieflip bookgoogling for informationmaking facesautistic childcrossed eyesexpressionistfalling to the groundreference to the nobel prizeschool bellautisticmoral courageautistic sonreport cardchildhood innocencefish bowlrunning up stairspedagogywalking backwardscombing someone's hairmutismoverachieverplaying hookydiwalifake mustachescaffoldingsplashing watercartoon frogfree thinkingtying shoelacesfinger paintingflute playerpainting comes to lifepicking one's nosepraying handscartoon turtlefaculty loungeneurological disorderoral examreference to the pied piperamphitheatrecartoon elephantcartoon fishlifting a boy into the airplaying fetch with a dogcanvas paintingcombing one's hairhyperactive childreading a poem aloudreference to neil diamondautistic boyfinding own voicereference to new zealandreference to verditoilet stoolcartoon swanhousemasterreference to thomas alva edison (See All) |
Vincent is an old Vietnam vet whose stubbornly hedonistic ways have left him without money or a future. Things change when his new next-door neighbor's son, Oliver, needs a babysitter and Vince is willing enough for a fee. From that self-serving act, an unexpected friendship forms as Vincent and Oli β¦ver find so much of each other's needs through each other. As Vincent mentors Oliver in street survival and other worldly ways, Oliver begins to see more in the old man than just his foibles. When life takes a turn for the worse for Vincent, both them find the best in each other than no one around them suspects. (Read More)
Subgenre: | coming of age |
Themes: | moneyreligionfriendshippregnancydrinkingdrunkennessvoyeurismdivorcetheftdrug usegamblingbullyingadoptiondeath of wifedying |
Locations: | school busbicyclebusschoolhospitalnew york citybartaxicourtroomstrip clubcatholic schoolnew school |
Characters: | teacherfriendhusband wife relationshipfather son relationshipmother son relationshipboyprostitutenursedancerlawyerjewishreference to godsingle mothercatholicrussian β¦russian americanex u.s. soldier (See All) |
Period: | year 1965 |
Story: | bicycle helmetschool principallistening to musicprayerclassroomcryingtelephone calltitle spoken by characterphotographcharacter name in titlesexbloodtwo word titlefightcigarette smoking β¦dancingpantiesbeatingfoodurinationblondeface slapwatching tvcatdrinksex in bedbooktearssunglassesrunningneighborvoyeurstrippertelephonef wordcleavagenewspaperold manmontageeatingapologyscantily clad femalebinocularslocker roommini skirtpay phonesuitcasebankconvertiblechildbirthsadnessclasssleepingnewspaper headlinegirl in pantieseyeglassesanswering machinereference to adolf hitlerbabysitterscene during opening creditsbrooklyn new york citycoitusskateboardstreet lifebreakfastretirementremote controlbloody nosepillscynicismcigarette lightercellphoneraised middle fingercanered pantiesabbreviation in titlecopulationparking lotnew job12 year oldgamblerlaundryhit in the facebreast feedingpink pantiesreading aloudmini dressfencename callinghorse racinglooking out a windowjukeboxdrunk drivingvacuum cleanerlaundromatdrug dealknocking on a doorloanfacebookstethoscopestrokeunhappinessmailboxchild custodyreading a booknursing homeemergency roomnewborn babybroken noseprivate schoolsushidivorced parentshorse racemailmansaintgambling debtrace trackwalkmanvietnam war veteranhomeworkoverhead shotbaptistlawn mowernecktiewater hoserearview mirrordoorbellman boy relationshipblue collarhand kissingnext door neighborhospital gownjoke tellinghead bandagegym classmisanthropepenis slurbank tellernew york city skylinesit upshand woundabandoned by fatherreference to the vietnam warmementobourbonretireesex with a pregnant womangarbage baghealth insurancerussian immigrantyear 1946reference to lyndon johnsonbank clerkdodgeballagnosticcrossing oneselfcat scanmarbleslawn chairreference to las vegas nevadatoy dinosaurgrumpy old manreference to jane fondairish immigrantphysical rehabilitationwatering a plantgymnasiumhard of hearingphysiotherapyspeech therapyhedonistreference to abbott and costelloreference to mother theresasainthoodbronze starcustody hearingcutting one's handold man young boy relationshipchin upsbaby cribschool report (See All) |
Three students and a school teacher disappear on an excursion to Hanging Rock, in Victoria, on Valentine's Day, 1900. Widely (and incorrectly) regarded as being based on a true story, the movie follows those that disappeared, and those that stayed behind, but it delights in the asking of questions, β¦not the answering of them. (Read More)
Subgenre: | coming of ageindependent film |
Themes: | friendshipdeathsuicidedrinkinginvestigationnatureobsessionsexualityillnesspoetry |
Mood: | nightmarenightmythaustralian supernatural |
Locations: | schoolchurchrural settingaustralialaketownaustralian outbackschool party |
Characters: | driverteacherfriendhusband wife relationshippolicedoctortattoosingerbrother sister relationshipteenage girlteenage boygirlstudentpolicemanphotographer β¦teacher student relationshipmaidfrenchuncle nephew relationshipaunt nephew relationshipsuicide by jumpingfrench teacher (See All) |
Period: | 19th century1900s |
Story: | girls' schoolschool uniformmemorizationfriendship between girlsstonedressrockprayerclassroomcryingsingingphotographf ratedsexbased on novel β¦bloodinterviewflashbackdogbare chested malekisscigarette smokingpartyvoice over narrationsongdreamfoodhorsemirrorblondeface slapslow motion scenecameradrinkbookriflebeertearsdead bodypianohallucinationalcoholorphanwinemansionwomanfour word titlesnakedinnerbrunettechildbirdsearchjourneyracial slurlegendvirginscreaminguniformumbrellastatuemissing personreadingscreamflowersfarmerhangingscarpianistdisappearancedeath of husbandschoolgirltied upflowersleepingclass differenceseyeglassespoemwhat happened to epiloguecaketouristhatsouth australiaservantorphanagevirginitycolonelpicnicclockgirl with glassesinnocencecorsettaking a picturefalling to deathinsectlostboarding schoolhomoeroticismlanternopening a doorhorse and carriagetripsymbolismholding handshorseback ridinghysteriaillusionexpeditionapparitiongatebandageglovesmetaphorreading aloudestatepicturelizardvillaredheaded womanknocking on a doorlavagreenhousepocket watchstretcherantbare feetpipeguardianshockfamous scorevalentine's dayprivate schoolsexual repressionstressheatwaking uplesbian subtextmagnifying glassmasculinitywhite dressguidealtarrock climbingfinding a dead bodystreamtop hatswancarriagescrapbookno endingaboriginepapernightgownresignationspinstermetaphysicsturkey the birdblack stockingsfrench accentgovernessturn of the centurycreekbased on supposedly true storygeologygrandfather clockneurosisambiguitydining hallreference to jack the ripperfat girlgarden partyheadmistresssightseeingfield tripbritish flagsearch partytennis racketkoalause of bloody as epithetexpulsiononeiricconstableunsolved mysteryvalentineboarderstarfishopening a windowstraw hatparasolgeometrygreeting cardhair brushstopped timevictoriabloodhoundqueen victoriagirls' boarding schoollacephysical examinationsonnetforebodinglying on a bedbloomersexercise classsearch dogyear 1900lawn partyadorationhair ribbonmathematics teacherpan fluteviewfindervalentine's cardreference to botticellishakespearean sonnethistorical societyaustralian flagbroken watchsexual hysteria (See All) |
Tracy Turnblad, a teenager with all the right moves, is obsessed with the Corny Collins Show. Every day after school, she and her best friend Penny run home to watch the show and drool over the hot Link Larkin, much to Tracy's mother Edna's dismay. After one of the stars of the show leaves, Corny Co β¦llins holds auditions to see who will be the next person on the Corny Collins show. With all of the help of her friend Seaweed, Tracy makes it on the show, angering the evil dance queen Amber Von Tussle and her mother Velma. Tracy then decides that it's not fair that the black kids can only dance on the Corny Collins Show once a month, and with the help of Seaweed, Link, Penny, Motormouth Maybelle, her father and Edna, she's going to integrate the show.....without denting her 'do! (Read More)
Themes: | friendshipdrinkingdanceracismdysfunctional familycheating |
Mood: | behind the sceneshigh school |
Locations: | school busbusschoolbarpolice car |
Characters: | religious fundamentalistbest friendteacherfemale protagonistfriendmother daughter relationshiphusband wife relationshippolicemother son relationshipfather daughter relationshipafrican americansingerbrother sister relationshipteenage girlteenage boy β¦police officernursestudentpolicemandancer (See All) |
Period: | 1960syear 1962 |
Story: | blackboardfireworksfalse accusationclassroomcryingtelephone callsingingtitle spoken by characterphotographone word titlef ratedkisscigarette smokingdancingparty β¦songfoodremakewatching tvdrinktearsrunningtelevisionnewspaperflashlighteatingno opening creditsnews reportmicrophoneprotestauditionscene during end creditsrattied upclassnewspaper headlineblack americanrecord playerapplauseropetv newsrace relationsfaintingdemonstrationcommunistagentflatulencetv showfemale tied upgas maskcivil rightsinterracial romanceswitchbladenostalgiaobesitybackstagelove at first sightdressing roomalarm clockmusic bandunderdoghaircrownbeauty pageantbillboardteenage daughtertv studiobeauty salonteenage crushgarbage truckracial tensionironingbaltimore marylanddetentionmarchfat womanrecord storeprotestortitle appears in songmusic storedance contestphonograph recordracial segregationtv cameraclothes linefat suitsocial changemarchingtiarabomb shelterbased on stage musicaldoughnutfat girlinstructorpageanttheatrical agentcandy barprotest signwashing clothesblonde stereotypeflasherreference to j. edgar hooverboys' bathroommemorabiliaoverprotective parentwoman played by mandress shopreference to doris dayhiding in a car trunkplacardtv show hostgirls' bathroomhair sprayshoeshinenewspaper boyironing boardtv cameramancivil rights eratony award sourcechemistry classracial integrationreference to jackie kennedyfitting roomturkey bastergirl tied upfadlaundressblack white friendshipgorilla maskreference to gina lollobrigidawhoopee cushionphysical education classnovelty shopp.e. classshoeshine man (See All) |
As children, Ruth, Kathy and Tommy spend their childhood at a seemingly idyllic English boarding school. As they grow into young adults, they find that they have to come to terms with the strength of the love they feel for each other, while preparing themselves for the haunting reality that awaits t β¦hem. (Read More)
Subgenre: | dystopiaalternate history |
Themes: | friendshipdeathjealousyartrivalrychildhood |
Locations: | schoolhospitalbeachrestaurantcarboatwoodsfarmengland |
Characters: | teacherchildrenboyfriend girlfriend relationshipdoctorboyteenage girlteenage boygirlnurseartistlove trianglewaitressteacher student relationship |
Period: | 1980s1990s1970syear 1994year 1985year 1978 |
Story: | school uniformaudio cassettecrushtape recorderhuggingbraceletsoccerclassroomcryingsingingf ratedbased on novelflashbacksex scenekiss β¦based on bookwatching tvsecretpaintingdeath of friendhuman rightsdrivinguniformsurgerybarnmagazineart galleryfirst kissseasidesoulboarding schoolalternate realitypierfieldbruiseclonechildhood memorytracking devicedormitoryporn magazineimperative in titlefencetrue lovetween girl18 year oldcottageteasingamputationcricket the gamedeath of boyfriendguardianromantic rivalrycloningtitle appears in songcassette tapeart classdonationbraided hairpupilmenuorgan donationorgan harvestingheart brokennon personorgan donorsalebelief in the soulschool assemblyoriginsobjectification28 year oldindividual rightsartificial humanhuman cloningtokentoy horsecarerhuman clonenon humanhugging pillowlegal rights of artificial life formelectronic bracelethuman beingboundarydying during surgery (See All) |
The movie is about a boy with a unique aging disorder: one that makes him age 4 times faster than normal. It picks up when Jack (Robin Williams) is 10 years old, but looks 40. He tries to go to public school for the first time, and to become friends with kids his own age. His physical appearance cau β¦ses him lots of problems, however. (Read More)
Subgenre: | fish out of water |
Themes: | friendshipdysfunctional family |
Locations: | bicycleschoolhospitalbar |
Characters: | little boylittle girlteacherfamily relationshipsfather son relationshipmother son relationshipboygirlteacher student relationshipnew student |
Story: | 10 year oldchild's point of viewplaygroundcrushbedroomclassroomtitle spoken by charactercharacter name in titleone word titlejailhalloweencaliforniabasketballnunpantyhose β¦treeactor shares first name with characterhalloween costumespeechchildbirthheart attackfemale stockinged legsdiseaseflatulencebutterflyfriendship between boyshalloween partygraduationforename as titletrick or treatingfreaktutoressayhandicaptreehousehigh school graduationwoman in laborcardboard boxfirst day of schoolfirst crushmaturitypaperboypenthouse magazineblowing bubblesteacher crushwater balloonrapid agingpremature birthclass photographaging disorderpremature agingfifth graderadult actor playing minorgummi bearprogeriacollapsing chair (See All) |
High school student Ferris Bueller wants a day off from school and he's developed an incredibly sophisticated plan to pull it off. He talks his friend Cameron into taking his father's prized Ferrari and with his girlfriend Sloane head into Chicago for the day. While they are taking in what the city β¦has to offer school principal Ed Rooney is convinced that Ferris is, not for the first time, playing hooky for the day and is hell bent to catch him out. Ferris has anticipated that, much to Rooney's chagrin. (Read More)
Subgenre: | coming of agecult filmteen movieteen comedy |
Themes: | friendshiphome invasion |
Mood: | high schoolbreaking the fourth wallaffection |
Locations: | school busschoolrestaurantswimming poolcarpolice stationofficechicago illinoismuseumsinging in shower |
Characters: | best friendfriendpoliceteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boypolice officerstudentteacher student relationshipsecretary |
Period: | 1980s |
Story: | school principalprincipalbedroomclassroomtelephone callcharacter name in titledogkissdancingshowerslow motion scenecomputerpaintingbedapostrophe in title β¦bathroomtelephonedrug dealerhouseanti herolooking at the cameratalking to the camerakicked in the facescene during end creditsconvertiblehigh school studentgarageanswering machineteen angststreetimpersonationrebelrebellionparking garageart galleryblack humorparadehomecameoscene after end creditssibling rivalryone dayclassmatelaughingsports carneighborhoodsurprise after end creditsirreverencemudjoyhigh school teachercar drivingschemewalletadvicecameo appearancecoughinggeneration gappopularitymarching bandhallwaybackyardhigh school girldeskferraridog attackspringsmilingswimming in underwearhigh school seniorreference to john lennonhigh school principalhypochondriacteenage angstthe beatles songdowntownclarinetsynthesizerhigh school boyskipping schoolteenage rebelliondiving boardcomputer screentalking to the audiencecatatoniafake illnessanti authoritycar damagetruancyfaking illnessprincipal's officechicago cubsjersey the garmentjoyridemusical sequence in non musical workreference to dirty harryon screen narrationnarrated by title charactertruantpretending to be sickstudent principal relationshipwrigley fieldday offfoot popping kissfake nursegummi bearshermer illinoiscalling someone a heroexpensive carthriller dancevoice sampling (See All) |
Early summer. In a village in northern Turkey, Lale and her four sisters are walking home from school, playing innocently with some boys. The immorality of their play sets off a scandal that has unexpected consequences. The family home is progressively transformed into a prison; instruction in homem β¦aking replaces school and marriages start being arranged. The five sisters who share a common passion for freedom, find ways of getting around the constraints imposed on them. (Read More)
Subgenre: | coming of agecoming of age film |
Themes: | weddingmoneysuiciderapedrinkingfeardrunkennessescapefreedom |
Mood: | wedding night |
Locations: | busschoolhospitalbeachtruckrooftoptunnelsex in a cartrying to escape |
Characters: | teachermother son relationshipteenagerboyfriend girlfriend relationshipdoctorsingerteenage girlteenage boygirlstudentdancerhostagesister sister relationshipreference to godteacher student relationship β¦grandmother granddaughter relationshipuncle niece relationshipaunt niece relationshiptruck driversuicide by gunshot (See All) |
Period: | summer |
Story: | school uniformchild bridewomen's rightssexismdressscandalcookingcryingtelephone callsingingphotographone word titlef ratedblood β¦violencegunkissdancingchasepantiesvoice over narrationsongunderwearfoodcar accidentmirrorface slapslow motion scenewatching tvwritten by directordrinkbookrifleanimal in titlerunningtelephonesubjective cameraorphanbracandleambulanceeatingfootballapologymarriage proposalgunshotscreamingreadingdomestic violencepursuittragic eventgardensleepingobscene finger gesturetraditiontealooking at oneself in a mirrorfaintinghidinggossipvirginityburialhitchhikingappleticklingarranged marriagemedical examinationscissorsdeath of sisteratticnoteturkey the countryceremonyistanbul turkeyspittingoppressionmenstruationpedophiliarunning awayname callinglooking out a windowvacuum cleanershoutingclimbing through a windowanal rapegiving a toastsoupbare feetchewing gumsoccer matchsexual repressionturkishgame playingteen suicideforced marriageclimbing out a windowcaptivitymarriage of convenienceloveless marriagethreat to killflirtationbarricadelocked inrunaway childlemonadeblowing a kissnosy neighborwelderlearning to driverunning away from homebegins with narrationsneaking outdowryabusive parentfootball fantravel agencywading in waterhouse cleaningpretending to sleepbiscuithouseholdbreaking a glass windowlocking a doorpounding on a doorbarred windowescaping out a windowcombing someone's hairsuicide of sisterteaching someone how to drivecutting one's own hairdeath of granddaughtersplashing water on someonevaginal examwashing a windowforced weddingknocked to the groundvirginity testbarricading a doorwatching football on tvabusive unclehymenruined reputationcarried piggy backclimbing down a drain pipe (See All) |
Poppy Cross is happy-go-lucky. At 30, she lives in Camden: cheeky, playful, frank while funny, and talkative to strangers. She's a conscientious and exuberant primary-school teacher, flatmates with Zoe, her long-time friend; she's close to one sister, and not so close to another. In this slice of li β¦fe story, we watch her take driving lessons from Scott, a dour and tightly-wound instructor, take classes in flamenco dance from a fiery Spaniard, encounter a tramp in the night, and sort out a student's aggressive behavior with a social worker's help. Along the way, we wonder if her open attitude puts her at risk of misunderstanding or worse. What is the root of happiness? (Read More)
Themes: | friendshipjealousypregnancydrinkingdanceparanoiamental illnessbullyinghomelessness |
Locations: | kitchenbicyclebusschoolbarbeachcarlondon englandurban settinglakegas stationschool teacher |
Characters: | little boylittle girlteacherfemale protagonistchildrenfriendfamily relationshipshusband wife relationshipmother son relationshipboyfriend girlfriend relationshipsingerboydancersister sister relationshipbully β¦teacher student relationshiphomeless man (See All) |
Story: | school uniformplaygroundcookingclassroomtelephone callsingingbare chested malekissfightcigarette smokingdancingnippleschasepantiescell phone β¦songunderwearfoodslow motion scenedrinkundressingmaskbooklierunningmarijuanabrawomaneatinginternetchild abusedrivingbirddrawingpantyhoseparkargumentsuburbuniformflowerslong takesplit screendatechickenclasspubhappinesseccentricclubimprovisationstreet lifebootsspanishironymiami floridarowboatscissorsbookstorenintendothirty somethingbarbecuepiersocial workerowlabandoned buildingyellingteachingbag over headdockfirst dateplaystationfriendship between womenstreet marketshoutingclinicdenialbumravebackyardtrampolinelearningoptimismdance lessonsex on first dateglobedance classflamencofake breastsspaniarddriving lessoncar keyslessonpink braprimary schoolchildren's bookflatmatelearning to drivetouching breastsclappingpiggy back ridepalm readingthree sistersseat beltafrican anglo30 year oldchiropractordriving instructorpaper bagart projectoptimiststolen bicyclereference to pinocchioarts and craftspicture booktoucanback painshadow boxingcheerfulnessrowing boatcamden town londonosteopathreference to kate winsletnorth londontraffic signanglo african (See All) |
The story of the Buckman family and friends, attempting to bring up their children. They suffer/enjoy all the events that occur: estranged relatives, the "black sheep" of the family, the eccentrics, the skeletons in the closet, and the rebellious teenagers.
Subgenre: | black comedy |
Themes: | marriagepregnancymemorydysfunctional familygambling |
Mood: | affection |
Locations: | kitchenschoolcarbaseballoral sex in a car |
Characters: | little boylittle girlchildrenmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boysingle mother β¦grandfather grandson relationshipgrandmother grandson relationshippregnant wife (See All) |
Story: | school principalhuggingcookingbedroomcryingtelephone callsingingphotographone word titlemale nuditymasturbationsex scenekissparty β¦underwearhorsepunched in the facecameravomitinglievibratorbirthdaybedcollegehousedinnerbirthday partyold womanliarcowboychildbirthsadnessreference to william shakespearegrandmothersingle parentbirthday cakeeyeglassespornographyteen angstballooncowboy hatblockbusterbirthhomeembarrassmentgrandfatherpower outagesex talkliving roomplaybriefschildhood memoryhorseback ridingjoyteenage pregnancystrugglecar drivingschemeparenthoodyuppiebaseball gamebunk bedunplanned pregnancyresponsibilitybackyardhiding placebiracialwatching a videotalking while drivingschool playtreadmillexpectant mothernude photographsmilingmissouriexpectant fathermental disordercupcakest. louis missourihelium balloonpinatabiracial childmini vancowboy costumelittle leaguedropoutpaper bagmaternity wardnine year oldprincipal's officereference to franz kafkachild psychologistdental retainerusherkioskconsidering abortionchild rearingdiaphragmst. louis cardinalsphotographing sexbaby car seatballoon animalteenage marriagehelium inhalationblack sheep of familysocial adjustment (See All) |
Brian Lackey is determined to discover what happened during an amnesia blackout when he was eight years old, and then later woke with a bloody nose. He believes he was abducted by aliens, and N. McCormick, a fellow player on Brian's childhood baseball team, may be the key as to exactly what happened β¦ that night. As Brian searches for the truth and tries to track him down, Neil McCormick takes up hustling and moves to New York, in attempts to forget childhood memories that haunt him. Together, the two of them uncover the terrible truth of the scars they share. (Read More)
Subgenre: | coming of ageindependent film |
Themes: | moneyfriendshipkidnappingdrugsrapechristmasdrinkingdrunkennessinvestigationvoyeurismmemorycorruptiontheftobsessionparanoia β¦drug usedysfunctional familyguiltgriefhumiliationabuseunrequited lovecrueltychildhoodtraumaregretchildhood traumaalien abductionpsychological trauma (See All) |
Mood: | rainnightmare |
Locations: | bicyclebusnew york citybarsnowsmall townbathtubbaseballrooftopmotelgay barbus station |
Characters: | best friendlittle boylittle girlfriendfamily relationshipshomosexualfather son relationshipmother son relationshiptattooboybrother sister relationshipteenage girlprostituteteenage boy β¦girlalienstudentgay sexphotographergay kissbullysingle mothergay friendhomosexual rapehomosexual kissgay rape (See All) |
Period: | 1980s1990syear 1991year 1983year 1981year 1987 |
Story: | loudspeaker10 year oldaudio cassetteplaying a video gamechild's point of viewplaygroundcrushlistening to musictape recorderfireworksbedroomcryingtelephone callsingingphotograph β¦based on novelnuditybloodmale nudityviolenceflashbackmasturbationmale rear nuditydoggunkisscigarette smokingejaculationshowervoice over narrationbased on bookbeatingdreamunderwearfoodurinationface slapwatching tvdrinkcondomundressingletterbeertearsrunningbirthdaybedmarijuanaprostitutionsubjective camerahalloweengay slurflashlightnew yorkcocainehousesubwaynonlinear timelinechild abusechilddrawingbathsearchejaculation into someone's mouthlibrarymicrophonestrippingangelreadingchristmas treecollege studentfarmerhalloween costumeprankscargiftsadnessunderwaterobscene finger gesturegraffitiufosingle parentpizzacoacheyeglassespot smokingrevelationbreaking and enteringheavy rainfaintingsexual abuseice creamtoywatching a movienosebleedvideotapeteddy bearmovie theatremale prostitutehaunted by the pasttarget practicebloody nosesufferingunderage drinkingrejectiontaking a picturepost traumatic stress disorderhypnosislostchristmas eveabsent fatherpedophileperversionrainstormmustachesnowingdark pastbruisecellarhustlerchildhood memorypipe smokingphoto albumtracking devicepervertearphonespresentnew jobshynesspedophiliaspit in the facepostcardmen's bathroomtrick or treatingsnorting cocainechild molestationjournalcrutchesblackoutmotel roombitternesssexual perversiongay crushtween girlclimbing through a windowboy with glassesdegradationanal rapewhisperingmale rapehanging upside downlsdfallingcripplemuggingseizurestation wagonmale prostitutiondecadencesorrowoverhead camera shotchild molesterkansascruisingpolaroid cameratraumatic experiencewitch costumebaseball teammolestationfast food restaurantinner title cardchristmas caroldepravityletter writingrocking chairleaving homesoul matechild swearingdisabledboy girl relationshipcerealsweaterborderline personality disorderbody part in titlemistreatmentman boy relationshipsubconsciouscupcakerepressed memorytv show in filmhandballdevil costumeloss of innocencesexually transmitted diseasegomorrahyscaffolddrug snortingmoral corruptionvenereal diseasebed wettingshampooumpiregay hustlereight year oldlittle leagueswing setmother's boyfriendgay man straight woman relationshipmobilemen's toiletuses the word faggotgay kidcommunity collegeporch swinguses the word faghomemade haunted house attractionairplane ticketbaseball coachglbt issuesbreakfast cerealcamaropartner in crimeatariephebophilecrawlspacebroken eyeglassesdead cowbaseball cardconfronting the pasteyesightsilent nightmaking facesunwanted sexual advancesblue lightmale male relationshipmale wearing makeupsexual aberrationdrive in theatremale hustlergarglingcrabsrecovered memorysexual ambiguitytagginglittle league baseballmouthwashburied memorieschristmas carollingfalling glassuniversity of california berkeleyemotional shockman boy lovehand in pantsmodesto californiasandwich shopsexual corruptionsordidnesssubway ridebottomless pitgay man straight man relationshipreference to jan vermeerkarposi sarcomaloss of dignitysnack foodupside down imagevermeer paintingbeanbagcrab licenegligent motherpot pipeamc gremlinbrighton beach new yorkloft bed (See All) |
Preston, Idaho's most curious resident, Napoleon Dynamite, lives with his grandma and his 32-year-old brother (who cruises chat rooms for ladies) and works to help his best friend, Pedro, snatch the Student Body President title from mean teen Summer Wheatley.
Subgenre: | independent filmcult filmteen movie |
Themes: | weddingfriendshipdancetime travelbullyingphotography |
Mood: | satirehigh school |
Locations: | school busbicyclerestaurantsmall townmexicomotorcycle accidentbus stationschool dancebicycle accident |
Characters: | friendfamily relationshipsmother son relationshipboyfriend girlfriend relationshipsingerbrother brother relationshipboyteenage boygirldancerphotographerbullycousin cousin relationshipuncle nephew relationshipgrandmother grandson relationship |
Story: | water fountaintitle appears in writingelectionbraceletvanclassroomtelephone callsingingtitle spoken by characterphotographcharacter name in titledancingcell phonefoodhorse β¦face slapshot in the headshotgunwatching tvcomputercamerariflecafegangbasketballinternetanti herodrawingmicrophonelocker roompay phonedollfarmerconvertiblewigchickenclasscownerdkilling an animaleggcakeoverallsamerican footballmilkinterracial friendshippicnicinterracial romancehit in the crotchkickingrejectionfootball playerlionsalesmantigermustachenotebowlingsign languageshaved headsurprise after end creditsmexican americanvideo tapewedding ceremonycafeteriatime machinetaekwondoloserboy with glassesmedalself defensepeer pressureinterracial marriagemisfitanimal abuseinterracial kissbowling alleyfootsie under the tablewhite trashbased on short filmjockutahroller skateswatching a videofamous lineschool lifeonlinetrack and fieldmirror ballidahogeneration ysand dunepinatahensteakcyberspaceschool lockerbelchdune buggyvestwolverinename tagllamapopular girlhamkeychainmale to female footsie playingchicken farmnunchuckstallionreference to loch ness monsterspanish accentclass presidentinternet romancecorsageinternet chatroomhigh school electionlying about one's ageschool auditoriumtetherballblowing nosejuarez mexicochicken farmersleeper hit (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget β¦her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
Subgenre: | coming of agesupernatural |
Themes: | friendshipdeathartmagicangerdysfunctional familygriefchildhoodboy girl friendshipdeath of best friend |
Locations: | school busschoolchurchforestwoodsrural settingfarmpolice carmuseumschool teacherart museumschool bullynew girl in townschool friend |
Characters: | best friendlittle boylittle girlteacherfriendmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagerbrother sister relationshipteenage girlteenage boy β¦police officerstudentartistbullyteacher student relationshipchildhood friendlove letterbest friendsblonde girlnew friend (See All) |
Story: | blackboardbelief in godchild's point of viewcrushclassroomsingingphotographbased on noveldogdancingthree word titlebased on bookpunched in the facewatching tvpainting β¦tearsplace name in titlerunningbirthdaydeath of friendbridgedrawingkingkeyfantasy sequenceproduct placementstorytellingdollpianisttragic eventqueenbirthday cakeroperacelifting someone into the airloss of friendguitaristcgirealityimaginationpet dogdeerswingkingdomatheistdead girlbirthday presentfemale teacheroutsidertween girlcrownsquirrelgreenhousefantasy worldtrollanguishrunnerchurch servicegrievingcreeknext door neighbororganistsocial outcastlifting a female into the airgirl next doornonconformityschoolyardfalling from a treelittle sisteranimal trapreference to leonardo da vincineglected childsketchbookbelief in hellpoor familyfemale bullyclubhousereality vs fantasysinging happy birthdaymake believeschoolboy crushtwo friendsfoot racetree houseanimate treeteacher crushreference to theodore rooseveltoff screen deathswinging on a ropemusic classtree swingsobbing femaleimaginary worldfear of hellrope swingrunning racedog as a giftcatching someone who fallsreference to teddy rooseveltknocked to the groundlost keysmuseum tripreference to pieter bruegelwooden bridgelog bridge (See All) |
Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr β¦overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)
Subgenre: | coming of ageteen movieperiod film |
Themes: | friendshipsuicidedrugschristmasjealousydrinkingfeardanceincestmemoryseductionlonelinessdepressiondrug usecancer β¦guiltdatingmental illnesspoetryabusebullyingunrequited lovehomophobiabreak updyingwritingcheatingfirst lovedying from cancerdeath of best friendsuicide of friend (See All) |
Mood: | high school |
Locations: | hospitalrestaurantchurchsnowtrucktunnelcatholic churchpennsylvaniaschool dancekitchen knife |
Characters: | best friendlittle boyteacherfriendfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipdoctorsingerbrother brother relationship β¦boybrother sister relationshipteenage girlteenage boygirlpolicemandancerphotographerwriterpriestreference to godgay kissbullyteacher student relationshippsychiatristcatholicgay teenagergay relationshipaunt nephew relationshipcatholic priestboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All) |
Period: | 1990syear 1991 |
Story: | school principalred dressmix tapeaudio cassettesexismcrushlistening to musichuggingbedroomprayerclassroomcryingtelephone callsingingphotograph β¦based on novelflashbackkissfightdancingpartyknifevoice over narrationbeatingfoodcar accidentmirrorface slapslow motion scenepunched in the facewatching tvcamerawritten by directordrinkcondomsecretlettershootingbooktearsrunningbirthdaycafemarijuanabathroomcollegehallucinationreference to jesus christtelephonef wordsubjective cameragay slurwinecandledeath of friendeatingfootballsuicide attemptdinnerchild abusedrivingapologyracial slurpainflash forwardlibraryvirginreadingchristmas treecollege studentprankhigh school studentcheerleaderglassesrock 'n' rollsadnesssix word titleclassreference to william shakespearetypewritertrustteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualfireplacelooking at oneself in a mirrorsexual abuseice creamhappinessamerican footballmovie theaterimpersonationnew year's evevirginityclockpromisebuddhistmovie theatrenicknameinnocencepillssufferingmobile phonebackstagepunched in the stomachkaraoketaking a picturemental hospitalfootball playertheatre audiencefirst kisschristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingothgraduation12 year oldshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingteenage lovefirst dateadolescencechild molestationblackoutlooking out a windowharmonicaponytaillsd16 year old15 year oldstonedkiss on the lipsunhappinessgiving a toastveganhazingtutoreasterpromhouse partylip synchingcar radioteenage crushdance scene11 year oldwriting a letterabusive boyfriendwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausaspiring writerenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actreference to frank sinatracrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school dancehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glasseslast day of schoolenglish classfacial injuryprincipal's officeacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailwriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All) |
Tracy Flick is running unopposed for this year's high school student election. But school civics teacher Jim McAllister has a different plan. Partly to establish a more democratic election, and partly to satisfy some deep personal anger toward Tracy, Jim talks popular varsity football player Paul Me β¦tzler to run for president as well. Chaos ensues. (Read More)
Subgenre: | coming of agegay interestblack comedyteen moviepolitical satireteen romanceteen comedy |
Themes: | religionmarriageinfidelitybetrayaljealousypoliticsadulterylesbianismextramarital affairdivorcecorruptionunfaithfulnesscruelty |
Mood: | satirehigh school |
Locations: | bicycleschoolnew york citycatholic school |
Characters: | teacherfemale protagonistmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagerbrother sister relationshipteenage girlteenage boystudentlove triangleteacher student relationship β¦gay teenagerself destructivenessteacher student sexlesbian daughterself absorption (See All) |
Story: | girls' schoolelectionprayercryingtitle spoken by characterone word titlef ratedbased on novelflashbacksex scenekisspartylesbian kiss β¦showervoice over narrationurinationblondemanhattan new york cityconfessionlimousinefired from the jobkissing while having sexclass differencesteenage sexwashington d.c.freeze framedestinyteen angstathletejoggingoverallsbroken legapplemoralityjanitorcynicismhot tubswingposterfemale female kissgraduationteachingethicsteenage loveblonde womanmotel roombeeelection campaignpolitical campaignenvyteenage daughterteenage sexualitystatue of liberty new york cityjointjockpolitical candidatespitteenage crushsex with a minormarital infidelitynebraska16mmhigh school athletepepsibracesbannerpower plantcampaigningclicheridiculedumped by girlfriendphotocopiermultiple narratorsbee stinglesbian teensprinkler systemteen lovehistory teacherlawn mowingasparaguspinpower lineapple treepower stationlesbian sisternarcissistic personality disorderchemistry classgirl girl relationshipomaha nebraskaoverachieverskiing accidentwipemathematics teacherfaculty loungehigh school electionlincoln memorial washington d.c.student council presidentmuseum guideteenage issuesparochial schoolschool administratorhigh school vice principalwide angle lensstudent governmentvote tampering (See All) |
County Durham, during the endless, violent 1984 strike against the Thatcher closure of British coal mines. Widower Jackie Elliot and his firstborn, fellow miner Tony, take a dim view of 11 year-old second son Billy's poor record in boxing class, which worsens when they discover he sneakily transferr β¦ed to the neighboring, otherwise girls-only-attended ballet class. Only one schoolmate, closet-gay Michael Caffrey, encourages Billy's desire, aroused by the teacher, who judged him talented enough for private lesson, to train and try out for the world-renowned Royal Ballet audition. Only the prospect of a fancy career unimagined in the pauper quarter may twist pa and big brother's opposition to indispensable support. (Read More)
Subgenre: | coming of ageindependent filmmartial arts |
Themes: | moneyfriendshipdeathinfidelitychristmasadulteryfeardrunkennessdanceextramarital affairdeath of motherpovertyunfaithfulnesssexualityhomophobia β¦death of wifechildhood (See All) |
Mood: | affection |
Locations: | busschoolcemeterybathtublondon englandelevatordance school |
Characters: | best friendteacherfriendmother daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshippolicemother son relationshipfather daughter relationshipdoctorbrother brother relationshipbrother sister relationship β¦policemandancerbullyteacher student relationshipgrandmother grandson relationshipself discoverygay frienddance teacherself expression (See All) |
Period: | 1980s1990syear 1984 |
Story: | school uniformsexismchild's point of viewcrushlistening to musicdresshuggingclassroomcryingtelephone callphotographcharacter name in titlesexnudityblood β¦male nudityviolencekisscigarette smokingdancingchasebeatingunderwearurinationface slappunched in the facebare buttletterbooklietearsrunningbathroompianogay slurmontagetoiletboxingjudgebathgraveyardgravelibrarycoming outwidowerauditiongympianisttragic eventsadnessloss of motherballetclasscross dressingsacrificetrustrecord playerriottransvestiteshavingeggslow motionrecordingdemonstrationworking classcommunisthammerboxerloss of wifecompassionmilkembarrassmenttheatre audiencemakeuplipstickfriendship between boyssnowingdead motherferryjoypiano playerearphonesjewelryelectricitystage performanceteachingapparitiongay bashinginspirationfenceescalatorstrikelibrariantombstonegay crushmooningmailtransvestismpunching bagsurrogate motherminersoccer ballpostmanmusic boxlabor uniontalentcircular staircasesnowmanpillowkiss on the cheekchristmas lightscoalswantap dancingballet dancerpillow fightdance classboxing gloveschanging roomwashingcoal minenightstickjumping on a bedmerry christmastriumphmale dancerlaborercoal minersledge hammerpolice vanmotivationriot policestickmine shaftdance instructormining townnorthern englandreference to fred astaireboxing traineragainst the oddsgay kidapronfollowing a dreampawnbrokerdancing in the streetpicket linespinningtutuballet schoolballet teacherphysical examreference to ginger rogersbilly clubboy dressed as a girldressing upballet dancingsliding doorimpatiencejewelry boxstuffed toy animalgarglingbreakthroughstanding on a tableminers strikenewcastle upon tynescabswan lakeboxing lessonmobile libraryriot shieldboy wearing lipstickriot gearsoccer shirtboogieboy boy kissboy wearing a dressbreakfast trayletter of acceptancedestroying a pianofalling into a bathtubroyal ballet school (See All) |
When her father enlists to fight for the British in WWI, young Sara Crewe goes to New York to attend the same boarding school her late mother attended. She soon clashes with the severe headmistress, Miss Minchin, who attempts to stifle Sara's creativity and sense of self-worth. Sara's belief that "e β¦very girl's a princess" is tested to the limit, however, when word comes that her father was killed in action and his estate has been seized by the British government. (Read More)
Themes: | friendshipfearmagicracismlonelinesspovertyabusebullyingcrueltychildhoodamnesia |
Mood: | rain |
Locations: | schoolnew york citywheelchairshipindiaschool bully |
Characters: | best friendlittle girlteacherfemale protagonistfather daughter relationshipafrican americangirlsoldiersister sister relationshipteacher student relationshipfrenchsingle fatherfather daughter dance |
Period: | 1910s20th century |
Story: | girls' schoolschool uniformfriendship between girlschild protagonistchild's point of viewdressbedroomclassroomcryingbased on noveldancingthree word titlevoice over narrationunderwearrescue β¦birthdaybritishgood versus evilorphancandlenew yorkold manchild abusechild in perilbirthday partyprincesspainuniformstorytellingdollstatuereunionschoolgirlworld war oneflowerclass differencesmonkeybattlefieldhatesingle parentbirthday cakeballoonslow motionrace relationslifting someone into the airelephantmouseservantinterracial friendshiprealityindianpresumed deadgirl with glassesimaginationhatredrejectiondespairthunderstormroseatticboarding schoolrainstormhorse and carriagedead motherseparationloss of jobbirthday presentnarratorimaginary friendkindnessfriends who live togethercruise shiprainingbomberprivate schoolbowwindowclimbing out a windowlockettrenchletter writinglifting female in airnightgownresignationchild labormissing fatherfather daughter reunionbilingualbombardmentturbanlonginginkasian indianchimneyheadmistressbratorphan girldeitystarving childbad temperriches to ragsballadeerfantasy lifemilkmanrich poorstory within a storyarmy captainsinger offscreenhot temperjourney shown on mapblowing out a candlegirls' boarding schoolmotherless childshawlchild exploitationdenunciationlosing temperharpistrejectrejectedchimney sweephelping otherspair of shoesaggressiveservant girlcrueldenouncementwood plankman versus beastramayanablind man's bluff gamemilk manserioussocial rejectbad temperedliving in an attic (See All) |
Seventh-grade is no fun. Especially for Dawn Weiner when everyone at school calls you 'Dog-Face' or 'Wiener-Dog.' Not to mention if your older brother is 'King of the Nerds' and your younger sister is a cutesy ballerina who gets you in trouble but is your parents' favorite. And that's just the begin β¦ning--her life seems to be falling apart when she faces rejection from the older guy in her brother's band that she has a crush on, her parents want to tear down her 'Special People's Club' clubhouse, and her sister is abducted.... (Read More)
Subgenre: | coming of ageindependent filmcult filmblack comedydark comedyteen movie |
Themes: | friendshipkidnappingdysfunctional familyhumiliationabusebullyingcruelty |
Mood: | satiresocial satire |
Locations: | busschoolsinging on bus |
Characters: | little girlteacherfemale protagonistfamily relationshipsbrother sister relationshipteenage boygirlsister sister relationshipjewishbullyparent child relationshipwriter directorjewish girl |
Story: | principalchild's point of viewcrushclassroomtelephone callsingingwatching tvwritten by directorkissingpianogay slurtoiletsuburbattempted rapespeech β¦cheerleaderglassesballetnerdteen angstclubgirl with glassescynicismfirst kisssibling rivalrysexual harassmentlonerpublic humiliationphysical abuseirreverencesexual awakeningharassmentoutcastcafeterialockermental retardationboy with glassesballerinadown syndrometormentlunchjunior high schoolverbal abusemiddle schooldignitytauntingjewish familysocial outcastsibling relationshipfirst crushdeliberate crueltypsychological tormentlesbian slursardonicgarage bandschool assemblypariahnerdy girlsuspected lesbianfood trayseventh gradespitball (See All) |
Jenna is unhappily married, squirreling away money, and hoping to win a pie-baking contest so, with the prize money, she'll have enough cash to leave her husband Earl. She finds herself pregnant, which throws her plans awry. She bakes phenomenal pies at Joe's diner, listens to old Joe's wisdom, tole β¦rates her sour boss Cal, is friends with Dawn and Becky (her fellow waitresses), and finds a mutual attraction with the new doctor in town. As the pregnancy advances, life with Earl seems less tolerable, a way out less clear, and the affair with the doctor complicated by his marriage. What options does a waitress have? (Read More)
Themes: | weddingmoneyfriendshipmarriageinfidelitybetrayaladulterypregnancyextramarital affairunfaithfulnesscheating |
Locations: | kitchenbushospitalrestaurantsmall townwheelchair |
Characters: | female protagonistfriendmother daughter relationshiphusband wife relationshipmother son relationshipdoctorsingernursedancerbabysingle motherwaitressdoctor patient relationshipbaby girlnew baby |
Story: | saving moneyprize moneyhuggingcookingcryingtelephone callsingingone word titlef ratedsexkisscigarette smokingdancingsong β¦title directed by femalefoodmirrorface slappunched in the facesecretletterlietearscafetelephonenewspaperold manvideo cameramontageeatingdinerdinnerdrawingpantyhosepay phoneflowersdomestic violencechildbirthcontestfemale stockinged legswoman with glassesdysfunctional marriageministerlipstickwedding ringvoice over lettermarital problemlandlordabusive husbandwedding receptionsouthern accentunhappy marriagesouthernerpregnancy testbus stoppieunplanned pregnancyunwanted pregnancywriting a letterbegginggynecologistbakinghidden moneywaiting roomdoctor's officeman hits womanultrasoundwife abuseorange juicecribwoman in labordessertstar died before releasehoroscopecontrol freakdirected by co starsonogrambigger dreamscheesecakemorning sicknessgreeting cardobstetriciancar horndeath of cast memberpregnant woman's water breaksunhappily married womanbad poetrymeat piewaitress uniformtarthonking a hornfood pornsearching for happinesspumpkin piequicheleaving husbandchocolate pie (See All) |
Four members of a high school band called Mystery do everything they can to attend a KISS concert in Detroit. In order to make it to the show they must steal, cheat, strip, deal with an anti-rock mom and generally do whatever it takes to see the band that has inspired them to be musicians.
Subgenre: | coming of agecult filmteen movieperiod pieceteen comedy |
Themes: | moneyfriendshipdrugsdrinkingtheftdrug usehomophobia |
Mood: | high school |
Locations: | school busschoolbarrestaurantchurchcarelevatorstrip clubcatholic churchsex in car |
Characters: | teacherfriendmother daughter relationshipfamily relationshipshomosexualfather son relationshippolicemother son relationshipfather daughter relationshipteenagersingerbrother brother relationshipboyteenage girl β¦teenage boystudentpolicemanpriestthiefjewishcatholicolder woman younger man relationshipalcoholic drinkreligious mother (See All) |
Period: | 1970s |
Story: | red dressloudspeakerlistening to musicrockvanclassroomtelephone callsingingtitle spoken by charactersexfemale nudityblooddogkissfight β¦cigarette smokingejaculationchaseerectionfiresongbeatingunderwearcar accidenturinationslow motion scenedrinklierifleplace name in titlerock musiccafemarijuanabathroomhallucinationhandcuffsguitarsubjective cameragay slurwinebandconcertrock bandapologynunmicrophonestrippingvirginstripteaseliarpay phonecity name in titlecrosssplit screenrock 'n' rollclassobscene finger gesturerecord playerpizzanerddiscoloss of virginitycomic bookrecordingtitle based on songvandalismcrucifixflatulencevirginityheavy metalface paintrock concerthit in the crotchblack brafirst kisshot tubgeekreckless drivingposterdrumsstolen carreference to elvis presleyporn magazinebongmenstruationvomitcafeterialong hairdetroit michiganconfessionalfilm projectordomineering motherradio stationtape recordinglsdwetting pantsstonedreference to albert einsteinmushroomstation wagondisc jockeycar radiodetentiongynecologistfemale to male foot in crotchreference to richard nixoncleveland ohiopremature ejaculationattempted robberyboy bandguard dogpizza delivery boyswedishfemale sitting on a toiletfrisbeetamponmusic concertmusic groupcult music bandauto theftcrossing selfpainted facepinball machinebubble gumvolvogargoylepokiesgym classstage frightsparklerreference to andy warholchop shopbelchroadieprodigal sonlava lampreference to jimmy carteri.d.porno moviechain smoking8 trackreference to john travoltapolkaclassic rock musicgirls' bathroomkneed in the crotchfour best friendshustler magazinepimpleface paintingacnesmiley facereference to burt reynoldsbell bottomsreligious parentsreference to lassiereference to the village peoplereference to farrah fawcettbackstage passconcert ticketradio contestreference to richard pryortest tube babyreference to patty hearstday glokiss the bandorff carmina buranareference to bobby kennedyreference to general motorsreference to sonny and cherreference to the hulkreference to john belushireference to blue oyster cultreference to carly simonreference to henry winklerreference to lee majorsreference to steve martinreference to the bay city rollersreference to the carpentersst. bernard (See All) |
To Greg Heffley, middle school is the dumbest idea ever invented. It's a place rigged with hundreds of social landmines, not the least of which are morons, wedgies, swirlies, bullies, lunchtime banishment to the cafeteria floor - and a festering piece of cheese with nuclear cooties. To survive the n β¦ever-ending ordeal and attain the recognition and status he feels he so richly deserves, Greg devises an endless series of can't-miss schemes, all of which, of course, go awry. And he's getting it all down on paper, via a diary - "it's NOT a diary, it's a journal!" Greg insists, preferring the less-sissyfied designation - filled with his opinions, thoughts, tales of family trials and tribulations, and (would-be) schoolyard triumphs. "One day when I'm famous," writes Greg, "I'll have better things to do than answer people's stupid questions all day." So was born the Wimpy Kid's diary. (Read More)
Subgenre: | ghost story |
Themes: | friendshiprevengechristmasbetrayalfearwrestlinghumiliationbullying |
Mood: | rainbreaking the fourth wall |
Locations: | school busbicyclebusschoolnew york cityforestsnowwoodsschool bullyschool danceschool friend |
Characters: | best friendlittle boyteacherchildrenfriendfamily relationshipsfather son relationshipmother son relationshipsingerbrother brother relationshipboyteenage boygirldancermusician β¦photographerbullyasian americangrandfather grandson relationshipchildhood friend (See All) |
Story: | playing a video gamechild protagonistchild's point of viewvancompetitionclassroomtelephone callsingingphotographbased on novelflashbackbare chested malefightdancingvoice over narration β¦cell phonesongunderwearmirrorurinationwatching tvcomputercamerarunningpianomanhattan new york cityhalloweenflashlighttoiletrock bandno opening creditstalking to the camerafive word titlelibraryfantasy sequenceumbrellaauditiondiaryhalloween costumeprankpianistfilm within a filmfirst partclassgarageprivate detectivepickup truckcoachnerdwoman with glassesfaintingwalkie talkieamerican footballwatching a moviejanitorreconciliationspanishanimated sequenceatticfriendship between boystitle at the endclassmatebroken armalarm clockwilhelm screamowlwrestlert shirtnarrated by characterporn magazinecandyfire extinguishercafeteriascene before opening creditstrick or treatingjournaltween girlboy with glassespeer pressureschoolboylistening to a radiopopularitycheesealtered version of studio logooverweighttimes square manhattan new york citybadgesitting on a toiletsnowmanmolespray painttoilet paperjunior high schoolschool playjack o'lanternmiddle schoolpirate costumeboy girl relationshipdental bracescanteenanimated opening creditsstudio logo segues into filmguatemalakindergartenbroken handrottweilerbreakdancinggym classgym teacherbratbreaking the fourth wall by talking to the audienceschool lockerfirst day of schoolprecociousnessstuffed animal toyfat boygingerhand bandagereference to the wizard of ozboys' bathroomolder brotherschool cafeteriagarage bandtwister the gamegroup of teenagersfriends falling outwedgiebleachersschool yearbookarm in a castsleeping in a bathtubhaunted forestarm in a slingbobble head dollhole in the groundphysical educationcymbalsnotgirl on boys teamleaf blowerptaschool clubwimpthrowing water on someoneweed whackervenetian blindsvoice over diarymouth guardphotograph comes to lifeschool gymschool newspapersinging auditionteenage bandbroken friendshippotty trainingcleaning a bathroomestranged friendwrestling coachmiddle childschool electioncootiespink eyepottysecret languageunicorn costumewriting on an arm cast (See All) |
Teenager Hubert haughtily regards his mother with contempt, and only sees her tacky sweaters and kitsch decorations. In addition to these irritating surface details, there is also his parent's cherished mechanisms of manipulation and guilt. Confused by this love/hate relationship that obsesses him m β¦ore and more each day, Hubert drifts through the mysteries of adolescence - artistic discoveries, illicit experiences, the opening-up to friendship, and ostracism. The turbulent relationship between mother and son unfolds with a compelling combination of savage fury and melting affection. The stunning, semi-autobiographical directing debut of 20-year-old actor Xavier Dolan. (Read More)
Subgenre: | coming of agesemi autobiographical |
Themes: | weddingfriendshipmurderloveangerdivorceblackmaildrug usedysfunctional familyguiltpoetrychildhoodinheritancegay love |
Mood: | high school |
Locations: | bicyclebusschoolrestaurant |
Characters: | little boyteacherfriendfather son relationshipmother son relationshipteenage boystudentgay sexdancerreference to godgay kisssingle mothermotherhomosexuality β¦teacher student relationshipcatholicgay teenagergay relationshipparent child relationshipboyfriend boyfriend relationshipgay student (See All) |
Story: | school principalschool uniformbackpackcookingclassroomtelephone callmale nudityflashbackbare chested malecigarette smokingdancingknifechaseshower β¦cell phonebeatingunderwearfoodmirrorface slapslow motion scenewatching tvcomputerundressingletterpaintingliecafemarijuanareference to jesus christrivertelephonef wordgay slurvideo cameramontageeatingsubwayapologylibrarycoming outfantasy sequencepay phonewritten and directed by cast memberdollmanipulationpursuitobscene finger gesturehatesingle parentchessrunawayclaim in titlepot smokinglgbtteen angstlooking at oneself in a mirroroverallsrebellionhome moviereconciliationboxer shortskickingrejectiontime lapse photographygay sonboarding schoolmale male kissbriefsbrushing teethphoto albumvideo tapegay bashingvideo storeadolescencedvdvacuum cleaner17 year olddomineering mother16 year oldgay clubdivorced parentsoverbearing motherinner title cardbipolar disorderwashing dishesreference to bugs bunnyreference to james deanreference to buddhalove hate relationship7 year oldreference to leonardo dicaprioboys' bathroompublic schoolmother son conflictlove hatebegins with a quotemale homosexualityreference to jackson pollockmother slaps sonreference to jean cocteaucontemptreport cardreference to christmasimaginary worldsaint lawrence riverspeed the drugwriting contestthrowing a telephone (See All) |
Annie (Kristen Wiig), is a maid of honor whose life unravels as she leads her best friend, Lillian (Maya Rudolph), and a group of colorful bridesmaids (Rose Byrne, Melissa McCarthy, Wendi McLendon-Covey and Ellie Kemper) on a wild ride down the road to matrimony. Annie's life is a mess. But when she β¦ finds out her lifetime best friend is engaged, she simply must serve as Lillian's maid of honor. Though lovelorn and broke, Annie bluffs her way through the expensive and bizarre rituals. With one chance to get it perfect, she'll show Lillian and her bridesmaids just how far you'll go for someone you love. (Read More)
Subgenre: | black comedy |
Themes: | weddingmoneyfriendshiplovejealousydrinkingfeardrunkennessvoyeurismtravelangerlonelinesssexualityrivalrypanic β¦wealthforgiveness (See All) |
Locations: | busbarrestaurantcarairplaneparis franceairportpolice carcitychicago illinoiswedding partyold car |
Characters: | best friendfemale protagonistfriendmother daughter relationshiptattoopolice officerpolicemanmaidcousin cousin relationshipchildhood friendparent child relationshipself esteembakergirl fightout of control β¦self deprecationnew friend (See All) |
Story: | red dressstoredresshuggingscandalcookingbedroomcompetitioncryingtelephone callsingingtitle spoken by characterone word titlef ratedsex scene β¦kissfightpartylesbian kisspantiescell phonesongwoman on topfoodface slapwatching tvdrinkarrestsex in bedvomitingbedcar crashbathroomvoyeuralcoholtelephonecleavagewomaneatinginternetjokeapologyman with glassesno opening creditsscantily clad femaleroommateconfessionparkargumentblack pantiesmicrophonefired from the jobchampagnemissing personscene during end creditsprankspeechisolationlaptopsadnesscouplegirl in pantiesflirtingrevelationcakegroup of friendshappinessexercisewatching a moviecrying womanimpersonationtennisdriving a carhonorembarrassmentapartment buildinggirl with glasseswatching televisionrampagewhiskeypillscynicismmisunderstandingironyconvenience storeworkco workerlaughterdrunkfrustrationpridefallsurprisee mailhighwaysexual humorwedding dressinsultred pantiespassionate kisscasual sexpuppyjobmidlife crisissports carreckless drivingflightwritten by stararrogancemusic bandengagement ringshamejoypractical jokefemale female kisschocolatecar troublejewelryloss of jobfountaindefecationsarcasmfriendship between womenbitternessfemale friendshiplegsloud sexboy with glassesenvymessagepartial female nudityforeplaybakeryquarrelflight attendantcookiebankruptcywalkingawkwardnessporschewoman in lingerievanityfailuretow truckchick flickmistakebus ridefilm starts with sexlunchscatological humortalking about sexwhite dressclumsinesslack of moneygrudgetalking while drivingalcoholics anonymousbakingcommitmentbride and groomraccoondiarrheasingle womanrentmaterialismloss of controltennis courtjewelry storedirtglamourtrainermusic groupbridesmaidwoman in bracupcakefemale sexualityhostilityhorny womanfear of commitmentsweatingfood poisoningobese womanmissing womantennis racketmarshaloutbursttalking during sexfear of flyingmilwaukee wisconsinfurybad temperstepdaughterseat beltbachelorette partyscotchtemper tantrumplaying tennisairplane ticketwolf whistlebreast squeezingcomedic sex scenefriends falling outporcupinecappuccinotennis matchdangerous drivingexpensive giftreference to bill cosbytraffic copair marshalbig housemaking facesmaid of honorstepsonairplane passengerbridal showerhighway patrolmanmisfortunebluffingextravaganceloose womanshort dresspersonal crisisapple laptoptraffic stopbridal shoptrip to franceopening creditsfirst classhit with a balllast film role for actressreference to netflixloveless sexnew dressno moneybride dressradar gunsobriety testtrading insultsdog as giftmale flight attendantpills and alcoholpurple dressscreaming in rageannoying roommatelack of affectionpet as a giftshitting selfsingle friend (See All) |
A comedy about bending the rules to reach your goal, Bend It Like Beckham explores the world of women's football, from kick-abouts in the park to freekicks in the Final. Set in Hounslow, West London and Hamburg, the film follows two 18 year olds with their hearts set on a future in professional socc β¦er. Heart-stopping talent doesn't seem to be enough when your parents want you to hang up your football boots, find a nice boyfriend and learn to cook the perfect chapatti. (Read More)
Subgenre: | coming of ageteen movietv sports programsoccer movie |
Themes: | weddingreligionfriendshipmarriagejealousypregnancydrinkingdancedeceptiontravelracismparanoia |
Mood: | archive footage |
Locations: | trainhotelcarairplanenightclublondon englandairportenglandgermany |
Characters: | friendmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenage girlteenage boystudentdancersister sister relationshiplove trianglegay friend β¦mother in law daughter in law relationship (See All) |
Story: | tomboywomen's rightsdresscookingsoccerbedroomprayercryingtelephone calltitle spoken by charactercharacter name in titlef ratedkissfight β¦dancingpartypantiesfirecell phonetitle directed by femaleunderwearfoodwatching tvcameradrinklietearsrunninglingeriebedsubjective cameracleavagebravideo cameramontagehouseimmigrantsubwayritualracial slurstrippinglocker roomfantasy sequencescene during end creditsuniversityscarsadnessstrong female charactertwenty somethingcoachcloseted homosexualtraditiondiscoinjurytempleculture clashstrong female leadinterracial friendshipcelebrationshoesteamhit in the crotchkickingnewsreel footageshoppingdiscriminationliving roomlaughingethnic slurbenchwedding receptionposterrefereet shirtjoyunderdogceremonybloopers during creditsimperative in titleshortssports teamescalatorhindudance clubgeneration gapteenage daughtercricket the gamescholarshipshirtfashion modeltv studiomarriage engagementhamburg germanymatchsoccer ballsoccer playersoccer matchpark benchbechdel test passedcultural differencejumpingmulticulturalracial discriminationvictorybride and groomveilcanceled weddinghinduismsikhdefeatsoccer footballsoccer fanmusclesoccer teamasian indianteenage angstfoosballsit upssoccer coachinterracial lovepunjabibritish asiangoalkeeperlondon undergroundfake illnessburn scarindian pakistanisoccer goalburn injuryracist insultwedding invitation360 degree well shotsoccer starlebanesenubile womanfashion magazinesports bragirls' soccersports announcerlingerie storepenalty kicksarireference to george michaelwomen's soccerbridal showerbandstandfamily traditionsbritish indiansoccer trainingkneehit with a ballrubbing nosessoccer practicesuspected lesbianwater sprinklerbroken marriage engagementanglo indianbritish soccergoal keeperletter of acceptancewest london (See All) |
The story of John Lennon's childhood and teenage years from 1944 to 1960, his relationship with his aunt Mimi and his mother Julia -the two dominant women in the first part of his life-, his first meeting with Paul McCartney and George Harrison, their friendship, their love for music and the birth o β¦f The Beatles. (Read More)
Subgenre: | coming of agetragedy |
Themes: | moneyfriendshipdeathdrinkingdrunkennessfuneralangertheftdeath of motherdepressiondeath of wifechildhood |
Mood: | nightmareaffection |
Locations: | bicyclebusschoolrestaurantcemetery |
Characters: | best friendlittle boyteacherfriendhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipsingerboyteenage girlteenage boygirlstudentdancer β¦musicianbabysister sister relationshipthiefreference to godcousin cousin relationshipuncle nephew relationshipaunt nephew relationship (See All) |
Period: | 1960s1940s1950s |
Story: | school uniformlistening to musictape recorderbedroomcryingtelephone callsingingphotographf ratedsexbloodflashbackmasturbation β¦two word titlekisscigarette smokingfingeringdancingpartybased on true storyfondlingbased on booksongtitle directed by femaledreamunderwearfoodmirrorurinationpunched in the facedrinksecretletterbookliebeertearsrunningbirthdayrock musiccafecollegepianoguitartelephonebandambulancemontageeatingwidowhouserock banddrawinghit by a carbirthday partygraveyardflash forwardargumentmicrophonereadinguniversitydeath of husbandrock 'n' rollsadnesscharacter says i love yousleepingpubrecord playerbirthday caketeateen angstwhat happened to epiloguehead buttdesirewoman with glassesrecordingtitle based on songgroup of friendsrageguitaristaudienceblack humorpassportmovie theatreswitchbladebloody noseshopliftingbackstagedrummertheatre audienceabsent fathersexual humorsongwriterpierattractiondark pastdressing roomrecording studiolaughingdead motherpajamascrowdexhibitionismnew zealandmusic bandfast motion scenedrumsjoypiano playerreference to elvis presleyporn magazinedark secretadolescencejazz musiclooking out a windowguitar playingharmonicaboy with glassesbus stopflasklistening to a radiowrathguitar playerurinalguardianhamburg germanypawnshopwakegravestoneoutdoor oral sexmailmanthe beatlesgrudgedoormanabsent motherwaveoverhearing sexmusical instrumentrecord storemusic storebanjomusic groupreference to winston churchillrock groupliverpooloverheard conversationdouble decker busbloody mouthboardwalkcollapsesketchingdeath of uncleabandoned by fatherillegitimacygarden shearshalf brother half sister relationshipabandoned by motherbirth certificatechildhood memoriesboys' bathroomband managerlodgerschool suspensionlawn chairfish and chipsknocking on doortroubled teenage boyblackpool englandabandoned by husbandreference to buddy hollyreference to little richardsleeping on a benchreference to tchaikovskysinging along with a recordbiochemistryseaside resortbanjo playerschool blazerbrain hemorrhagewashboardlistening to classical musicclipping a hedgemerchant navy (See All) |
1972. Vada Sultenfuss (played by Anna Chlumsky) is an intelligent, bubbly, hypochondriacal 11-year old girl. Her father, Harry (Dan Aykroyd), is a mortician and a widower. Her best friend is Thomas J Sennett (Macaulay Culkin). Then her father hires a new receptionist, Shelly (Jamie Lee Curtis), and β¦life will never be the same again. (Read More)
Subgenre: | coming of age |
Themes: | friendshipdeathmarriagefeardancefuneralmemoryangertheftgriefpoetryphotographypanicchildhoodwriting β¦death in childbirthfear of death (See All) |
Locations: | bicycleforestsmall townwoodswheelchairlakeschool teacherpennsylvania |
Characters: | best friendlittle boylittle girlteacherchildrenfriendfamily relationshipsfather daughter relationshipdoctorbrother brother relationshipboygirlpolice officernursestudent β¦musicianwriterteacher student relationshipamericangrandmother granddaughter relationshipsingle fatheruncle niece relationshipchildhood friendboy girl kiss (See All) |
Period: | 1970ssummeryear 1972 |
Story: | blackboardtomboycrushfireworksclassroomcryingsingingphotographbloodtwo word titlekissdancingpantiescorpsewatching tv β¦tearsbeddead bodyneighborrivertelevisionswimmingbasketballdeath of friendfishcoffinfishingtreeargumentmicrophonewidowermini skirtdeath of childscreamringdatebasementfirst partloss of mothertypewritergaragesingle parentrecord playergirl in pantiespoemapplausegamesupermarketlifting someone into the airhattitle based on songloss of friendoverallsloss of wifelosstimecarnivalpicnicyogaministerold agemourninghippieinsectsong in titlemedical examinationmakeupfirst kissrosedead childengagementmeditationlipstickbarbecuedivorceeuncleplaying cardspetmenstruationbeebicyclingundertakertween girlponytailboy with glassesgoldfishteasingreceptionistbikedocumentcrying femalefuneral homeallergy11 year oldfourth of julyreference to richard nixonshopping cartmortuarycasketex wifemortalityprecocious childrocking chairbingocampermorticianblond boyfunfairphonograph recordoathfairgroundfireworksenilitymakeup artistlongingjumping ropecadaverwaspdead fishlifting a female into the airbeehivebumper carfirst crushmotor homecrying childmenarchecuckoo clockpuppy lovebee stingpunched in the gutex husbandchocolate barsitting in a treecrypony tailskipping ropejoblessembalmingpledge of allegiancetubaprostate cancerstylistteacher crushmajor child rolehypochondriastashbee attackcarnival gamegender in titlethe star spangled bannerfish bowlreference to the marx brotherstree climbingwant adbell bottomslaneswarm of beescarnyinsect attackleaseproducewriting classreference to walter cronkitedeath noticemixed bloodchild killed by an animalmood ringphrenologyschwinn bicyclecrush on teacherrope skippingcosmetologist (See All) |
Uxbal, single father of two children, finds his life in chaos as he is forced to deal with his life in order to escape the heat of crime in underground Barcelona, to break with the love for the divorced, manic depressive, abusive mother of his children and to regain spiritual insight in his life as β¦he is diagnosed with terminal cancer. (Read More)
Themes: | moneyreligionmurderdeathmarriagedrugsbetrayaldrinkingfeardrunkennessmemorydrug usecancerredemptionguilt β¦griefillnessphotographyexploitationdyingpolice corruptionafterlifedying fatherdying from cancer (See All) |
Mood: | rain |
Locations: | schoolhospitalbarbeachrestaurantchurchforestsnowcemeterynightclubwoodspolice carstrip clubmexicotrain station β¦slumsex in a closet (See All) |
Characters: | little boylittle girlchildrenmother daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshippolicemother son relationshipfather daughter relationshipdoctorbrother brother relationshipboy β¦brother sister relationshipprostitutegirlnursepolicemandancerbabygay kisschinesegay relationshipsingle fathergay fathercrying babychinese foodgay asianbaby boypolice violencereligious iconsex with brother in lawasking for forgiveness (See All) |
Period: | 2000s |
Story: | belief in the afterlife10 year oldconstruction workerconstruction sitebackpackhuggingcookingcryingtelephone callsingingtitle spoken by characterphotographone word titlefemale nudityblood β¦violencebare chested malekissfightcigarette smokingdancingchaseshowercell phonedreamcorpseunderwearfoodmirrorurinationface slapwatching tvdrinkarrestundressingthongvomitingtearsrunningbirthdaydead bodycafebathroomjailhallucinationtelephonesubjective cameraorphanwinecandlestrangulationdrug dealermontageeatingcocainetoiletimmigrantsubwayaccidentfishdinnerchild abuseapologycoffinmarriage proposalpaingravemicrophoneprologuemassageringflowerspursuithairy chesttragic eventcrossdeath of soncharacter says i love yougay coupletrustsingle parentterminal illnessafricanbirthday cakecloseted homosexualtv newssyringemedicinebreaking and enteringwarehousehypodermic needlelooking at oneself in a mirrorcakebabysitterice creamcrucifixmorguespiderdesperationgay parentstreet lifemale underwearpillssufferingboxer shortsmourningmedical examinationmarital separationmale male kisspolice raiddead boybriefsinjusticedead motherillegal immigrantowldormitorysuffocationg stringcremationbreast feedingrepeated sceneevictionsnorting cocainedead fathertv reporterblack marketconstructionclimbing through a windowdenialdying mansense of smellbreaking a windowmarriage problemsmediumsewing machinesitting on a toiletintentionally misspelled titledistrustbarcelona spainsleeplessnesspole dancerhappy birthday to youillegal immigrationspaghettimortuarywrapped in a towelstreet vendorchemotherapyasphyxiationbailbipolar disorderforkcrematoriumchild's drawingpneumoniadead parentsnoseblowing out candleheartbeatsparklerestranged couplemedical clinicwashing clothesatonementblood sampledead sonmass deathbed wettingdiamond ringout of body experiencetouching someone's breastsreference to mother teresaterminal cancerestranged wifesenegalsweatshopfastingwetting oneselffootbridgeodorreference to disneylandwraithbad newsdeath by suffocationviolence against a childembalmingcarbon monoxide poisoningface woundnude dancingprostate cancerseven year oldupside down viewwaiting in lineincontinencechinese immigrantmale wearing an earringsense of soundtalking with the deadhuman exploitationabandoned childadult diaperbeginning morphed with endingsenegalesemagnetic resonance imagingpounding on a doorreference to the united nationsbarred windowpyreneesreference to the dalai lamacommunicating with the deaddeath from cancerillegal workerkid artstrip club ownerboogerheaterdeath by asphyxiationmale ponytailreference to francisco francopierced eartalkativenessboy smoking a cigarettedead body on beachprostate exammisspelled worddead body floating in waterreference to jack danielsappliance storebody washed up on beachhitting a childsilent sceneblack marketeersurrealism sequenceurinating bloodmultiple tv screenssent to one's room (See All) |
In a world difficult to comprehend, Nathan struggles to connect with those around him - most of all his loving mother - but finds comfort in numbers. When Nathan is taken under the wing of unconventional and anarchic teacher, Mr. Humphreys, the pair forge an unusual friendship and Nathan's talents w β¦in him a place on the UK team at the International Mathematics Olympiad. From suburban England to bustling Taipei and back again, Nathan builds complex relationships as he is confronted by the irrational nature of love. (Read More)
Subgenre: | coming of ageteen romance |
Themes: | friendshiplovedrugsfearfuneraldeath of fatherobsessionillnessdisabilityautismchildhood traumaself harm |
Mood: | rainhigh school |
Locations: | school busbustraincarcemeteryairplaneairportchinese restaurant |
Characters: | little boyteacherfather son relationshipmother son relationshipboyfriend girlfriend relationshipboyteenage girlteenage boystudentdancermotherteacher student relationshipchineseuncle niece relationshipyounger version of character β¦chinese foodself cuttingchinese abroadchinese girl (See All) |
Period: | year 1996 |
Story: | playing a video gameblackboardchild protagonistbackpackfireworksvancompetitioncryingtelephone callphotographsexbloodflashbackkissdancing β¦showervoice over narrationcell phoneunderwearcar accidentmirrorslow motion scenewatching tvcomputerrunningcafemarijuanareference to jesus christtelephonef wordwinebasketballmontagewidowfour word titledrivingapologyfishingflash forwardparkprologueumbrellasuitcasepianisthigh school studentdeath of husbandsadnessloss of fatherflowersleepingeyeglassesnerdapplausepot smokinglooking at oneself in a mirrorscene during opening creditshatice creampsychologistdriving a carteenage protagoniststreet lifeinterracial friendshipinterracial romancenicknamerap musictelescopementoraquariumfirst kisspridedemocracyturtlebalconycanegeekbenchswearingholding handschildhood memoryplaying cardsclose up of eyesmarijuana jointnarrated by charactershynessrepeated scenescene before opening creditspiano playinglooking out a windowmathematicsvacuum cleanerbroken windowfish tankgroup therapygoldfishinterracial kissreference to albert einsteintestdripping bloodtaiwanexamrainbowbriton abroadcircular staircasetai chisupport groupcolorclose up of eyeinspired by true eventschild prodigymentor protege relationshipdisabledbloody facefired from a jobtraffic lightwalking stickwatching someonebeing watchedjoke tellingintrovertmultiple sclerosisshared bedpenis slurreference to isaac newtonsparklerbroken windshieldceiling fanold people's homefirst crushteenage romancecrying childchildhood flashback9 year oldautistic savanttoy trainseat beltreference to stephen hawkingshycambridge universityreference to australiaarm woundchild smokingsymbol in titleelectric trainhiding under a tablemathematics classmother son hugwatching a video on a computermath teachervoice over readingsecondary schoolsharing a bedconservatorytoy dinosaurautistic childcambridge englandfalling to the groundplus sign in titleautisticautistic sonreference to monty pythongiftedreference to pythagorastrain setcultural exchangereference to indiagifted childprime numbersreference to englandmathematics teacherprawnreference to bertrand russellreference to the bee geesfibonacci sequencereference to chinareference to pandora's boxfalling on someoneletter in titleobject in nosemath examreference to jupiter the planetsharing bedroomautistic boyletter of acceptanceoverflowing sinkreference to canadatakeawaymath geniussitting under a table (See All) |
A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.
Subgenre: | suspense |
Themes: | murderdeathsurrealismrapedrinkingfuneralinvestigationvoyeurismmemoryobsessionredemptionpoetryhome invasionhopemurder investigation β¦death of daughterafterlifemissing child (See All) |
Mood: | rain |
Locations: | school busbicycleschoolhospitalsnowcemeterybathtubtaxifarmpolice carlaketaxi driverkitchen firerunning in water |
Characters: | little boylittle girlmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctorbrother sister relationshipteenage girlteenage boyserial killerdetective β¦policemandancerphotographersister sister relationshipgrandmother granddaughter relationship (See All) |
Period: | 1970syear 1973 |
Story: | toy storepainting toenailsshopping mallsoccercryingtelephone calltitle spoken by characterphotographf ratedbased on novelbloodflashbackdogkisscigarette smoking β¦dancingknifechasethree word titlefirevoice over narrationbeatingdreamcorpseblood splatterfoodwatching tvcameradrinkfalling from heightpaintingbooktearsrunningbirthdaydead bodyneighborvoyeursubjective cameraflashlightcandleaxemontageeatingno opening creditspainterunderwater scenesearchflash forwardtreestalkersuburbfantasy sequencesuitcaseevil manreadingbaseball batlightningflowerspursuitsuspicionhatestrong female characterrecord playereyeglassespoembreaking and enteringhatjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwrecklost lovevacuum cleanerbroken windowdigging14 year oldfalling into watercornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All) |
John Kimble is a tough city cop who's been on the trail of drug dealer Cullen Crisp for years. He finally tracks Crisp down but it seems the only person that can testify against him is his ex-wife. The problem is she's disappeared and all Kimble knows is the name of the school in Oregon where her so β¦n attends. When things don't quite go to plan, Kimble finds he has to go undercover on his toughest assignment yet - Kindergarten teacher! (Read More)
Subgenre: | martial artscult filmblack comedyfairy talefish out of water |
Themes: | friendshipmurderdeathloverevengekidnappingbetrayalprisonfearheroinvestigationdeceptionrobberypsychopathparanoia β¦redemptionpolice brutality (See All) |
Mood: | rainnightmarenight |
Locations: | school buskitchenschoolhospitalrestaurantforestcarsmall townairplanelos angeles californiawaterwoodspolice stationcourtroommotel β¦gas stationschool teacherfire truckschool fire (See All) |
Characters: | little boylittle girlteacherfriendfamily relationshipsfather son relationshippolicemother son relationshipdoctorpolice officerdetectivehostagelawyertough guyaction hero β¦single motherwaitresssecurity guardpolice detectivevillainteacher student relationshipex husband ex wife relationshipcrying girlcrying boyairplane stewardessgirl cryingchildren singing (See All) |
Period: | 1990s20th centuryyear 1990 |
Story: | school principaltoy storeblackboardprincipalshopping mallbackpackclassroomphotographbloodviolencetwo word titleguncigarette smokingpartychase β¦surprise endingpistolshowerfireshootoutdreamcorpseshot to deathblood splatterfoodshot in the chestshotgunrescuepunched in the facedrinkarrestgunfightpaintingbookvomitingshowdownheld at gunpointsunglassesbirthdaybedinterrogationbathroompianohandcuffsrevolvercriminalgay slurflashlightwineambulancedrug dealermontagebridgedinnerchild abusejudgechilddream sequenceanimaldisarming someonechild in perilhit by a cardouble crossshot in the legpainattempted murderlibrarydrug addictdangerscreaminglocker roomundercoverrace against timedollknocked outreadingtough girlbaseball batscreamdomestic violenceshot in the shoulderlong takegymdeath of sonwitnesspolicewomansuspicionsilencerobscene finger gesturetwingrandmothertrustarsonfreeze framesingle parentpickup truckapplausefireplacerevelationhead buttheroineheavy rainsociopathscene during opening creditslifting someone into the airsecurity cameracaught having sextoymorguevillainessblockbustercheffollowing someonecompassionanimal attackfalse identitymilkdrug dealingdrug overdosepump action shotguninnocencecynicismpartnerpunched in the stomachjunkiecigarette lighterpunched in the chestwisecrack humorundercover coptough coppierabusive fatherbruisepunchabusive husbandsmokelingerie sliplyingfirefighterhit with a baseball bathairdresseryellinginvestigatorteachingclosetbodyfake identityreading aloudcrutchestelling someone to shut upstreet marketmotel roomadvicewhistleinformantcastshoutingelementary schoolsleepredheaded womanhospital roomwhisperingpharmacypolice captainstretchermegaphoneone linerbathrobeunsubtitled foreign languagebitten in the neckman punching a womanmacguffinkindnessidentical twinsawkwardnessschoolteachermaverick copmurder witnessoregontwo way mirrorbadgefemale copfather son estrangementhair salonbeauty salongarbage truckreference to abraham lincolnpillowmerry go roundheadachedriving at nightpencilkicking in a doortrenchcoatfake accentman slaps a womanwetred herringpolice partnerlambponyfire alarmfiancefemale vomitingkindergartendinner datewalking stickbouquet of flowerswearing sunglasses insidesnoopingstore clerkpacific northwestmarchingfood poisoningfake beardredhead girlends with freeze framehula hoopleg bracechalkboardhandcuffed womanstopwatchfirefightingpastasit upsinfluenzasubstitute teacherbullhornlunchboxchild in dangerinterrogation roomwitness to murderyelling for helpcrying childtoy trainflourpolice lineuprepeated dialoguetwentieth centuryschool librarynapfire departmentnemesisundercover operationantennaferret6 year oldpledge of allegiancesaloncaught kissingdeath by overdoseclumsyfire sprinklerprincipal's officereading to a childworried motherspeaking germanclimbing a ropemilk cartonwhite winebottle of winekindergarten teacherpolice officer shot in the legundercover policemanundercover policewomanbathroom humorklutzseesawundercover missiongelatinman punches womanrag dollelementary school teacherrunning up stairssleeping in classtinfoiltoy truckvice copjelloreading poetryreading a poemreal twins playing twinsrope climbingshot through the chesttripping overhandcuffed to someonemale ponytailjumping jacksschool playgroundcaught snoopingnew partnerpurposely hit by a careating a sandwichgettysburg addressschool gymfirestartergift of flowershagglingkids playingsuspected of being gayassault coursecounty jailfire chieffire drillspoon feedingstuffed toy pandathree legged raceclassroom disciplinefeeling sickhypoglycemiainflatable toymale slaps a femaleman carrying a boysecret hiding placesick womanantihistamineaustrian accentblueberry piedeath by drug overdoseeating in bedkilling a witnesslying to a childmilk moustacheok hand signpony ridescreaming in ragesetting a building on firesleeping childwoman's birthdaywoman using crutchesworking single motherrun down by a car (See All) |
A tale told over four seasons, starting in autumn when Juno, a 16-year-old high-school junior in Minnesota, discovers she's pregnant after one event in a chair with her best friend, Bleeker. In the waiting room of an abortion clinic, the quirky and whip-sharp Juno decides to give birth and to place β¦the child with an adoptive couple. She finds one in the PennySaver personals, contacts them, tells her dad and step-mother, and carries on with school. The chosen parents, upscale yuppies (one of whom is cool and laid back, the other meticulous and uptight), meet Juno, sign papers, and the year unfolds. Will Juno's plan work, can she improvise, and what about Bleeker? (Read More)
Subgenre: | independent filmcult filmdark comedyteen movieteen comedy |
Themes: | friendshipmarriagejealousypregnancydivorcedrug usebullyingadoptionabortionmythology |
Mood: | high school |
Locations: | bicycleschoolhospitalsnowwheelchair |
Characters: | best friendteacherfemale protagonistfriendhusband wife relationshipmother son relationshipfather daughter relationshipteenagerboyfriend girlfriend relationshipdoctorsingerteenage girlteenage boystudentdancer β¦musicianbabylawyersister sister relationshipbullysingle motherstepmother stepdaughter relationshippregnant teenager (See All) |
Period: | wintersummer |
Story: | title appears in writingshopping malllistening to musicclassroomcryingtelephone callsingingtitle spoken by charactercharacter name in titleone word titlef ratedsexflashbackdogkiss β¦dancingpantiesvoice over narrationsongunderwearurinationslow motion scenecomputercondomvomitingtearsrunningbathroomguitartelephonenewspaperbandmontagetoiletscantily clad femaleprologueprotestsuburbpay phonehigh school studentchildbirthbasementflowerclassobscene finger gestureteenage sexstrong female characterteen angstloss of virginitycomic bookguitaristdemonstrationcomposerstrong female leadvirginitycommercialattorneyconvenience storebanananotebenchmarital problemwilhelm screampostervideo tapeteenage pregnancyforename as titlebicyclingpregnancy testponytailclinic16 year oldreceptionistautumncdmailboxpipeguitar playerpromcactusnewborn babysewing machineallergybechdel test passedfilm starts with sexunwanted pregnancywatching a videoanimated creditsminnesotaclerkfurnituredressingkeyboardrunnerpanties hit the floorcheerleader uniformduetunwed pregnancypaperdrugstoretrack and fieldultrasoundtruth or daremicrowaveorange juicehigh school athletewoman in laborunwed mothereffeminacyreference to woody allensuicide contemplationschool lockerteenage motherabortion clinicfolk songhigh school promconvenience store clerkreference to kurt cobainschool cafeteriafingernailsconsidering abortionpositive pregnancy testspring the seasonreference to diana rossdeodorantfour seasonswoman holding a babydiscovering one is pregnantreference to iggy poptrack meetmoving furniturelounge chairnail salonpregnant schoolgirlfolk singingneedlepointtic tacsinfant in cast creditsanti abortion demonstrationreference to the carpenters (See All) |
In the early 60s, two boys - Ignacio and Enrique - discover love, movies and fear in a Christian school. Father Manolo, the school principal and Literature teacher, both witnesses and takes part in these discoveries. The three characters come against one another twice again, in the late 70s and in 1 β¦980. These meetings are set to change the life and death of some of them. (Read More)
Subgenre: | coming of agegay interest |
Themes: | religionfriendshipmurderdeathlovefearblackmailsexualityunrequited loveeducationtransgenderfirst love |
Mood: | religiousneo noir |
Locations: | religious schoolschoolchurchswimming poolspaincatholic churchcatholic school |
Characters: | teacherchildrenmother son relationshipbrother brother relationshipgay sexactorpriesttranssexualgay kisschristianitydirectorprofessorcatholicfathercatholic priest β¦parent child relationshipboyfriend boyfriend relationshipsex with a priestevil priestboy singer (See All) |
Period: | 1960s |
Story: | school principalprincipalmale nudityflashbackmasturbationbare chested malemale pubic hairunderwater scenebuxomfilm within a filmwitness β¦reunionunderwaterheroinlgbtdrag queenwhat happened to epiloguedesiresexual abusedrug abusegay lead charactermale underwearmovie theatreliteraturejunkieyoung loveboarding schoolfilm actormale objectificationlightercatholicismtransvestismwhite briefssexual frustrationsexual repressionhitchcockianscreenplaysexual identitysexual obsessionmultiple time framespersonal assistanttranssexualityhostelloss of innocencelife and deathsexual favorloss of faithmovie businessstory within a storypederastyman boy lovehebephilia (See All) |
SON OF RAMBOW is the name of the home movie made by two little boys with a big video camera and even bigger ambitions. Set on a long English summer in the early '80s, SON OF RAMBOW is a comedy about friendship, faith and the tough business of growing up. We see the story through the eyes of Will, th β¦e eldest son of a fatherless Plymouth Brethren family. The Brethren regard themselves as God's 'chosen ones' and their strict moral code means that Will has never been allowed to mix with the other 'worldlies,' listen to music or watch TV, until he finds himself caught up in the extraordinary world of Lee Carter, the school terror and maker of bizarre home movies. Carter exposes Will to a pirate copy of Rambo: First Blood and from that moment Will's mind is blown wide open and he's easily convinced to be the stuntman in Lee Carters' diabolical home movie. Will's imaginative little brain is not only given chance to flourish in the world of film making, but is also very handy when it comes to dreaming up elaborate schemes to keep his partnership with Lee Carter a secret from the Brethren community. Will and Carter's complete disregard for consequences and innocent ambition means that the process of making their film is a glorious roller-coaster that eventually leads to true friendship. They start to make a name for themselves at school as movie makers but when popularity descends on them in the form of the Pied Piper-esque French exchange student, Didier Revol, their unique friendshiβ¦ (Read More)
Subgenre: | coming of ageindependent filmslapstick comedy |
Themes: | religionfriendshipsurrealismtorturefilmmakingtheftbullyingchildhoodreligious upbringing |
Mood: | nightmare |
Locations: | bicyclebusschoolhospitalrestaurantchurchforestsmall townwoodswheelchairenglandlake |
Characters: | teacherfriendmother daughter relationshipfamily relationshipsfather son relationshippolicemother son relationshipbrother brother relationshipboybrother sister relationshipgirlnursedanceractorthief β¦artistchristianbullysingle motherbiblefrenchgrandmother grandson relationshipwriter directorreligious sectchildren in love (See All) |
Period: | 1980s |
Story: | fundamentalist religionschool uniformhead scarfwater fountainhelmetcookingprayerclassroomcryingtitle spoken by characterviolenceflashbackdoggunkiss β¦fightcigarette smokingdancingpartychasethree word titledreamfoodrescuewatching tvwritten by directorbookvomitinglietearssunglassesrunningcafebathroomhallucinationrivercandlevideo cameraambulanceeatingwidowtoiletapologyno opening creditsdrawingchild in perilunderwater scenedrowningliarumbrellastatuereadingprankconvertiblepursuitwigfilm within a filmgiftclassgraffiticowsubtitled scenerecord playerrunawaysupermarketinjuryrecordingmousemale bondingmovie starvideotapewristwatchvisitskateboardbroken legmovie theatregrocery storeimaginationshopliftingbraverycrossbowmobile phonedrummertheatre audiencemedical examinationscissorsoilabsent fatherfriendship between boysclassmatearrowalarm clocksurprise after end creditsprayingcandyboredompickpocketrunning awaydead fathercrutchesalarmdrumgoldfishstuntworkshopkitescarecrowhallwaynursing homegurneyclimbing a treehome videoprivate schoolcamouflageintentionally misspelled titlestuntmanrescue from drowningtoy gunvisitorabsent motherphonographmovie fannecktiewater hosefrench accentbuilding collapserole modelheadbandsodabubble gumexchange studentcatapulttoilet stallmovie premierepower plantschool lockerold people's homescreen testchild driving a carpiggy bankgood samaritanreference to ramboentouragestitchfishbowltarforeign exchange studentinjured childanimated sceneaneurysmleg in castblood oathflip bookswinging on a ropetool shedblood brothersholding a gun to one's own headyoung filmmakerjumping into a riverabsent parentshit on the head with a ballamateur filmmakingguide dogplaying hookynose bandageboy smoking a cigarettescabtalking through a windowbicycle lockpineconestocking feetfake tattooimitating someonejumping from a treelow techprayer meetingschool tiemuscle suitflying dogsliding down a hill (See All) |
Anton is a doctor who commutes between his home in an idyllic town in Denmark, and his work at an African refugee camp. In these two very different worlds, he and his family are faced with conflicts that lead them to difficult choices between revenge and forgiveness. Anton and his wife Marianne, who β¦ have two young sons, are separated and struggling with the possibility of divorce. Their older, ten-year-old son Elias is being bullied at school, until he is defended by Christian, a new boy who has just moved from London with his father, Claus. Christian's mother recently lost her battle with cancer, and Christian is greatly troubled by her death. Elias and Christian quickly form a strong bond, but when Christian involves Elias in a dangerous act of revenge with potentially tragic consequences, their friendship is tested and lives are put in danger. Ultimately, it is their parents who are left to help them come to terms with the complexity of human emotions, pain and empathy. (Read More)
Themes: | friendshipmurderdeathrevengemarriageinfidelityjealousyadulterypregnancyfearfuneralnatureextramarital affairangerdivorce β¦lonelinesspsychopathdeath of motherdysfunctional familycancergriefunfaithfulnessillnessbullyingcrueltydeath of wifevengeanceforgiveness (See All) |
Mood: | satire |
Locations: | bicycleschoolhospitalchurchsmall townboatdesertlondon englandelevatorpolice stationpolice carafricalaketruckrooftop β¦war zonerunning after a truck (See All) |
Characters: | teacherfriendfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipdoctortattoobrother brother relationshipboynursestudentpolicemanbaby β¦bullygrandmother grandson relationshipsingle fatherbaby killer (See All) |
Story: | school principalplaying a video gamebackpackplaygroundfireworksvanclassroomcryingtelephone callphotographone word titlef ratedsexbloodviolence β¦bare chested malekissfightexplosionknifecell phonetitle directed by femalebeatingblondeslow motion scenecomputerlierifletearssunglassesbombrunningf wordswimminggay slurambulancestabbingwomaninternetapologychildcoffinpainbeaten to deathprologuewidowerliartentflowersdisappearancecountrysidecrossthreatthreatened with a knifeloss of motherclassgaragehatepickup trucksurgeryafricanwoundjoggingpatientvandalismdenmarkloss of wifespiderassaultmoralitypromiseremote controllandscapewindsufferingmourningabsent fatherpunched in the chestinfectionprideblood on shirtfriendship between boysswingmarital separationfemale doctormarital problemmoral dilemmatext messagingsaving a lifehandshakehysteria12 year oldharbornecrophiliahit in the facecremationdockhead woundcrutchesname callingwebcammilitiaidealismpeer pressurestethoscopekiteauto mechanicgurneysoccer balljumping into watertormentwarlordguerrillaveilleg woundrefugee campsurgical operationjoggertoy cardental bracesrubik's cubehead bandagebiblical referencegunpowdermissing sonaudikiss on the foreheadsudansuicide contemplationpacifismvideo chatretaliationbomb explosionmalariapain killerreference to coca colasummer housewoman directorboys' bathroomswedeparallel storyautomatic riflecobwebsilofacial injuryclimbing a ladderdragging someonewanting to diemultiple languagesparent teacher conferencechoking someonehomemade explosivetelephone hangupct scanhomemade bombmodel carberry pickingereye for an eyereference to hans christian andersenflying a kitevan explosionshoulder woundblind in one eyeknife held to one's throatdying during surgeryhit with a basketballholding someone's hand (See All) |
Soon after moving in, Beth, a brainy, beautiful writer damaged from a past relationship encounters Adam, the handsome, but odd, fellow in the downstairs apartment whose awkwardness is perplexing. Beth and Adam's ultimate connection leads to a tricky relationship that exemplifies something universal: β¦ truly reaching another person means bravely stretching into uncomfortable territory and the resulting shake-up can be liberating. (Read More)
Subgenre: | independent film |
Themes: | infidelityjealousyadulterydrinkingfearfuneralextramarital affairdeath of fatherguiltunfaithfulnessadoptionautismradiationgay adoption |
Mood: | moving |
Locations: | schoolnew york cityrestauranttrainsnowcemeteryapartmentpolice carcourtroomofficeouter spaceschool director |
Characters: | little boylittle girlteacherchildrenmother daughter relationshiphusband wife relationshippolicefather daughter relationshipafrican americanboyfriend girlfriend relationshippolice officerstudentpolicemanbabywriter β¦lawyersister sister relationshipemployer employee relationshipchineseengineerlesbian mother (See All) |
Story: | playgroundhuggingvanfalse accusationbedroomclassroomcryingtelephone calltitle spoken by characterphotographcharacter name in titleone word titlesexkissfight β¦partyvoice over narrationcell phoneunderwearfoodmirrorwatching tvcomputerdrinkbooklietearsbedcafeneighbormanhattan new york citysubjective cameranew yorkcaliforniaeatingjudgeapologytrialgraveyardflash forwardparktheatergraveauthorargumentfired from the jobchampagnemassagedollreadingflowerscourtamerican flaglaptopcharacter says i love youflowerloss of motherclassblack americantwenty somethingwaiteranswering machinetealooking at oneself in a mirrorgay parentstrangerclockapartment buildingwatching televisionpromisetelescopestarnew jerseyboxer shortsjob interviewanxietyco workertheatre audiencefirst kisslesbian couplerefrigeratorsnowingnotelooking at self in mirrorplaybenchflagaccountantpresentshynessface maskloss of jobclosetlaundrytestimonycentral park manhattan new york citylast will and testamentreading aloudfencebroken mirrortheatre productionmessageastronomyforeplayquarreluniversereference to albert einsteintour guidepark benchreference to john f. kennedywashing machinegalaxylunchcalendarraccoonbreaking a mirrorinterracial adoptionspacesuitbroomcourthousequeens new york citysexual arousalreference to harry potterfired from a jobsolar systemfreezerasperger's syndromepadlocktelling a jokejoke tellingcartobservatoryastronomerlooking for a jobroutineschoolyardpre schoolchildren's bookcuddlinggrand central station manhattan new york cityreference to thomas jeffersonreference to mozartlaundry roomgrocerieslooking for workreference to wolfgang amadeus mozartbig bangjob applicationplanetariumtoy makerbreakfast cerealbig bang theorycentral parkreference to f. scott fitzgeraldreference to julia robertsreading to a childsaturn the planettv dinnerpicture booklonely man29 year oldcracked mirroroff broadwaychildren's authorsitting on stepsjail sentencesuspected paedophiledestroying a roommen's clothing storesurrogate unclewestchester new yorkreference to samuel beckettwatching a playkicking a canmacaronireference to clarence darrowwashing a windowfrozen foodsweeping a floorvoice recognitionpeople watchingreference to the little princetoy designer (See All) |
Former CIA spy Bob Ho takes on his toughest assignment to date: looking after his girlfriend's three kids (who haven't exactly warmed to their mom's beau). When one of the youngsters accidentally downloads a top-secret formula, Bob's longtime nemesis, a Russian terrorist, pays a visit to the family.
Subgenre: | martial artsslapstick comedy |
Themes: | herodivorcehome invasion |
Locations: | kitchenbicycleschoolhospitalrestaurantswimming poolhotelhelicopterdeserttaxilaboratorychinese restaurantkitchen fire |
Characters: | little boylittle girlmother daughter relationshipfamily relationshipsmother son relationshipboyfriend girlfriend relationshipboybrother sister relationshipteenage girlteenage boygirltough guyartistaction herobully β¦single motherinterracial relationshiprussianchinesestepmother stepdaughter relationshipstepbrother stepsister relationship (See All) |
Story: | school principalriding a bicycleshopping mallcookingbedroomviolencefightknifepistolfirecell phonebeatingfistfightface slappunched in the face β¦computercatarrestbrawlpaintingshowdownheld at gunpointhand to hand combatneighborhandcuffskung fuhalloweenspyassassinterroristmixed martial artstied to a chairdrivingman with glasseschilddisarming someoneone man armynews reportsuburbundercoverknocked outkicked in the facehalloween costumeamerican flagmartial artistpigtied upsecret agentciafreeze framestylized violencesingle parenthenchmanmartial arts masterassassination attemptbabysitteroverallskicked in the stomachvillainessnosebleedswat teamwristwatchladderlaserchop sockybreakfastgash in the facepunched in the stomachkicked in the crotchbooby trapaerial shotundercover agentturtlegadgetsecret identityterrorist plotpumpkinwilhelm screamstick fightnannysatellitecia agentterrorist groupcartoon on tvtrick or treatingparkourwatchkittencookiemacguffinmeat cleaverski maskbackyardinterracial couplerogue agentoverhead camera shotspy herogarbage cantoilet paperkicking in a doorhummerberetsugargadgetryhands tiedapple computerhair dryerhoseipodnanotechnologyred rosehit with a frying panmarriage ceremonyprincess costumebaconhalloween decorationmother's boyfriendouttakes during end creditslaundry roomwhite suitanimal bitechild spypigletplayboy mansionstepsister stepsister relationshipcookieswedgieoil refinerywire cutterasian man white woman relationshipends with weddingoatmealplayhousesitting on a rooftoptrip and fallvialhit by a falling objectknock knock jokecrash through windowcrashing through a doordoor shut in facebicycle bellbioengineeringfour year oldhandsomenessrobinson r44 raven helicopterok hand signruffled shirtextension ladder (See All) |
Frank Adler (Chris Evans) is a single man raising a child prodigy - his spirited young niece Mary (Mckenna Grace) in a coastal town in Florida. Frank's plans for a normal school life for Mary are foiled when the seven-year-old's mathematical abilities come to the attention of Frank's formidable moth β¦er Evelyn (Lindsay Duncan) whose plans for her granddaughter threaten to separate Frank and Mary. Octavia Spencer plays Roberta, Frank and Mary's landlady and best friend. Jenny Slate is Mary's teacher, Bonnie, a young woman whose concern for her student develops into a connection with her uncle as well. (Read More)
Themes: | moneyfriendshipdeathsuicideinfidelityadulteryfearextramarital affairangerobsessionunfaithfulnessbullyingforgivenesssuicide of mother |
Locations: | school busschoolhospitalbarbeachrestaurantswimming poolboattaxicourtroombaseballschool teacher |
Characters: | teacherfriendmother daughter relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipafrican americansingerboybrother sister relationshipgirldancerlawyerreference to god β¦bullygrandmother granddaughter relationshipuncle niece relationshipcrying girlphilosophy professor (See All) |
Period: | year 1998 |
Story: | school principalbackpackclassroomsingingtitle spoken by characterphotographone word titlesexkissfightdancingsongmirrorface slapslow motion scene β¦watching tvcomputercatletterbeersunglassesrunningneighborpianobritishmontagejudgeapologytrialdrawingmicrophonecourtchildbirthlaptopsadnessclasssleepingtrustblack americanpickup truckeyeglassesapplauselooking at oneself in a mirrorscene during opening creditshappinesscrying womanfloridacrying manbreakfastpromiseattempted suicideboston massachusettscellphonedead motherholding handsgeniusphoto albumsunset12 year oldboredomtestimonydockhead wounddvdname callinglooking out a windowmathematicshangover17 year oldelementary schoolprizeseagulllandladymailboxreference to albert einsteindnachild custodymotorboatscholarshipreference to googlebroken noseiphonedistrusttequilasilhouettetrespassingchild prodigyapple computerfoster homecheerleadingdrinking gamefoster familymathematiciangazebofirst day of schoolprimary schoolabandoned by fatherseashellwatching a movie on tvschool expulsionwater pump7 year oldhealth insuranceslamming a dooroutdoor cafeart projectgoogle searchhospital waiting roommathematics classcalculatorguesthousemassachusetts institute of technologytool shed29 year oldwoman wrapped in a towellocking a doormathematical equationelementary school teachervisitationmissing someoneping pong ballpet adoptiontripping someonesunscreenreference to germanysuicide of sister70 year oldgifted childreference to englandreference to rene descartesschool playgroundshow and tellcustody hearingbreaking someone's nosehit in the headmacbookchild servicesinternet searchfoster mother foster daughter relationshipfoster father foster daughter relationshipmathematics professorreference to cambridge universitysandpiper (See All) |
The story of Joseph, a man plagued by violence and a rage that is driving him to self-destruction. As Joseph's life spirals into turmoil, a chance at redemption appears in the form of Hannah, a Christian charity shop worker. Their relationship develops to reveal that Hannah is hiding a secret of her β¦ own with devastating consequences to both of their lives. (Read More)
Themes: | religionmurderdeathrapeprisondrunkennessfuneralabusedying |
Mood: | religious |
Locations: | buscemeterynightclubshed |
Characters: | husband wife relationshipboychristiansingle mother |
Story: | infertilitystorebelief in godhuggingprayercryingtelephone callsingingtitle spoken by characterone word titleviolencedogbare chested malefightdancing β¦showercell phonebeatingurinationguitaralcoholdeath of friendsevered headdrawingflowersdomestic violencedeath of husbandpubsingle parentragehidingblack eyebruiseabusive husbanddead dogbeheadingstuffed animalkilling a doganimal abusemooningbased on short filmbreaking a windowprison visitreference to supermansledgehammerdog attackdead husbandchild's drawingoxygen maskpool cuedeath of dogwife murders husbanddeath of peturinating on someonemarital rapemother's boyfriendpitbullabused womanreference to robert denirothrift storestuffed toy rabbitburying a dead dogburial of petkicking a dogkicked to deathpicture of jesusreference to jurassic parkbeheading an animalsevered dog's head (See All) |
When her wealthy fiance breaks it off, gold digger Elizabeth Halsey returns to middle school: she's an awful teacher but wants to save for breast-implant surgery. She brightens when Scott, a new teacher, turns out to be rich, and she stops showing films and sleeping in class when told there's a bonu β¦s for the teacher whose class scores highest on the state exam. Her competition for Scott and the bonus is cheery and tightly wound Amy. Amy digs for dirt on Elizabeth who cheats her way toward Scott's bed and the money. Honesty with students seems to be her only skill. She ignores Russell, a droll gym teacher, who looks on. Will she succeed with Scott and get those new breasts? (Read More)
Subgenre: | black comedyabsurdism |
Themes: | moneyrevengeinfidelitydrugschristmasjealousydrinkingdrunkennessdeceptionvoyeurismseductioncorruptiontheftblackmailpoetry β¦rivalryunrequited lovebreak upcheating (See All) |
Locations: | school busbusschoolbarrestaurantcarsnowmotorcycleapartmentpolice carchicago illinoismuseumsinging in a carschool teachersinging on a bus β¦singing on busrussian in usa (See All) |
Characters: | teacherfemale protagonistfriendpoliceteenagerboyfriend girlfriend relationshipdoctorteenage girlteenage boypolicemanlove trianglealcoholicprofessorfiance fiancee relationshipcolleague colleague relationship β¦crying girllow self esteempolice dogrussian abroadnew teacher (See All) |
Period: | christmas partysinging christmas carol |
Story: | school principalblackboardfalse accusationcompetitionclassroomcryingphotographf ratedfemale nuditynuditymale nuditybare breastsfemale frontal nuditymale rear nuditydog β¦two word titlesex scenecigarette smokingejaculationpartyknifesurprise endingerectiontopless female nuditycell phonecar accidentblondeslow motion scenewatching tvdrinkarrestsunglassesbirthdaycar crashmarijuanapianohandcuffsvoyeurguitarf wordcleavagebrabandconcertdisguisebasketballwomanmontageman with glassesscantily clad femaleroommatefemme fatalecoffeeracial slurflash forwarddrug addictcostumeliarmini skirtchampagnechristmas treemanipulationgymspeechwigsuspicionprofanitypoetkissing while having sextopless womanbirthday cakepoempot smokingsabotagefarcewoman with glassesscene during opening creditsmagazinefraudeccentricbarefoot maleambitionapplejanitorintrigueironyballbribeblack braframe upchristmas eveabsent fatherrivalturtlesexual humorbarefoot femaleethnic slursurgeonlyingarrogancereference to barack obamadrugged drinkmarijuana jointbriberynew jobporn magazineteachingbongshortscar drivingdefecationcafeteriaglovesfemale teachernudesarcasmdrunken manfriendship between womenhangovercamera shot of bare feetvulgarityguitar playingstonerelementary schooldomineering motherrumormasturbation referenceplaying guitarcar washenvydolphinnude girlnarcissismcookieexamhallwaycactuscrying femaleillinoissitting on a toiletawkward situationcheating boyfriendmanipulative behaviorbechdel test passedreference to abraham lincolnfully clothed sexseductive behaviorinformerwet clotheslack of moneytalking while drivingheadmasterfeet on tablefast food restaurantwrongful arrestswindlesmoking potseductive womangold diggerfemale antagonistdrinking from a bottleswindlerdrinking from bottleselfish womanfired from a joblearning the truthpretending to be someone elsemanipulative personmercedespsychological manipulationfalse nameplastic surgeonmanipulative womanbasketball courtlazinessantiherochristmas dinnergym teacheregoismmisanthropebustunfaithful boyfriendclassmate classmate relationshiptortoisetaking off shoescounting moneysubstitute teacherworkplace romanceflatmateplanting evidenceauditoriumlittle black dressreference to snow whiteroommate roommate relationshipspeeding vehicleegocentrismemotional blackmailmoney countingfake namebonuscar washingcheaterdodgeballdrunk manschool janitorschool tripcompulsive liardriving in reverseemployee dismissalprofessional rivalryemployee employee relationshipeating an applebreast enlargementcheating on a testdry humpingband membersinging alongtaking off bratrickeryerection visible through clothingreference to the three stoogeswomanchildacneegocentric womannarcissistic personality disordercompromising photographwashing carcoors lightobscene hand gesturereference to morgan freemanreference to tom sawyerconfidantfitness centerpoison applewearing a wigcompromising picturepoison ivyreference to michelle pfeifferdumped by boyfriendegocentricopening champagnesexy teacherboob jobbreast surgeryflatmate flatmate relationshipsuperintendentvulgar womanarrogant womandaisy dukeshit with a ballreference to pamela andersonspringfield illinoisfoul mouthsperm stainbreast examoxycontinreference to lionel richiesemen stainmanipulatorschool inspectorspreading a rumorteacher as protagonistbad teacherhistrionic personality disorderenvious womanface ticklazy woman (See All) |
In the depths of the 1930's, Annie is a fiery young orphan girl who must live in a miserable orphanage run by the tyrannical Miss Hannigan. Her seemingly hopeless situation changes dramatically when she is selected to spend a short time at the residence of the wealthy munitions industrialist, Oliver β¦ Warbucks. Quickly, she charms the hearts of the household staff and even the seemingly cold-hearted Warbucks cannot help but learn to love this wonderful girl. He decides to help Annie find her long lost parents by offering a reward if they would come to him and prove their identity. However, Miss Hannigan, her evil brother, Rooster, and a female accomplice, plan to impersonate those people to get the reward for themselves which put Annie in great danger. (Read More)
Subgenre: | cult film |
Themes: | politicsdrinkingdrunkennessseductionpovertyadoptioncrueltywealth |
Mood: | nightmare |
Locations: | new york cityswimming poolbathtub |
Characters: | little girlfemale protagonistchildrenmother daughter relationshippolicefather daughter relationshipsingergirlpolicemandanceralcoholic |
Period: | 1930s |
Story: | red dress10 year oldtomboychild's point of viewdressradiocryingsingingcharacter name in titleone word titledogfightdancingchasepanties β¦songunderweardrinkbased on comicrunningmanhattan new york cityfoot chaseorphannew yorkmansionlimousinemicrophonebusinessmanuniformrunawaylifting someone into the airorphanagebald manmovie theatrecapitalismpunchchauffeurdormitoryforename as titleclosetlaundrygardenertween girlwhistlebillionairedemocratredheaded womangreat depressionrepublicancleaninglocketchrysler building manhattan new york cityvillain turns goodpillow fightlifting female in airbucketreference to santa claussweaterventriloquistwashing dishesstray dogbraided hairbased on stage musicalorphan girlreference to greta garbobackflipchild as main charactercurly hairreference to fred astaireliverpool englandradio programfranklin d. rooseveltreference to j. edgar hooverreference to bette davissomersaultcartwheelfrecklesmopping a floordogcatcherhandstandredheaded girlreference to ginger rogerstin cankicked in the shindead mouseradio city music hall manhattan new york cityreference to the buddhamuttlaundry basketradio commercialscrubbing floorreference to william randolph hearstpig latinwashing a windowlittle orphan annieorphaned girlpulled by the earcomic villainesstiffany's (See All) |
Ricci, an unemployed man in the depressed post-WWII economy of Italy, gets at last a good job - for which he needs a bike - hanging up posters. But soon his bicycle is stolen. He and his son walk the streets of Rome, looking for the bicycle. Ricci finally manages to locate the thief but with no proo β¦f, he has to abandon his cause. But he and his son know perfectly well that without a bike, Ricci won't be able to keep his job. (Read More)
Themes: | moneylovedrinkingfearinvestigationrobberytheftpovertyhumiliationunemploymentwealthjusticestarvation |
Mood: | rain |
Locations: | bicyclebusrestaurantchurchboatpolice stationitalytruckgas stationbrotheltunnelcatholic churchwater wellunemployment office |
Characters: | little boychildrenmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipsingerboyprostitutepolice officerpolicemandancerbaby β¦priestlawyerthiefreference to godcatholicgermanbrother in law sister in law relationship (See All) |
Story: | riding a bicycleelectionradiofalse accusationprayercryingsingingbased on noveldogcigarette smokingdancingchasesongunderwearfood β¦urinationface slapdrinkarrestlietearsrunningcafeguitarrivercriminalswimmingwinebandold manbridgeeatingsearchdrowningbinocularskeylocker roomliarumbrellamissionpursuitcrosswitnesspsychicpizzaitalianshavingrome italycrucifixstealingbeardrehearsalswimsuitladderviolinfollowing someonestreet lifehaircutfanhungerdespairsuperstitionfrustrationsocietystadiumfortune tellerjobposterbeing followedworkerpost waraccordionbeggarbarberbreadtemptationwhistlesoupmacguffincheesemale protagonistseizurefilling stationlaborcyclingrescue from drowninghymnbeggingwaitingpotatodelivery manmasspenciloptimismradio broadcastbrothel madampapercapbuckettrolleypredictionwelfarestreetcarintegritycrossing selfhardshiprealismpastagluenon professional castcatholic masslicense platebicycle racedowryslanderfalling downneorealismstore roomepileptic seizuregarbage collectorfather slaps sonsoup kitchenstolen bicyclemandolinsundaybrushcombing hairproofreference to rita hayworthbicyclistlibelmisfortunestreet demonstrationbed sheetmadamesalarybricklayerthrowing water on someonewater faucetplowingpush cartbicycle bellact of conscienceserial numberbicycle shopneck scarfneo realismemployment officebicycle wheelitalian neorealism (See All) |
An elderly couple journey to Tokyo to visit their children and are confronted by indifference, ingratitude and selfishness. When the parents are packed off to a resort by their busy, impatient children, the film deepens into an unbearably moving meditation on mortality.
Themes: | moneyfriendshipdeathmarriagedrinkingfeardrunkennessfuneralmemorylonelinessdeath of motherillnessdeath of wifedyinghomelessness |
Locations: | bicyclebusschoolbeachtrainhotelcemeteryboatwatervillagerural settingurban settingjapanbaseballoffice |
Characters: | teacherchildrenfriendmother daughter relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctorsingerbrother sister relationshippolice officerstudent β¦policemanmusicianbabysister sister relationshipwaitressjapanesemaidgrandfather grandson relationshipgrandmother grandson relationshipmother in law daughter in law relationshipfather in law son in law relationshipmother in law son in law relationship (See All) |
Period: | 1950s |
Story: | school uniformfireworksprayerclassroomcryingtelephone callsingingphotographcigarette smokingsongdreamunderwearfooddrinkletter β¦lieplace name in titleold manwidowfishapologybathgraveyardold womansuburbfired from the jobwidowerliarumbrellamassagesuitcasereadingcity name in titlegiftdeath of sondeath of husbandsadnessreuniongardenloss of motherclasssleepingcult directorterminal illnessholidayteacard gamehypodermic needlecakecomaice creamhappinessagingtempleloss of wiferailway stationfestivalhonortowelambitionretirementtokyo japanold agefanmourninginsectpeacelostprideswinglanternbriefcasemahjongtripplaying cardsshamehairdresserpost world war twoharborelderlyfamily reunionaccordionselfishnesswatchpocket watchgeneration gapwhistlingdisappointmenttrain ridekindnesskimonorespectexamfeveroverweighttelegramdeskspahair salonsorrowbeauty salonestrangementsleeplessnessnewlywedsewingmedical doctortour buswaitingheadachedressingremarriagechantingfather in law daughter in law relationshipricetantrumcapchopsticksdoctor's officepinball machinehair dryertricyclegeishadawndoor bellheadstonehomesicknessspoiled childincensetradition versus modernitysightseeingelderly womanstubbornnessbeauticianhot springold coupleseasicknessmilitary draftfarewellelderly manbowingsakeblood pressureexpectationosaka japanill motherpublic bathhouse cleaningforgetfulnesskabukisweepingscrubbing floorsashswivel chairbroken chairdaybreaksashimideath bedkeepsakesibling estrangementspringtimeunable to sleep (See All) |