Please wait - finding best movies...
Susy was recently blinded and recently married. Susy's husband, Sam, is asked to hold a doll for a woman he doesn't know as they get off an airplane. The woman disappears. Later, she's found dead by her former associates, Mike and Carlino, small-time hoods, in Susy's basement apartment. (Both occupa β¦nts of the apartment are then absent.) The doll woman's newer partner in crime, Harry Rote, who murdered her for self-dealing, presses Mike and Carlino into a scheme to recover the doll, which contains a fortune in smuggled heroin. After disposing of the body, the thugs return while Susy is present to continue their search. They assume Susy's blindness will enable them to search her apartment under her very nose for the doll. In Sam's absence, Mike pretends to be an old friend of Sam's, while the three together spin for Susy a story of a murder investigation of her husband from which only the finding of the missing doll can save him. Rote is a predator, and his stalking of Susy becomes ever more obvious as the blind woman's predicament becomes ever more desperate. (Read More)
Themes: | claustrophobiablindnesshome invasionsurveillancepsychopathmurder |
Characters: | husband wife relationship |
Story: | blind protagonist42nd street manhattan new york cityvisually impaired persondestroying propertyloss of eyesightrun over by a carpanic attackreference to batmanpsychological tortureassumed identitywoman in jeopardydrug dealingbreaking and enteringthreatened with a knifewitness |
Recently divorced Meg Altman and her daughter Sarah have bought a new home in New York. On their tour around the mansion, they come across the panic room. A room so secure, that no one can get in. When three burglars break in, Meg makes a move to the panic room. But all her troubles don't stop there β¦. The criminals know where she is, and what they require the most in the house is in that very room. (Read More)
Subgenre: | suspenseheistpsycho thrillerpsychological thrillerheist gone wrong |
Themes: | home invasionsurveillancepsychopathmurderdeathrevengemoneybetrayaldrinkingtortureescapedeceptionrobberydivorcetheft β¦brutalityredemptionsadismgreedpanicinheritance (See All) |
Mood: | rainneo noirone night |
Locations: | new york citybathtubelevatorkitchentruckbus driverfire escape |
Characters: | husband wife relationshippolicefather daughter relationshipteenagermother daughter relationshipteenage girlfemale protagonistpolice officerserial killerpolicemanhostagethiefex husband ex wife relationshipengineer |
Story: | psychological torturewoman in jeopardybreaking and enteringthreatened with a knifef ratedbloodviolencegunphotographtitle spoken by characterexplosionknifepistolfirecrying β¦cell phonebeatingblood splatterurinationshot in the headrescueslow motion scenepunched in the facedrinkbrawlshootingheld at gunpointtearsdead bodyinterrogationbathroomneighbormanhattan new york citytelephonef wordcleavagesurvivalfoot chasenewspaperflashlightwineambushvideo cameraambulancebasketballwomantoilettied to a chairchild in perilbathshot in the foreheadparkattempted murderorganized crimedangerkeyperson on fireproduct placementrace against timetough girllightninglong takemanipulationinjectionbasementtrapdie hard scenariosilencerstrong female characterpizzaeyeglassesfalling down stairssyringemedicinehypodermic needleheavy rainsociopathlifting someone into the airsecurity cameranosebleedvideotapeswat teampsychostrong female leadlaserhomecompassionmasked manfemale warriorbarefootburglarpillssurveillance cameraburglarykickingpower outagestabbed in the neckmillionairedeath threatsafeblood on shirtone dayrainstormsiegerefrigeratorintruderlooking at self in mirrorduct tapeextortiondivorceebenchtank toppsycho killerreal estate agentbreak inrobberminimal castcentral park manhattan new york cityspiral staircasestaircasereference to the beatlestween girlscooterbroken mirrorburnt facemind gamefemale heroski maskconscienceseizurepark benchhitchcockiansick childcircular staircasefemale victimlocked in a roomdiabetesdragging a bodyman hits a womangas explosionintercomsecret roomcat and mouselifting female in airhidden moneysecurity systempsychological manipulationpower drilldiabeticgun held to one's headsodarobbery gone awrysafecrackerhidden truthsingle set productionsanctuaryinsulinsledge hammermorse codemoving vantooldoor lockfalling off a balconyskylightbattered womandolly zoomcrushed handclassified adattacked with a knifecontainmentsosbotched robberychronic illnesselectric drillshot in sequencefloor safevideo screenwalking on broken glassbearer bondsbrownstoneupper west side manhattan new york citydiabetic childpropanepanic roomalone against the oddsmotion detectorrazor scooterheart rate monitorhome security systemhypoglycemiareference to joe pescihome securitylow blood sugarsafe roomescrow (See All) |
This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)
Subgenre: | independent filmcult filmconspiracyb horrorpsycho thrillerpolitical thrilleramerican horrorpolitical conspiracy |
Themes: | claustrophobiasurveillancepsychopathmurderdeathpoliticstorturefilmmakinginvestigationparanoiaguiltsadismevilexploitationtechnology |
Mood: | neo noirnightslasher |
Locations: | hospitaltrainsnowcityrooftoptrain stationpennsylvaniacar in water |
Characters: | doctorprostituteserial killerdetectivephotographerhitmankillervillainslasher killerserial murderermurder of a prostitute |
Period: | 1980swinter |
Story: | woman in jeopardywitnessfemale nuditynuditybare breastsfemale frontal nudityflashbacktwo word titlebare chested maleguntitle spoken by characterknifechasesurprise ending β¦showerwoman on topcar accidenturinationrescuewatching tvlingerievoyeuralcoholtelephonereportercleavageassassindisguisebridgestabbed to deathpoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upevil manattempted rapehairy chesttragic eventsplit screenfilm within a filmmurdererfireworkscult directorgraffititrustkillingmaniactape recorderrecordingmutilationcaught having sexcrying womanmovie theaterphone boothpsychofroggrindhousevictimparadedead womanmale underwearwatching televisionrampagedamsel in distressveteranslaughtermustachephiladelphia pennsylvanialonerbody countbriefscharacters killed one by onedead woman with eyes openkilling spreereckless drivingpsychoticpolitical corruptionpsycho killerfilm industryinterrupted sexserial murderpsychopathic killerbad guymadmantruthsubway stationtelevision newsblackoutmotel roomhomicidal maniacrestroomgovernortv reporterslashingwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathsadistic psychopathtapepsychotronic filmmurder spreetelevision reporterdisturbed individualbroken bottlegrindhouse filmwiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepydisturbingred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esquesadisticaudio recordingdrive in classicwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j β¦ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | independent filmcult filmslasher flicksurvival horrorsadistic horror |
Themes: | claustrophobiahome invasionpsychopathmurderkidnappingmarriageinfidelitytortureescapeextramarital affaircancerinsanityself harm |
Mood: | gorecar chaseslasher |
Locations: | hospitalhotelurban setting |
Characters: | husband wife relationshippolicefather daughter relationshipdoctorserial killerdetectivephotographerhostagekillerpolice detectiveself mutilation |
Story: | psychological tortureviolenceone word titleflashbackgunsurprise endingpistolcorpseshotguncamerasecretbathroomrevolverbound and gaggedthroat slitting β¦stabbed to deathtoiletchild in perilpolice officer killedclownpuppetperson on firepoisonfirst partburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappeddisembowelmentbooby trapbody countextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorlocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
A young man receives a call on his cellular phone from a woman who says she's been kidnapped, and thinks she's going to be killed soon, along with her husband and son who the kidnappers have gone after next. The catch? She doesn't know where she is... and his cell phone battery might go dead soon.
Subgenre: | martial artsconspiracy |
Themes: | claustrophobiahome invasionpsychopathmurderkidnappingmarriageescapeparanoiapolice corruption |
Mood: | car chase |
Locations: | beachschoolswimming poollos angeles californiataxiairportpolice stationrooftopschool bus |
Characters: | husband wife relationshipfather son relationshippolicemother son relationshipteacherhostagelawyerartistsecurity guardpolice detectivepolice sergeant |
Story: | witnessbloodviolenceone word titlefightchasepistoltelephone callcell phoneshootoutshot to deathblood splatterfistfightcar accidentshot in the chest β¦slow motion scenebrawlheld at gunpointrevolvershot in the backfoot chasestrangulationvideo camerawomanexploding carchild in perilpolice officer killedshot in the legpay phoneproduct placementrace against timebankpolicewomandie hard scenariocabinballoonlifting someone into the airwalkie talkievideotapevictimhonorstealing a cartelescopeconstruction siteamusement parkatticone daypierbreak inhigh school teachershot in the neckresponsibilitymurder witnessfilmed killingtow truckmetal detectorvideo footagecarjackingrealtordirty coppeep hole555 phone numberbubbleeye witnessauto theftfamily in dangerremadephone conversationsledge hammerjackhammerfishbowldistress signalbiology teacherthrown to the floorfacial maskwitness to a crimeauto impound lotdesk sergeanthousehold help (See All) |
Robert Dean is a mild-mannered lawyer who works in Washington D.C. He is on the trail of a kingpin named Pintero. Meanwhile, a politician named Thomas Reynolds is negotiating with Congressman Phillip Hammersley about a new surveillance system with satellites. But, Hammersley declines; Reynolds has H β¦ammersley killed, but the murder is caught on tape, and the taper is chased by Reynolds' team of NSA agents. The guy must ditch the tape, so he plants it on Dean (unbeknownst to Dean). Then, the NSA decides to get into Dean's life. That is when Dean's life began to fall apart all around him, with his wife and job both gone. Dean wants to find out what is going on. Then, he meets a man named "Brill" who tells him that Dean has something that the government wants. Dean and Brill formulate a plan to get Dean's life back and turn the tables on Reynolds. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypolitical thrillerpolitical conspiracy |
Themes: | claustrophobiasurveillancemurderfriendshiprevengemarriagechristmaspoliticsgangstervoyeurismcorruptionparanoiablackmailmafia |
Mood: | neo noir |
Locations: | restauranthelicopter |
Characters: | husband wife relationshipfather son relationshipafrican americanlawyer |
Period: | 1990s |
Story: | witnessviolencedogkisschasefireshootoutshot to deathblood splattershot in the chestcomputercatgunfightbombrunning β¦f wordfalse accusationman with glasseson the runpay phonefugitivecover upespionagewashington d.c.machismoidentityelectronic music scorelawexploding buildingvideotapemexican standoffinnocencesurveillance cameraconfrontationframe upevidencewisecrack humorgadgetethnic slurpolitical corruptionsatellitecartoon on tvtimebombcomputer crackerintelligenceforeplaymiddle classvideo footagebaltimore marylandcongressmangovernment corruptionidentity theftnsaconspiracy theoristprivacyfreight trainlaundry drying on clothes linelethal injectionstolen identitypolitical cover upwiretapemployee dismissalvideo voyeurismtunnel chase scenenational security agencysecret hideawayrecording the villaindistrust of governmentechelondisbelieving authorities (See All) |
Subgenre: | martial artsmelodrama |
Themes: | home invasionsurveillancemurderdeathrevengemoneydrunkennessescapegangsterdeceptionlonelinessguilthomelessness |
Mood: | neo noirambiguous ending |
Locations: | restaurantchurchlondon englandapartmentbrothelchinese restaurant |
Characters: | policeprostitutesoldiertough guyex husband ex wife relationshipchinesepimphomeless manex soldier |
Story: | assumed identitythreatened with a knifeviolenceone word titleflashbackmale rear nuditybare chested malefightphotographtitle spoken by characterexplosionpartyknifechasesurprise ending β¦pistolbeatingcorpseshot to deathfistfightmachine gunshot in the chestpunched in the facecamerawritten by directorbrawllettervomitinghand to hand combatanimal in titlehallucinationbritishrevolverf wordfoot chasedeath of friendmontagethroat slittingmixed martial artsnunanti heronews reportshot in the legon the runorganized crimecharacter repeating someone else's dialoguebeaten to deathfugitivekicked in the faceshot in the shoulderpremarital sexshot in the armballetnewspaper headlinesubtitled scenecrime bossanswering machineshavingsupermarkethead buttlooking at oneself in a mirrorscene during opening creditsred dressexploding buildingphone boothchefirishsadomasochismart gallerystreet lifethughaunted by the pastswitchbladepunched in the stomachfalling to deathpost traumatic stress disorderafghanistanspecial forcespunched in the chestdark heroassault riflebody landing on a cartuxedobarbecuelonerlooking at self in mirrorbroken armvodkahuman traffickingbag of moneyarmored carchild molestationdrunken mansexual violencedroneyoung version of characterconventtriadbankerman punching a womanhanged manmoney launderingpizza deliverybriton abroadbird in titlefacial scarrighteous ragecockney accent555 phone numberpizza delivery boypretending to be gaymoney falling through the airex special forceshomeless womankicked in the chestgymnastenforcerthrown from heightfish marketplaying against typeawolafghanistan veteransoup kitchenhummingbirdsoho londonthrown from a rooftopfemale crime bosssex with nunaerial reconnaissancehelmand province afghanistan (See All) |
Wendell Rohr is a torts lawyer taking on the gun lobby. Rankin Fitch is the jury consultant for the Defendants and between them the battle is for the hearts and minds of the jury. But there is someone on the inside. Nicholas Easter is a juror with a girlfriend, Marlee, on the outside. they have a pa β¦st ..... and their own agenda. (Read More)
Subgenre: | black comedysuspenseconspiracycourtroom drama |
Themes: | blindnesshome invasionsurveillancepsychopathmurderdeathrevengesuicidemoneybetrayaldrinkingdeceptionrobberycorruptiontheft β¦death of fatherparanoiablackmailabortionjustice (See All) |
Mood: | rainmurder suicide |
Locations: | barrestaurantchurchsmall townbustaxiapartmentcourtroommoteltaxi driverfire truckschool shooting |
Characters: | husband wife relationshipfather son relationshipmother son relationshipafrican americanchildrensingerpolicemanphotographerlawyersister sister relationshipthiefwaitresssecurity guardalcoholicprofessor β¦secretary (See All) |
Story: | breaking and enteringsexbased on novelbloodgunfightcigarette smokingphotographsingingknifechasesurprise endingtelephone callfirecell phone β¦songbeatingfistfightfoodslow motion scenecomputercameradrinkarrestbrawlsecretshootingriflebirthdaycar crashcafebathroomprayertelephonefoot chasecandleambushdisguiseambulancebasketballwomanmontageeatingwidowsuicide attemptdinertoiletweaponjudgetrialdouble crossfemme fatalenews reportgunshotflash forwardattempted murderprologueattackpay phoneumbrellaundercoverrace against timestatuebaseball batcourtmanipulationpursuitdeath of husbandmanagerarsonblack americanfreeze framebirthday cakesabotagesupermarketrevelationheavy rainlawcrucifixamerican footballvideotapevictimhome moviefollowing someonefalse identitystreet lifedrug overdosemechanicwatching televisionguardtarget practiceattorneycynicismnew orleans louisianashopping mallco workerblack and white scenestabbed in the legassault riflelipstickbody landing on a cargasolineblind mannewspaper clippingmoral dilemmapatriotismmedia coveragefirefightersouthern accenthit with a baseball batintimidationbeing followedgothbriberyvideo tapeset upohioabuse of powercockroachfake identityarms dealercameramanjurylawsuitdemocratasthmaassistantmailoffscreen killinggun violencesense of smellwoman kills a manhome videonewscastrealtorhappy birthday to yougoth girlceoman hits a womanmiscarriage of justicewiretappingindianawater fountainex marinecourthouseprotestorbaptisthappy birthday911job promotioncourt trialbilingualnecktiestreetcarman fights a womansleeping pillssuitcase of moneytv crewjudicial systementrapmentcajuncourt casestockbrokerjudicialjudiciarycrisis of consciencewearing a sound wirelegal systemcincinnati ohiogun controlsaxophone playercourt hearingskeet shootingmoney transferpledge of allegiancejurorfighting the systempunk rock girlmachine pistolhit with a bottlesmashing a car windowcourt of lawlitigationmp3 playerex u.s. marinecayman islandsjury dutyarms tradeschool playgroundfemale security guardjury roomtrolley carbrokerage firmjury tamperingplaintiff (See All) |
A small, seemingly innocuous plastic reel of film leads surveillance specialist Tom Welles down an increasingly dark and frightening path. With the help of the streetwise Max, Welles relentlessly follows a bizarre trail of evidence to determine the fate of a complete stranger. As his work turns into β¦ obsession, he drifts farther and farther away from his wife, family and simple life as a small-town private eye. (Read More)
Subgenre: | cult filmsuspenseconspiracyfish out of waterpsycho thriller |
Themes: | home invasionsurveillancepsychopathmurderdeathrevengesuicidekidnappingmoneybetrayalprisonfeartortureescapefilmmaking β¦investigationdeceptionangercorruptionbrutalityobsessionparanoiasadismevilhollywoodcrueltypanicdeath of daughter (See All) |
Mood: | neo noirdarkness |
Locations: | hospitalnew york citybarswimming poolcemeterylos angeles californiabustaxiairportwheelchairmotelstrip clubbrothelfire truck |
Characters: | husband wife relationshiptattooprostitutedetectivebabyhostagelawyerfilm directorpimp |
Period: | 1990s |
Story: | threatened with a knifesexfemale nuditynumber in titlebloodmale nudityviolencemale frontal nuditymale rear nuditybondagebare chested malegunfemale rear nudityfight β¦female full frontal nuditycigarette smokingnipplesphotographtitle spoken by charactermale full frontal nudityknifechasesurprise endingpistoltelephone callfirecell phonebeatingcorpsedigit in titleshot to deathblood splatterfistfightshot in the chestpunched in the facebrawlbare buttfalling from heightmasklettershootingshowdownheld at gunpointsunglassesinterrogationprostitutioncriminalstrippertelephoneshot in the backf wordfoot chasegay slurbound and gaggedstrangulationambulancemansionthroat slittingimpalementwidowstabbed to deathprisonerstabbed in the chestman with glassesnundisarming someoneacronym in titledouble crosslimousinelibrarybinocularsbeaten to deathdangerstabbed in the backsuburbperson on firepay phoneundercovermissing personcover upevil mankicked in the facelightningdiaryshot in the shoulderbodyguardthreatpremarital sexcharacter says i love yousilencerarsonrunawayprivate detectiveeavesdroppingpornographyuzianswering machineundergroundburned aliverevelationheavy raintape recordersociopathscene during opening creditssexual abuserecordingstabbed in the stomachhollywood californiakicked in the stomachvideotapedesperationsadomasochismbrooklyn new york cityfaked deathhomicidemasked manmechanicduct tape over mouththugcrossbowcynicismhatredkickingstabbed in the neckheadphonesmiami floridabutlersenatorpunched in the chestsafethrown through a windowbookstoreknife fightfilm producerrainstormgasolineburned to deathmasked killerprivate investigatorsouthern accentdead girlimpersonating a police officerpervertabandoned buildingmysterious mansidekickporn magazineshot in the neckpistol whipvideo storepictureporn industryloss of daughterbrooklyn bridgesexual perversionfilm projectormasochismclimbing through a windowdegradationmessageunderworldbody in a trunkpornographercrashing through a windowsnuff filmpalm treekicked in the headstabbed in the shoulderfilmed killingdecadencegarbage truckknife murderwatching a videosex shopprivate eyecleveland ohiocriminal investigationabandoned warehousewiretappingguillotinedepravityvinylred light districtmistreatmentsuper 8mmsexual sadismsexual torturesexual crueltyfilm reelporn directorvideotaped sexfiendviolent sexwall safemicrofilmpornographic videodeviant sexunusual sex act8mmpainful sexporno shopsadomasochism clothingback alleyadult bookstoregimp maskhall of recordsmeat processing plantharrisburg pennsylvania (See All) |
The film starts in the early 1980s. Young Martin Asher took a bus for Canada. He meets another teen on the bus Matt Soulsby. When the bus broke they decided to rent a car and drive to Seattle. On the road the car gets a flat tire, and Matt starts changing the tire Martin comments on how he and Matt β¦are about the same height and he quickly pushes Matt in the way of an oncoming truck causing a huge accident where Matt and the driver both die. He took Matt's guitar and left singing like Matt did. Twenty years later, an FBI profiler, Illeana Scott comes to Canada to help hunting down a serial killer Martin Asher who killed multiple men and lived by their identities. Martin's mother claims that she saw Martin in Quebec city and she tells the police that Martin is evil. The police also has an eyewitness James Costa who saw Asher kill his last victim... (Read More)
Subgenre: | suspensepsychological thriller |
Themes: | home invasionsurveillancepsychopathmurderdeathrevengekidnappingbetrayaljealousyfearescapeinvestigationdeceptionredemptionmurder investigation β¦police investigationmurder of a police officer (See All) |
Mood: | gorerainneo noircar chasenightdarknesspoetic justice |
Locations: | hospitalbarrestauranttrainhotelsnowbathtubbusnightclubelevatorapartmentpolice stationfarmpolice cartrain station β¦singing in a carpennsylvaniabus station (See All) |
Characters: | policemother son relationshippolice officerserial killerdetectivehostageartistsecurity guardpolice detectivefrenchamerican abroadpolice chaseyounger version of characterfrench canadiancoroner β¦art thief (See All) |
Period: | 1980s2000syear 2004year 1983 |
Story: | assumed identitythreatened with a knifewitnessfemale nuditybased on novelbloodfemale frontal nudityflashbackbare chested malecigarette smokingnipplesphotographtitle spoken by characterexplosion β¦knifechasesurprise endingpistolshowerfirecell phonebeatingcorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapslow motion scenepaintingshowdownheld at gunpointsunglassescar crashinterrogationsex standing uphandcuffsrevolverguitarcriminalf worddecapitationsurvivalfoot chasegay slurflashlightambushstrangulationdisguisemansiondrug dealermontagethroat slittingbridgestabbed to deathstabbed in the chestexploding carsevered headman with glassesdisarming someonedrawinghit by a cardouble crosspolice officer killednews reportcoffeebartenderflash forwardattempted murdergravedrug addictstalkercharacter repeating someone else's dialogueprologuefbiumbrellamistaken identityrace against timedebtcover uptough girlskeletonscaramerican flagbodyguardstalkingdeath of sonpremarital sexfireworksnewspaper headlinesubtitled scenegaragefreeze framestrong female characterpizzamaniacanswering machinemass murdergothicheavy rainmutilationsecurity camerawalkie talkiefbi agentmorgueswat teamimpersonationsevered handcovered in bloodskullstrong female leadart galleryfestivalfalse identitypresumed deadcrime scenesevered fingerconstruction sitehit in the crotchimpostorsexismescape attemptblack and white scenejumping through a windowautopsyblood on shirtdisfigurementsuspectdark pastlens flarebruisepolice inspectorkilling spreeferryflat tirelaptop computerdrifterinsecurityold dark housescene before opening creditsspiral staircasefake identityfarmhousewhodunitboy with glassestwin brotherpolice captainhead bashed inhit by a truckstakeoutscene of the crimecrashing through a windoweyeballwoman kills a manburnt bodytwo way mirroroverturning carfatal attractionhiding under a bedtragic pastmatricidepool of bloodbulldozercar rolloverfingerprintmass murdererfinger gunbilingualisminnocent person killedextreme close upsecret roomman slaps a woman555 phone numberred herringstabbed with scissorstragic villainmontreal quebecidentity theftmusic concertgarroterainy nightferry boatart dealerexhumationfederal bureau of investigationhidden doorthrown through a windshieldforensic evidencekilled in an elevatorstolen identitywearing a sound wirebus tripdriving in the rainpicking a lockribbondentureshit on the head with a rockson murders motherfaked pregnancyart showstitchesteapotrunaway teendecomposed bodyemployee dismissalsurgical stitchesfbi profilercanadian flaglock picking (See All) |
Will Graham is a former FBI agent who recently retired to Florida with his wife Molly and their young son. Graham was a 'profiler'; one who profiles criminal's behavior and tries to put his mind into the minds of criminals to examine their thoughts while visiting crime scenes. Will is called out of β¦his self-imposed retirement at the request of his former boss Jack Crawford to help the FBI catch an elusive serial killer, known to the press as the 'Tooth Fairy', who randomly kills whole families in their houses during nights of the full moon and leaves bite marks on his victims. To try to search for clues to get into the mind of the killer, Will has occasional meetings with Dr. Hannibal Lecktor, a charismatic but very dangerous imprisoned serial killer that Will captured years earlier which nearly drove him insane from the horrific encounter that nearly cost Will's life. With some help and hindrance, Will races against the clock before the next full moon when the 'Tooth Fairy' will strike again. Elsewhere, a local photographer named Francis Dollarhyde, the killer that Will is looking for, struggles to stay undetected while seeing a hope of redemption when be begins a relationship with a blind woman who is not aware of his double life. (Read More)
Subgenre: | independent filmcult filmsuspense |
Themes: | blindnesshome invasionpsychopathmurderdeathkidnappingprisontortureinvestigationbrutalityguiltinsanitysadismcannibalismmadness β¦murder of a police officermurder of family (See All) |
Mood: | goreneo noirslasherstylization |
Locations: | beachforestairplanewoodswheelchairpolice station |
Characters: | husband wife relationshipfather son relationshippolicemother son relationshipboyfriend girlfriend relationshiptattooserial killerdetectivehostagehomosexualityvillainpsychiatristmysterious killer |
Period: | 1980s |
Story: | visually impaired personpsychological torturebased on novelbloodviolenceone word titlebare chested maleguncigarette smokingphotographtelephone callcell phoneshootoutdream β¦corpseshot to deathblood splattercar accidentmirrorshot in the chestshotgungunfightkissingshootingshowdownheld at gunpointrevolvercriminaltelephonegood versus evilgay slurjournalistambushstabbed in the chesttied to a chairman with glassescultanti heroshot in the legstalkerhotel roomfbiperson on firemistaken identityrace against timeevil manstalkingtrappremarital sexcharacter says i love younewspaper headlinewashington d.c.freeze framesupermarketelectronic music scoregothictape recordersociopathfbi agentvideotapefloridapsychohome movieparking garagecrying manwhite housemental institutioncrime scenepump action shotguncannibalgash in the facemental hospitalpsychotronicmiami floridapolice officer shotjumping through a windowblack eyemurder of a childdisfigurementtigernotekilling spreephoneburned to deathholding handsman cryingserial murderpsychopathic killerveterinarianhuman monsterpolice officer shot in the chestbroken mirrorbearded mankiss on the lipsscene of the crimeblind womanpalm treepsychoanalysisdarkroomwatching a videoman on firebaltimore marylandsadistic psychopathtoilet paperbreaking a mirrorpsychosisnewspaper reporterwoman in dangerdepravityman in a wheelchairslide showtalking to oneselfset on fireposing for a photographcriminal mastermindcoming out of retirementst. louis missouriliterary adaptationweirdofamily in dangerslide projectorends with freeze frameforensicsphone conversationfamous songoedipus complexgrocery shoppinganthropophagusneonreference to the new york timesvoice recordingtwo killerscharacter appears on front page of a newspaperreference to houdinicode breaking8 trackreference to harry houdiniprofilerclimbing a ropefamily photohomicide investigationlighting a cigarette for a womantabloid reporterfirearm pointed at the cameraphoto labphotograph in newspaperreference to william blakefbi profilerhannibal lecterface slashedgin and tonichaving picture takenbalding mannote read aloudfax transmissioncamera flashmalevolencevhs videoex fbi agentlighting a cigarette for someonepreventing a murderforensic psychiatristmuzzle flashphreakingpunching one's fist into a mirrorred dragontied to a wheelchair (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | independent filmcult filmblack comedydark comedypsycho thrillersurvival horroramerican horror |
Themes: | claustrophobiahome invasionpsychopathmurderdeathkidnappingdeceptionincestinsanitymental illnesssadismevilgreedcannibalismwealth β¦starvation (See All) |
Mood: | goresatireslasherdarknesssocial satire |
Locations: | los angeles californiaslum |
Characters: | policefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipvillainterrorkiller dog |
Period: | 1990s |
Story: | breaking and enteringbloodviolencedogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathblood splattershot in the chestface slapshotgunbirthday β¦flashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletonbasementcharacter says i love youcult directorterminal illnessmaniacfalling down stairsfireplacekilling an animalgothicscene during opening creditsragemutilationstabbed in the stomachspiderpsychosevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordpsycho killergothpervertserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
After witnessing the brutal murders of a convenience store owner and his son, firefighter Jeremy Coleman barely escapes with his life. As he is forced to testify against the crime lord, Hagan, he is placed in the witness protection program under the watch of the U.S. Marshals. When his new identity β¦becomes compromised Jeremy is forced to take an unexpected course of action in order to get his life back and save the lives of those he loves. (Read More)
Subgenre: | independent filmmartial artssuspense |
Themes: | murderdeathrevengekidnappingchristmasbetrayalfeartortureescapegangsterinvestigationdeceptionrobberyangerbrutality β¦justicepolice investigationnear death experience (See All) |
Mood: | car chase |
Locations: | hospitalhotelairportapartmentpolice stationpolice carcitymotelgas stationfire truckabandoned factoryfire stationsex in a hotel |
Characters: | african americanboyfriend girlfriend relationshipdoctortattoopolice officerdetectivepolicemanhostagelawyertough guywarrioraction herohitmaninterracial relationshippolice detective β¦villainsnipersniper rifleself justice (See All) |
Period: | 2010s |
Story: | assumed identitywoman in jeopardythreatened with a knifewitnessbloodviolenceflashbackbare chested malesex scenekissfightinterracial sexphotographexplosionknife β¦chasethree word titlepistolshowerfirecell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facegunfightbrawlfalling from heightshowdownheld at gunpointbeerhand to hand combatinterrogationrevolverfightingcriminalshot in the backf wordsurvivalfoot chaseorphanassassinbound and gaggedgangambushaxedisguiseambulancemontageimpalementmixed martial artsprisonerjudgeanti herodisarming someoneone man armydouble crossvannews reportshot in the foreheadracial slurflash forwardattempted murderorganized crimebeaten to deathdangerprologuelocker roomperson on fireproduct placementrace against timeevil mantough girlbaseball batopening action scenestreet shootoutfemale removes her clotheslaptoppremarital sexdie hard scenariotied upprofanitysilencerlove interestkissing while having sexvigilantearsonhenchmancrime bosssurgeryuzianswering machinesabotageburned alivehead buttassassination attemptelectronic music scoresociopathrepetition in titlejail cellbeardhammeraction heroinebald mangun battlefemale warriorthugcrime sceneinterracial romancereverse footagetarget practicesevered fingerfight to the deathhatredmercilessnessnew orleans louisianaconvenience storegunshot wounddeath threatfalling to deathblack bracigarette lighterstabbed in the legpunched in the chestbuildingtough copgasolinedark pasttied feetlens flareaxe murderethnic slurburned to deathblack bra and pantiesshot multiple timesfirefightersouthern accenthit with a baseball batfiremanshot through a windowfinal showdownscene before opening creditsarms dealermotel roomglockhired killerinterracial kissbody in a trunkcomputer hackervigilante justicedistrict attorneyaction violencebullet woundtwo way mirrorshot in the footinterracial couplerighteous ragetragic pastwoman shotcockney accentwitness protectiongang leaderfemale gunfighterabandoned warehouseimmolationvillain arrestedmale vomitingtear on cheekarm slingburning buildingfederal agentcrime lorddriver's licensehands tiedrunning for your lifephoenix arizonau.s. marshalaliasfemale in bra and pantiesoxygen maskbroken fingerlong black hairthrown through a windshieldnight cityscapeman carrying a womanchop shopfire hosemale in a showeralley fightpolice lineupslide locked backsprinkler systemstorage unitwoman murders a manfemale fbi agentaxe throwingwoman removes her clothesshooting a womantaseredbuilding firelong beach californiaaryan brotherhoodnailsfake mustachestuffed in a car trunkshooting lessonsymbol cut into skin (See All) |
Subgenre: | independent filmcult filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller |
Themes: | home invasionpsychopathmurderdeathfriendshiprevengekidnappingfeartortureescapebrutalityparanoiainsanitypaniccannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | goreslasher |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | psychological torturethreatened with a knifesexbloodviolencecigarette smokingexplosionknifechasesurprise endingpistolfirecrying β¦cell phonebeatingcorpseshot to deathblood splattercar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partwaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhouseroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
In this English-language remake of a deconstruction in the way violence is portrayed in the media, a family settles into its vacation home, which happens to be the next stop for a pair of young, articulate, white-gloved serial killers on an excursion through the neighborhood.
Subgenre: | independent filmpost modern |
Themes: | home invasionpsychopathmurderdeathkidnappingvoyeurisminsanityhumiliationmurder of family |
Mood: | breaking the fourth wallhorror movie remake |
Locations: | kitchen |
Characters: | husband wife relationshipfamily relationshipsboyserial killerhostage |
Story: | psychological torturebloodviolencebondagedogknifechasesurprise endingpantiescryingcell phonecorpseshot to deathblood splattershot in the chest β¦face slapremakeshot in the headshotgunvomitingvoyeurprayertelevisioncleavagebound and gaggedstabbed to deathwhite pantiesscantily clad femaleacronym in titlechild in perillooking at the cameradrowningtalking to the camerapainproduct placementlong takefemale removes her clothestied upgirl in pantiesmaniackilling an animalnipples visible through clothingeggsociopathlifting someone into the aircaptivesocial commentarybroken legremote controlball gagpunched in the stomachdark humorhousewifemurder of a childtitle at the endbettied feetbroken armduct tapedead dogbarking dogbag over headforced to stripdockdead animalfemale removes her dressdead childrengolf clubsailboatsailingdegradationdouble barreled shotgunmind gameteasingwetting pantsupper classwoman in lingeriecountry housetied up while barefootwoman smokerleg woundcat and mousebloody body of a childeggsglovechild with a gunno survivorshair dryerchild killergolden retrieverraincoatgolf ballcarpetpliersgolferno musicduct tape gaghit with a golf clubmurderer duoremake by original directorlifting a male into the airchain link fencechild shot in the headsummer houseweird behaviorwading in waterrewindcar stereoanti violencerandom violencebroken eggsail boatbound hand and footwire cuttersleg splintmurdered pet (See All) |
Nick Wells, a professional criminal, decides to leave the business for good, since he nearly got caught on his last job. His plan is to live in peace with his girl Diane, running his Montreal jazz club. Soon afterward, Max, his good friend and financial partner, comes along with an offer Nick can't β¦refuse: A historical and priceless French scepter has been discovered while being smuggled into the country. It is now under massive surveillance in the Montreal Customs House, and soon to be returned to France. Nick has to team up with Max's man inside, the young, talented and aggressive thief Jack Teller to get the precious item. Only one question remains: Who will trick whom out of their share? (Read More)
Subgenre: | black comedysuspenseheistcaper |
Themes: | home invasionsurveillancemoneybetrayalescapedeceptionrobberymental illness |
Mood: | rainneo noirnight |
Locations: | restaurantswimming poolbusnightclubairportelevatorurban settingcitytunnelsewerbus station |
Characters: | boyfriend girlfriend relationshipthiefinterracial relationshipsecurity guardfrench canadian |
Story: | assumed identitybreaking and enteringbare chested maledancingtitle spoken by characterchasesurprise endingpistolfirecell phonebeatingheld at gunpointrunningmarijuanapiano β¦revolverf wordfoot chaseflashlightmansionmapanti heroradiodouble crossvoice overnews reportmarriage proposalnecklacecoffeeparkorganized crimechampagnerace against timestatuedebtbaseball batbodyguardbasementgaragetv newspot smokingwarehousesecurity camerawalkie talkieswat teamwristwatchphone boothlaserfalse identityscamthuginterracial romancejanitorburglarexplosivesurveillance cameraburglarypartnerrowboatsafecon artistlonerlaptop computerhit with a baseball batcoffee shopjewelryhackerquebecalarmestatecomputer crackerstewardesscomputer hackermacguffinski maskquarantinecodemetal detectorinterracial couplemugshotgarbage truckimplied sexvideo gameone last jobjewel thiefwhite male black female relationshipjazz clubcareer criminalsafecrackerwine cellarblowtorchblueprintjewel theftfurnacelunchboxinfra redjewelry heistperiscopecomputer nerdjazz singerliquid nitrogenpersonal computerriding a busmaster thieftoolsjewel heistu.s. canadian borderjazz combonorth americacrime ringscepterspy cameradishonornikon cameramaintenance manvisceralcutting torchmentally retarded personjewelry theftflip phoneinside manschematicsecurity codeunderground passagewaymontreal canadahanging from ceilingpaint thinnerreverse engineeringcomputer geekdolly shot (See All) |
When Nick Parsons appears to be murdered his wife Libby is tried and convicted. Six years later Libby is paroled and with the help of Travis Lehman (her parole officer) she sets out to find her son and the truth behind the "murder".
Themes: | psychopathmurderrevengebetrayalprisonfearescapepanic |
Mood: | goreneo noirmurder trial |
Locations: | hospitalbarbeachschoolswimming poolcemeterynightclubpolice stationfarmpolice carcourtroomsan francisco californiacar in water |
Characters: | husband wife relationshipfather son relationshippolicemother son relationshipdoctorsingerfemale protagonistteacherpolice officerlawyersheriffpolice chasepolice arrest |
Story: | assumed identitybreaking and enteringsexfemale nuditynuditybloodtwo word titlesex scenecigarette smokingdancingphotographtitle spoken by character β¦singingknifechasepistolshootoutshot to deathshot in the chestshot in the headwatching tvcomputercameraarrestpaintingshowdownheld at gunpointtearshandcuffsislandrevolverf wordfoot chasesoccerambulancemontageprisonerinternetjudgetrialcoffinfishingsearchnews reportcoffeebartenderon the rungunshotfugitivemistaken identitymoaningevil manknocked outnewspaper headlinesociopathbabysitterjail cellbuttocksfaked deathcarnivalremote controlprison guardmisunderstandingnew orleans louisianaframe upwomen's prisonevidenceboarding schoolhorse and carriageinjusticeferryframed for murdermusic bandauctionburied alivetestimonyset upsouthern u.s.sailboatsailingjuryframedtape recordinghandcuffedwrongful convictiongeorgiainmategravestonegolden gate bridgefundraiserwrongful arrestcryptcar salesmaninsurance frauddecoyfuneral processioncurfewreference to pablo picassocriminal mastermindmausoleumfalse nameferry boatart dealerparole officercoast guardcajunmardi grasconvicted felonhalfway houseparoleeinsurance policycanoeingoil paintingparole hearingfrench quarter new orleansbeneficiarylifesaverreference to marc chagallburied moneyreference to wassily kandinskyreference to joan miroseemingly widowedwomen's correctional facility (See All) |
Frank Leone is nearing the end of his prison term for a relatively minor crime. Just before he is paroled, however, Warden Drumgoole takes charge. Drumgoole was assigned to a hell-hole prison after his administration was publicly humiliated by Leone, and has now arrived on the scene to ensure that L β¦eone never sees the light of day. (Read More)
Subgenre: | independent filmblack comedyconspiracymelodrama |
Themes: | surveillancepsychopathmurderfriendshiprevengesuicidekidnappingbetrayalprisontortureherodeceptioncorruptionwrestlingsadism β¦crueltyself sacrificeprison escapeescape from prison (See All) |
Mood: | rainneo noirdarkness |
Locations: | carsnowboatwheelchairprison fightprison violenceprison brawlprison yardescape tunnel |
Characters: | boyfriend girlfriend relationshiptattoohostagetough guywarrioraction herobullybetrayal by friendblood revenge |
Period: | 1980s |
Story: | psychological torturethreatened with a knifebloodmale nudityviolenceflashbackdogbare chested malefightcigarette smokingphotographexplosionknifechasepistol β¦firebeatingblood splatterfistfightmachine gunshotgunkissingbrawllettershowdownheld at gunpointinterrogationjailhandcuffscriminalf wordfoot chasebasketballdeath of friendmontageimpalementfootballprisonerstabbed in the chestanti herodisarming someonecigar smokingnecklaceracial slurstabbed in the backelectrocutionbaseball batringmanipulationgymisolationgaragehatefreeze framemachismocaptainsecurity camerajail cellwalkie talkiemale bondingswat teampsychointerracial friendshipcrushed to deathmale underwearmechanicprison guardnew jerseyitalian americanhit in the crotchmanhuntpower outagem 16escape attemptmentorconvictprison cellrelease from prisonethnic slurcafeteriaabuse of powercomic reliefbully comeuppanceinformantweightliftingburnt faceescaped convicthandcuffedford mustangbeltinmateboxing ringcorrupt officialelectric chairprison wardensolitary confinementarmoryknife held to throatstrong manwardenconprison riotcigarescaped prisonernightsticksnitchinfirmarypenitentiary20 year oldsleep deprivationprison gangmustangprisoner transportlucky charmphysical torturelockuppersonal vendettacorrectional officersadistic wardensadistic prison guardshankbright lightelectric cableinmatesthreats and intimidationelectrical wirecorrectional institutionbuckleprison escape plancons (See All) |
Professional photographer L.B. "Jeff" Jeffries breaks his leg while getting an action shot at an auto race. Confined to his New York apartment, he spends his time looking out of the rear window observing the neighbors. He begins to suspect that a man across the courtyard may have murdered his wife. β¦Jeff enlists the help of his high society fashion-consultant girlfriend Lisa Freemont and his visiting nurse Stella to investigate. (Read More)
Themes: | claustrophobiasurveillancemurdervoyeurism |
Characters: | husband wife relationshipdetectiveamateur detectivepolice lieutenant |
Story: | breaking and enteringbare chested malecamerasuicide attemptbinocularssuspicionclass differencesdismembermentcomposerpeeping tombroken legapartment buildingwedding ringsongwriterbride and groom β¦flash cameraworld war two veteranballet dancergreenwich village manhattan new york cityphotojournalistinvalidtraveling salesmanheat waveanonymous telephone callleg in castinnocent bystanderdeath of a pettelephoto lensdance practicereference to general motorsback scratcherreference to reader's digest (See All) |
Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh β¦ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypost modern |
Themes: | home invasionsurveillancepsychopathmurderdeathloverevengebetrayaljealousydrunkennessescapeinvestigationdeceptiondeath of mothergreed β¦murder of a police officer (See All) |
Mood: | goresatirehigh schoolslasher |
Locations: | hospitalsmall townelevatorpolice station |
Characters: | husband wife relationshippoliceteenagerfemale protagonistserial killersheriffcousin cousin relationshipex boyfriend ex girlfriend relationshipself mutilationaunt niece relationshipself referentialshooting a police officer |
Period: | 2010s |
Story: | threatened with a knifenumber in titlebloodviolencesequelpartyknifechasesurprise endingpistolcell phonecorpsedigit in titleshot to deathblood splatter β¦shot in the chestrescuepunched in the facefalling from heightmaskbookheld at gunpointnumbered sequelf wordreporterfoot chaseflashlightbound and gaggedvideo cameradisguiseambulancedeath of friendthroat slittingstabbed to deathstabbed in the chesttied to a chairno opening creditspolice officer killedfemme fatalenews reportshot in the foreheadauthorcharacter repeating someone else's dialoguevirginstabbed in the backfired from the jobelectrocutionknocked outhigh school studentfilm within a filmpolicewomansuspicionvigilantestrong female characteranswering machinefalling down stairsrevelationsociopathfamegroup of friendsred dressbarnsecurity camerawalkie talkiestabbed in the stomachkicked in the stomachfourth partimpersonationpress conferencestrong female leadparking garagefemale killerduct tape over mouthcrime scenetensionunderage drinkingstabbed in the throatstabbed in the neckpunched in the stomachdeath threatstabbed in the legdisembowelmentbookstorebody landing on a carlens flarecharacters killed one by onedead woman with eyes opensequel to cult favoritemasked killermedia coveragelaptop computerintestinesstabbed in the handhiding in a closetreference to facebookwebcamstabbed in the armclimbing through a windowwhodunitfacebookdeputystabbed in the shouldersole black character dies clichefilmed killingcamcorderreference to twitterfemale cophiding under a bedspitting bloodbreaking through a doorshot in the crotchstupid victimvillain not really dead clichewoman in dangerbullet proof vestred herringdead woman on floormovie fantauntingdeeply disturbed personmystery killerpretending to be deadbook signingstabbed in the footdoorbellaccomplicebreaking down a doorbloggerdead teenagergeneration ydefibrillatorstartledstabbed in the bellystabbed in the foreheadclichepublicistmillennial generationthreatening telephone callfourth in seriesthrown through a glass doorunmaskingparty crashingmotivephone terrorreference to jeffrey dahmertelephone terrorweb camerathrown off a balconyreference to bruce willissudden disappearanceschool clubstabbing a womanhiding evidencemise en abymestabbing a police officerself inflicted woundcrashing through windowgarage door openerwatching a horror movieactress shares last name with characterdraw bladerunning into a wall (See All) |
Based on the novel by David Baldacci, Absolute Power is about the ruthlessness of people in power. The President believes that everything he does is beyond reproach, including an affair or two. That leads to murder and everyone around him is involved. There is only one witness, a thief named Luther β¦Whitney. They are sure he'll talk, but when? The Secret Service is determined to keep him quiet, but catching a thief isn't always easy. (Read More)
Subgenre: | suspenseconspiracypsycho thrillerpolitical thrillerpolitical conspiracy |
Themes: | home invasionmurderdeathlovefriendshiprevengesuiciderapebetrayalpoliticsadulterydrunkennessescapeheroinvestigation β¦deceptionvoyeurismextramarital affaircorruptionparanoiablackmailredemptiondeath of wifenear death experience (See All) |
Mood: | neo noir |
Locations: | hospitalbarhotelmotorcycleairportwoodswheelchairapartmentpolice station |
Characters: | family relationshipspolicefather daughter relationshipdoctordetectivethieftough guyhitmanpolice detectivesniperolder man younger woman relationshipsniper rifle |
Story: | threatened with a knifewitnesssexbased on novelbloodviolencetwo word titlekissfightcigarette smokingphotographpartyknifechasepistol β¦based on bookcorpseshot to deathblood splattercar accidentface slapshot in the headpunched in the facearrestletterpaintingbedcafehandcuffsvoyeurshot in the backfoot chaseflashlightambushdisguisemansionwomananti herodrawingnews reportnecklacebartenderracial sluron the runattempted murderlimousinewidowerpay phonecover uplightningu.s. presidentattempted rapedirected by starpresidentpolicewomanex convictsilencerkissing while having sexnewspaper headlinepowerwashington d.c.answering machinesyringeelectronic music scoreheavy rainlooking at oneself in a mirrorhidingloss of wifevideotapepress conferenceproduced by directorsadomasochismart gallerywhite housecrime scenereverse footageburglarburglarystabbed in the neckmillionaireblack braframe upsafeautopsyrainstormtourethnic slurmelancholypolitical corruptionframed for murderimpersonating a police officerjewelryex copsecret servicestolen moneystabbed in the armredheaded womanhospital roomhired killeroffscreen killingprosecutormetal detectortwo way mirrorforgerywoman shotvaultbutt slapmotorcycle copwoman slaps a manfake moustacheman hits a womannight vision goggleswiretappingwoman in dangersecret roomman slaps a womancrime of passiondead woman on floorjoggerone last jobtrophy wifegovernment corruptionwoman punches a mansecret service agentjewel thiefanswering machine messagefather daughter estrangementcareer criminalcharacter appears on tvman punches a womanreference to george washingtonreference to sherlock holmeswoman hits a manhomicide detectiveyelling for helpreference to thomas jeffersonproduced by actorpolitical cover upkorean war veteranpolaroid photographmaster of disguiseforgercharacter appears on front page of a newspapercrusadeyoung wifediamond necklacewoman beaterreference to the old testamentwhite house washington d.c.chief of staffletter openeru.s. secret serviceincriminating evidenceinjected in neckjewelry theftcar over a cliffjewelry thiefreference to mary poppinsview through rifle scopeposing as a doctor80 year oldcrime scene cleanupstabbed with a letter openerwatergate hoteldaughter in danger (See All) |
College student Jeffrey Beaumont returns to his idyllic hometown of Lumberton to manage his father's hardware store while his father is hospitalized. Walking though a grassy meadow near the family home, Jeffrey finds a severed human ear. After an initial investigation, lead police Detective John Wil β¦liams advises Jeffrey not to speak to anyone about the case as they investigate further. Detective Williams also tells Jeffrey that he cannot divulge any information about what the police know. Detective Williams' high school aged daughter, Sandy Williams, tells Jeffrey what she knows about the case from overhearing her father's private conversations on the matter: that it has to do with a nightclub singer named Dorothy Vallens, who lives in an older apartment building near the Beaumont home. His curiosity getting the better of him, Jeffrey, with Sandy's help, decides to find out more about the woman at the center of the case by breaking into Dorothy's apartment while he knows she's at work. What Jeffrey finds is a world unfamiliar to him, one that he doesn't truly understand but one that he is unable to deny the lure of despite the inherent dangers of being associated with a possible murder. Still, he is torn between this world and the prospect of a relationship with Sandy, the two who are falling for each other, despite Sandy already being in a relationship with Mike, the school's star football player. (Read More)
Subgenre: | independent filmcult filmpost modern |
Themes: | blindnesssurveillancepsychopathmurderdeathsurrealismkidnappingdrugsrapejealousygangstervoyeurismobsessionblackmailalcoholism β¦murder of a police officerpolice corruptionamerican mythology (See All) |
Mood: | goresatireneo noirnightmarecar chaseavant garde |
Locations: | hospitalsmall townnightclubbrothel |
Characters: | father son relationshippolicemother son relationshipfather daughter relationshipsingerserial killerstudentdetectivelove trianglepolice detectivevillainolder woman younger man relationshipwriter directoramateur detectiveshooting a police officer β¦go go dancer (See All) |
Story: | woman in jeopardybreaking and enteringsexfemale nuditynuditymale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditytwo word titlegunsex scenefemale rear nudityfemale full frontal nudity β¦male full frontal nudityknifeleg spreadingcorpseshot to deathface slapshot in the headsecretbeerhallucinationvoyeurmale pubic haircolor in titlerevolvergood versus evildrug dealerdinerfemale pubic haircontroversyfemme fataleshot in the foreheadpublic nuditysuburbstripteaseconvertiblewigsilencercult directorcorrupt coptitle based on songmutilationwalkie talkiedrug abuseassaultsadomasochismpeeping tombroken legswitchbladedark humorinsectpsychotronicsong in titleblack eyemusical numberperversionmisogynyblack bra and pantiesdoppelgangerhiding in a closetforced to stripsex slavemasochismstrokescene of the crimeamericanashot in the handurinatingwoman in lingerielip synchingflamegraphic violencegrasswaking upbutcher knifepsychotronic filmdreamingtalking while drivingsexual obsessionsexual humiliationstairwellhardware storetitle appears in songsevered earsexual predatorhigh school footballoxygen maskhandballexterminatorfire engineblack lingerieloss of innocencestrong sexual contentgomorrahymuscle carinnocence lostlounge singerclichekidnapped childtouching someone's breastspsychological abusemystery womanspying on someonehornsdance partyhyperrealismfull circlekiller coprobinpaladinsexual aberrationmiddle americaheineken beernon statutory female on male rape attemptamyl nitratefront yardhorusalienated sexualityosirissmall town stereotypekidnapped manman in disguisekabuki makeup (See All) |
Sam Bowden ('Nick Nolte' (qv))is a small-town corporate attorney/"Leave It to Beaver" type family-man. Max Cady ('Robert De Niro' (qv)) is a tattooed, cigar-smoking, bible-quoting, rapist. What do they have in common? Fourteen years, ago Sam was a public defender assigned to Max Cady's rape trial, a β¦nd he made a serious error: he hid a document from his illiterate client that could have gotten him acquitted. Now, the cagey, bibliophile Cady has been released, and he intends to teach Sam Bowden and his family a thing or two about loss. (Read More)
Subgenre: | coming of agesuspensepsychological thriller |
Themes: | home invasionsurveillancepsychopathmurderrevengeinfidelitydrugsrapereligionbetrayaladulteryprisonfeartorturedrunkenness β¦deceptionseductionextramarital affairangerterrorismparanoiadysfunctional familyredemption (See All) |
Mood: | neo noirhigh schoolnightmarehorror movie remake |
Locations: | hospitalbarrestaurantchurchhotelsmall townairportelevatorpolice stationmotelstorm |
Characters: | husband wife relationshipfamily relationshipspolicefather daughter relationshipteenagermother daughter relationshiptattoopolice officerserial killerlawyerhitmanbible |
Story: | psychological torturesexbased on novelbloodviolenceflashbackdogtwo word titlebare chested malegunfightcigarette smokingtitle spoken by characterknifesurprise ending β¦pantiespistolfirebeatingcorpseblood splatterfistfightremakeslow motion scenebrawlplace name in titleinterrogationhallucinationhandcuffsrevolverrivergood versus evilbound and gaggedstrangulationaxethroat slittingdinerprisonertied to a chairman with glasseschild in perilunderwater scenepolice officer killedcigar smokingattempted murderstalkerbeaten to deathperson on firepay phonecover uplightningattempted rapehigh school studentstalkingfilm within a filmex convictactingfireworksclass differencesfreeze framemaniacpot smokingteen angstkilling an animalhead buttgothicheavy rainsexual abusesecurity cameraassaultmovie theaterblockbusterrape victimparaderapistmale underwearcrime scenecameoprison guardfloodtrappedbloody noseboxer shortsfight to the deathfitnessimpostorgash in the facepolice officer shotblack and white scenebible quoteblood on shirtrainstormgasolinerelease from prisonbriefsinjusticestick fightprivate investigatorsouthern accentvillain played by lead actorsexual awakeningworkoutharassmentharborsexual violenceweightliftingflareburnt facemind gameyuppieshot in the throatmiddle classtwo way mirrorparoletormentfourth of julyman on firepool of bloodwrongful imprisonmentmiscarriage of justicepolice officer shot in the headextreme close uphousemaidcigarsexual predatorolder man young girl relationshipgarrotefireworkfamily in dangerhouseboatmuscularhawaiian shirthit with a rockcounsellorbattering ramrestraining ordersouthern gothicwearing a sound wirehuman fleshadultererauditoriumremake of cult filmbody buildingbitten in the faceracquetballstringparoleeephebophilespeaking in tonguesweight trainingpolice officer strangulatedcolor remake of black and white filmfinger suckingblood on floorhit squadhouse boatman wearing wigdarwinian struggle for survival (See All) |
After returning from a wedding reception, a couple staying in an isolated vacation house receive a knock on the door in the mid-hours of the night. What ensues is a violent invasion by three strangers, their faces hidden behind masks. The couple find themselves in a violent struggle, in which they g β¦o beyond what either of them thought capable in order to survive. (Read More)
Subgenre: | independent filmsuspensesurvival horror |
Themes: | home invasionpsychopathmurderfeartortureparanoiapanic |
Mood: | slasherone night |
Locations: | rural settingkitchenshedcar fire |
Characters: | boyfriend girlfriend relationshipserial killerterror |
Period: | year 2005 |
Story: | psychological torturebloodviolenceflashbackcigarette smokingdancingknifesurprise endingcell phonebeatingcorpseshot to deathblood splattershot in the headshotgun β¦written by directorcar crashpianoalcoholfoot chasebedroomflashlightcandleaxedisguisedeath of friendstabbed to deathstabbed in the chesttied to a chairnonlinear timelineno opening creditsmarriage proposalchampagneevil manknocked outstalkingthreatisolationrecord playerpickup truckfireplaceice creambarnvandalismstabbed in the stomachcovered in bloodstrangerfemale killermasked manpump action shotgunconfrontationblood on shirtswingintruderwedding receptionmasked killerflat tireengagement ringmormonwoman in bathtubinterrupted sexharassmentbag over headhiding in a closetvery little dialoguehomicidal maniaccottagemind gamebubble bathfilm starts with textcabin in the woodsscene of the crimebleeding to deathcountry housemasked villainknife murderbutcher knifebreaking through a doorcut handcat and mousestarts with narrationtauntingnightgownwriting in bloodred lightham radiocrawlingbroken windshieldmasked woman911 callwind chimecandlelight dinnershower curtainunmaskingtwisted ankleloading a gunheld at knifepointsmoke alarmrose petalmasked intruderassembling gunsack maskflannel (See All) |
A State Department employee newly posted to the American embassy in London is charged with stopping terrorists from getting into the U.S. That puts her right in the line of fire and she is targeted for death and framed for crimes. Discredited, she is forced to go on the run while she tries to clear β¦her name and stop a large-scale terrorist attack set for New Year's Eve in Times Square. (Read More)
Subgenre: | independent filmmartial artssuspenseconspiracy |
Themes: | home invasionsurveillancemurderdeathrevengekidnappingchristmasbetrayalfearescapedeceptionterrorismunlikely hero |
Locations: | new york cityrestauranthotelhelicoptermotorcycleairplanelondon englandtaxiairportkitchenwheelchairapartmenttruckrooftoptaxi driver β¦laboratorytunneltrain stationfire truck (See All) |
Characters: | policedoctorfemale protagonistdetectivehostageartisthitmanpolice detectivesniperemployer employee relationshipamerican abroadsniper riflepolice chasemysterious villainamerican in the uk |
Story: | assumed identitybreaking and enteringviolenceone word titleflashbackfightphotographexplosionknifechasesurprise endingpistolfirecell phoneshootout β¦corpsefistfightmachine gunslow motion scenepunched in the facebattlegunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombrunningrevolvercombatscientistf wordsurvivalfoot chaseorphanflashlightassassinambushterroristdisguiseambulancestabbed in the chestsubwayexploding carfalse accusationno opening creditsnews reporton the runattempted murderbinocularsdangerprologuepay phonefugitiveproduct placementrace against timecover upknocked outchristmas treetough girlopening action scenelaptoppolicewomanratsuspiciondie hard scenariosilencersubtitled scenebattlefieldak 47hand grenadeburned aliveassassination attemptelectronic music scoresociopathsecurity cameraexploding buildingwristwatchnew year's evefaked deathart galleryrocket launcherpassportcrime scenetarget practiceexplosiveimpostormanhuntgash in the facestabbed in the neckafghanistancigarette lighterframe upbooby trapaccidental killingaerial shote maileye gouginggasolinepolice inspectorterrorist plotexploding helicopterframed for murdergatling guntracking devicemysterious manterrorist groupfire extinguisherspiral staircasefake identityeconomicscomputer crackerbrooklyn bridgemarinehired killerhelicopter crashembassyambassadorflight attendantwoman kills a mantimes square manhattan new york citycontract killermicroscopecorrupt officialpost officewoman fights a manvaultchinatownman with no namebilingualismgas explosionhelicopter pilotdog tagbig ben londoncorrupt businessmancompact dischazmat suitflash drivestabbed in the crotchscotland yardnight vision binocularscustoms officerlondon eyepharmaceuticalssecurity officeremployee employee relationshipbomb makingexplosives expertbombmakerid badgecell phone detonatordiplomatic security service (See All) |
Marcus Burnett is a hen-pecked family man. Mike Lowry is a foot-loose and fancy free ladies' man. Both are Miami policemen, and both have 72 hours to reclaim a consignment of drugs stolen from under their station's nose. To complicate matters, in order to get the assistance of the sole witness to a β¦murder, they have to pretend to be each other. (Read More)
Subgenre: | cult filmdark comedyheistbuddy comedy |
Themes: | home invasionmurderdeathmarriagedrugsmoneygangsterherorobberybrutalitymafiapolice brutalitypolice corruption |
Mood: | gorecar chase |
Locations: | trainswimming poolcarhelicopternightclubairportelevatorwheelchairapartmentpolice stationstrip clubbrothelhotel fight |
Characters: | husband wife relationshiphomosexualpoliceafrican americanfriendboyfriend girlfriend relationshipchildrenprostitutedetectivetough guyaction herobest friendpolice detectivepolice shootoutpolice chase β¦suicide by cop (See All) |
Period: | 1990s |
Story: | witnessbloodviolencedoggunkissfighttitle spoken by characterexplosionchasesurprise endingpantiespistolfirecell phone β¦shootoutcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshotgunslow motion scenegunfightbrawlshowdownheld at gunpointcar crashprostitutionhandcuffsfightingstrippertelephonef wordfoot chasewineambushmansionbasketballexploding caranti heroshot in the legattempted murderblack pantiescharacter repeating someone else's dialoguemistaken identitybaseball batopening action scenestreet shootoutautomobilefirst partdirectorial debutprofanityheroincorrupt copmachismocaptaintitle based on songblockbusterswat teamfloridawomanizermexican standoffgun fugun battlepump action shotgunbuddydual wieldpartnermiami floridaaquariumwisecrack humortough copbody countdrug lordblack bra and pantiesbullet timedesert eaglesidekickhackerstorestabbed in the handspiral staircasecomputer crackertwo man armyquick drawglockbullet balletbuddy coppolice captainstrong languagegun duelrazor blademaverick copporschebadgebloodshedwitness protectionblack copnight vision gogglesshoulder holsterthroat cutdead woman on floorbrothel madamforkliftidentity swapmoney falling through the airluxuryinternal affairshangarbustcarpethk 5 machine gunblack herofight in the restroomshooting a womanshot repeatedlyknife in handtrailer narrated by hal douglasloose cannonethermiranda warninggun in pursereference to skittlesstanding on the roof of a car (See All) |
When Eastern European criminals Oleg and Emil come to New York City to pick up their share of a heist score, Oleg steals a video camera and starts filming their activities, both legal and illegal. When they learn how the American media circus can make a remorseless killer look like the victim and ma β¦ke them rich, they target media-savvy NYPD Homicide Detective Eddie Flemming and media-naive FDNY Fire Marshal Jordy Warsaw, the cops investigating their murder and torching of their former criminal partner, filming everything to sell to the local tabloid TV show "Top Story." (Read More)
Themes: | home invasionpsychopathmurderdeathlovefriendshiprevengerapemoneybetrayaljealousyprisondrinkingfeartorture β¦drunkennessescapefuneralinvestigationrobberytheftparanoiainsanitycelebritysadismgreedjusticeforgivenesspolice brutalitymurder of a police officer (See All) |
Mood: | satirecar chase |
Locations: | new york citybarrestauranthotelcemeterybathtubtaxiairportapartmentpolice stationrooftoptaxi driverfire station |
Characters: | husband wife relationshippoliceboyfriend girlfriend relationshipboyprostituteserial killerdetectivepolicemanhostagelawyersister sister relationshipthiefpolice detectivepsychiatristrussian β¦police chasetalking to oneself in a mirrorlow self esteempolice funeral (See All) |
Story: | threatened with a knifewitnessfemale nuditynumber in titlebloodviolenceinterviewdogbare chested malefightcigarette smokingphotographtitle spoken by characterexplosion β¦knifechasepantiespistoltelephone callfirecell phonecorpsedigit in titleshot to deathunderwearblood splatterfistfightshot in the chesturinationface slapshotgunpunched in the facewatching tvcameradrinkarrestbrawlthongfalling from heightheld at gunpointdead bodycafehandcuffsmanhattan new york citycriminalf wordreporterfoot chasejournalistaxevideo cameraambulancestabbingdeath of friendstabbed to deathprisonerstabbed in the chestimmigranttied to a chairdrawinggraveyardnews reportcigar smokingshot in the legmarriage proposalnecklacetalking to the cameraattempted murderperson on firepay phoneproduct placementactor shares first name with characterflowersscene during end creditsamerican flagneck breakingdie hard scenariocharacter says i love youex convictshot in the armsubtitled scenearsontv newssociopathfamemediavideotapejournalismhome movietv showrapisthomicideransomswitchbladepartnerdeath threatdelusionblack and white scenerosebooby trapgasolinefemale reporterillegal immigrantmedia coverageengagement ringfirefighterclose up of eyesfiremanserial murderfire extinguishergreekspit in the facecentral park manhattan new york citypistol whipmen's bathroomwalletstabbed in the armcall girlcameramanstatue of liberty new york citysnuff filmdeath of boyfriendmurder witnessburnt bodytimes square manhattan new york cityfilmed killingcamcorderbadgeshot in the footnewscasthair salontime for titlespitting bloodtour buswitness protectionmurder of a nude womanbreaking a bottle over someone's headchrysler building manhattan new york cityarm slingknife held to throatthroat cutmacetied to a treereference to ludwig van beethoventv hosthit with a chairmedia manipulationnypdinterviewerfortunepepper sprayhot dog standsuitcase of moneyjamaicanstabbed with a knifeburned bodyburnt handhit with a frying panescort servicefoot injurydachshundpolish americanwaiting in linenew york police departmentkerosenereference to people magazinerikers island new york citydouble homicidereference to frank capraeastern europeanone million dollarspillow over headreflection in a car mirrortemporary insanitythrowing a chair through a windowusa customsarson investigatorfire marshalkilling rampagerunning in traffic (See All) |
JJ 'Jake' Gittes is a private detective who seems to specialize in matrimonial cases. He is hired by Evelyn Mulwray when she suspects her husband Hollis, builder of the city's water supply system, of having an affair. Gittes does what he does best and photographs him with a young girl but in the ens β¦uing scandal, it seems he was hired by an impersonator and not the real Mrs. Mulwray. When Mr. Mulwray is found dead, Jake is plunged into a complex web of deceit involving murder, incest, and municipal corruption all related to the city's water supply. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypolitical conspiracy |
Themes: | home invasionsurveillancemurderdeathfriendshipmoneybetrayalpoliticsadulteryfeartorturedrunkennessgangsterinvestigationdeception β¦incestextramarital affairracismcorruptionbrutalityparanoiadysfunctional family (See All) |
Mood: | neo noircar chasenight |
Locations: | beachrestaurantlos angeles californiabathtubdesertwaterapartmentpolice stationfarmofficerooftopmexicousayachtfollowing someone in a car |
Characters: | husband wife relationshipfamily relationshipspolicefather daughter relationshipmother daughter relationshippolice officerdetectivehostagelawyersister sister relationshiphitmansecurity guardpolice detectivemaidsecretary β¦employer employee relationshipmayorpolice chasefishermanengineercoronerchinese american (See All) |
Period: | 1930s |
Story: | assumed identitythreatened with a knifefemale nuditymale nudityviolenceone word titlebare chested malefightcigarette smokingphotographtitle spoken by characterknifesurprise endingpistolshower β¦telephone callbeatingcorpseshot to deathfistfighthorsecar accidentshot in the chestface slapshot in the headrescuepunched in the facecamerabrawlsecretshowdownrifleheld at gunpointplace name in titlecar crashdead bodyinterrogationhandcuffsrevolvertelephoneshot in the backambushmansionwomanbridgewidowmapfalse accusationanti herofishingdouble crossfemme fataledrowningracial slurattempted murderbinocularscharacter repeating someone else's dialogueprotestcover upevil manknocked outfarmerdomestic violencelong takeconvertibletragic eventthreatpremarital sexsuspicionshot in the armhandgunnewspaper headlinehenchmanprivate detectivescandaleyeglasseseavesdroppingshavingsabotagevandalismmorguekicked in the stomachnosebleedimpersonationrape victimfollowing someonescammexicanthugcrime scenehaunted by the pastswitchbladeimpostormillionaireplot twistrowboatescape attemptaquariumbutlerpunched in the chestdark heroautopsyaccidental killingwisecrack humordisfigurementdark pastlieutenantloss of husbandethnic slurmelancholypolitical corruptionprivate investigatorsouthern accenttaking a photographdirector cameoex copset uphomagebarbergardenerreal estatelawsuitretirement homeknocked unconsciousshot in the eyepocket watchkiss on the lipsgreat depressiondambusiness cardman kills a womanpalm treealtered version of studio logopondfamous scoreorchestral music scoretragic pasttragic endingdistrustchinatownimplied sexbarbershopfade to blackfamous linetrespassingtycoonsocial decaycocktaildroughtman slaps a womansecret pastbarber shopcity hallorangegovernment corruptionprotective malebloody facecrutchcorrupt businessmansnoopingobituarytelling a jokebeaten uphidden truthlandownerscapegoatorchardends with deathcaught in a liedishonestypolitical cover upmystery womancity councilincestuous relationshipjazz scoremusic score features pianoyawningreservoirsad endingnaked dead mansevered noselos angeles storm drainhard boiledshocking truthphoto labtelephoto lenschinatown los angelessalt waterreference to confuciusmale slaps femalenose bandageyawnbandaged nosewater rightskilled in a carlighting cigarette for womanlos angeles riverco worker co worker relationshiphall of recordsreal estate fraudshot while trying to escapecatalina island californiahanging up without saying goodbyecatalinareal estate scam (See All) |
Rocky, a young woman wanting to start a better life for her and her sister, agrees to take part in the robbery of a house owned by a wealthy blind man with her boyfriend Money and their friend Alex. But when the blind man turns out to be a more ruthless adversary than he seems, the group must find a β¦ way to escape his home before they become his latest victims. (Read More)
Subgenre: | suspensepsycho thriller |
Themes: | home invasionpsychopathmurderdeathrevengetorturerobberydeath of daughter |
Characters: | boyfriend girlfriend relationshiptattoosister sister relationshipthiefterrorex soldier |
Story: | breaking and enteringbloodflashbackdogtwo word titlepistolbeatingcorpseshot to deathblood splatterurinationshot in the headslow motion scenepunched in the face β¦written by directorfalling from heightheld at gunpointhandcuffsshot in the backf wordfoot chasebound and gaggedstrangulationimpalementnonlinear timelineno opening creditsnews reportstabbed in the backknocked outattempted rapelong takeisolationbasementhammerburglaryshot in the facesafethrown through a windowtrailertied feetblind mansexual assaultcharacters killed one by onecellarnewspaper clippingatheistclose up of eyesbag of moneyhiding in a closetminimal castdetroit michigansexual violencenight visiondisposing of a dead bodybroken windowtrailer homeclimbing through a windowshoeheld captiveman punching a womangashit with a shovelhitchcockianin medias reshit with a hammersole survivordragging a bodyvillain not really dead clicheattempted robberycat and mousesecurity systempregnant woman murderedrobbery gone awryrape attemptgarden shearsladybugshot in the eargulf war veterantrapped in a housecigarettesfalling through a rooftop windowcrawling through an air shaftinseminationloud noisehit with a crowbarturkey basterrobbery attempt (See All) |
A rare atmospheric phenomenon allows a New York City firefighter to communicate with his son 30 years in the future via HAM radio. The son uses this opportunity to warn the father of his impending death in a warehouse fire, and manages to save his life. However, what he does not realize is that chan β¦ging history has triggered a new set of tragic events, including the murder of his mother. The two men must now work together, 30 years apart, to find the murderer before he strikes so that they can change history--again. (Read More)
Subgenre: | suspenseparanormal phenomenaalternate history |
Themes: | home invasionpsychopathmurderdeathloverevengesurrealismescapeheroinvestigationmemoryobsessionsupernatural powerparanoiatime travel β¦redemption (See All) |
Mood: | affection |
Locations: | hospitalnew york citybarrestaurantnightclubbicyclepolice stationbaseballsewer |
Characters: | husband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipteenage boyserial killernursedetectivepolice detective |
Period: | 1990s1960s2000s |
Story: | woman in jeopardybloodone word titleflashbackfightexplosionsurprise endingpistolfirebeatingcorpsefistfightshotgunrescuebrawl β¦showdownrevolvertelevisionaxedinerfalse accusationchild in perilcoffeestalkerrace against timebaseball batskeletontragic eventstalkingloss of fathernewspaper headlinecorrupt copdestinywarehousewoundslow motionlifting someone into the aircaptivepatientexploding buildingblockbusterfollowing someonecompassiondead womanback from the deadcrime scenefloodbraverycynicismmisunderstandinghippieitalian americanframe upbarbecuedead woman with eyes openpatriotismfirefighterirish americanpicturewalletlost loveexploding truckelectric shockjailbreakabandoned warehousevillain not really dead clichemedical professiondead woman on floorsittingqueens new york citylifting male in airfingerprintsham radioworld seriescoworker relationshipfirefightingbad copaltering historyaurora borealisflamesphilosophical conversationnew york police departmentamateur radiofuture shockbutterfly effectnew york metslove across timetaking the law into one's own handsdropping a glassfight in men's roomtachyontemporal paradoxyahoograndfather paradox (See All) |
Two seemingly well-educated young men, who call each other Paul and Peter among other names, approach a family on vacation. They are, apparently, friends of the neighbors, and, at the beginning, their true intentions are not known, but soon, the family is imprisoned and tortured in its own house vio β¦lently, which the viewers are forced mostly to imagine and to share a certain complicity with the criminals. It might be some kind of game with the lives of husband, wife, son, and dog, but why are they doing it? (Read More)
Subgenre: | independent filmpost modern |
Themes: | home invasionpsychopathmurderdeathkidnappingtortureescapegriefhumiliationsadismmurder of family |
Mood: | breaking the fourth wall |
Locations: | kitchenlaketrying to escape |
Characters: | husband wife relationshipfamily relationshipsfather son relationshipmother son relationshipserial killerterrorboy in underwear |
Story: | psychological torturebloodviolencedogtwo word titleknifechasesurprise endingcryingcell phonecorpseface slapwatching tvwritten by directorundressing β¦vomitingrifleprayertelevisionoperachild in perilcontroversylooking at the cameradrowningtalking to the cameragunshotscreamingvacationdeath of childlong taketied upcharacter says i love yougamekilling an animaleggoverallsbroken legremote controlinvasionbuddyloss of sonmurder of a childtitle at the endbetduct tapeloss of husbandphysical abusebag over headforced to stripdockkilling a dogdead childrengolf clubsailboatmind gamewetting pantsloss of childactual animal killeddeath by drowningdeath by gunshotbloody body of a childglovechild with a gunno survivorsaustrianno music during end creditshair dryerchild killerfamily in dangergolf ballremadehorror movie remadesailing boathit with a golf clubmurderer duochild shot in the headblood on wallrewindescape out a windowcar stereoman slaps manescape out windowkilling a petgolf bagbroken eggwet underwearmurdered couplerewinding actionvacation resort (See All) |
Kevin Chan (aka Jackie) is a Hong-Kong cop, who scores his first big hit by virtually single-handedly capturing and arresting a big drug- lord. Of course, the drug-lord isn't too happy about this, and frames Kevin with the murder of another cop (who happened to be on the take). Kevin has to clear hi β¦s name, whilst keeping himself from getting killed or arrested, and keeping his girlfriend from leaving him. (Read More)
Subgenre: | independent filmmartial artscult filmblack comedyslapstick comedy |
Themes: | home invasionmurderdeathrevengekidnappingbetrayalescapegangsterherodeceptionangerbrutalityhumiliationpolice corruptionnear death experience |
Mood: | car chase |
Locations: | swimming poolmotorcyclebustaxiurban settingapartmentpolice stationpolice cartruckrooftopchinaslumbus driverrooftop fight |
Characters: | policeboyfriend girlfriend relationshippolice officerdetectivepolicemanhostagelawyertough guywarrioraction herohitmanpolice detectivesecretarypolice shootoutpolice chase β¦actor director writerpolice officer taken hostage (See All) |
Period: | 1980s |
Story: | woman in jeopardythreatened with a knifewitnessnuditybloodmale nudityviolencetwo word titlebare chested malefightphotographexplosionknifechasesurprise ending β¦pistolshowertelephone callcell phoneshootoutbeatingshot to deathblood splatterfistfightmachine guncar accidentshot in the chestrescueslow motion scenepunched in the facecomputerwritten by directorswordarrestgunfightbrawlshowdownheld at gunpointhand to hand combatsunglassesbirthdaycar crashhandcuffsrevolverfightingcriminaltelephonekung fugood versus evilfoot chasebound and gaggedsword fightambushmontagemixed martial artsweapontied to a chairfalse accusationjudgetrialdisarming someoneone man armyhit by a cardouble crossbirthday partypolice officer killednews reportlatex glovesattempted murderone against manyorganized crimebeaten to deathpay phoneumbrellaundercoverproduct placementrace against timekicked in the facebaseball batopening action sceneactor shares first name with characterstreet shootoutcourtdirected by starbodyguardmartial artistautomobilefirst partsemiautomatic pistolcowcorrupt copstylized violencehenchmancrime bossbirthday cakefalling down stairsmartial arts masterdestructionhead buttelectronic music scorecoplawhong kongoverallskicked in the stomachvideotapephone boothpress conferencejumping from heightparking garagechop sockymasked mangun battlethugdamsel in distressmisunderstandingshopping mallframe uppunched in the chestundercover coptough copbody landing on a carpublic humiliationpolice inspectorsports carchloroformwritten by starnewspaper clippingdrug lordframed for murdermob bosshit with a baseball batkung fu fightingswordsmanface maskkatanafinal showdownbloopers during creditskendohiding in a closetrepeated scenetelephone boothparkourgun held to headglocktape recordingdepartment storepolice captainwetting pantsroadblockcrashing through a windowcactusmaverick copcop killerrighteous ragemotorcycle cophappy birthday to youreference to michael jacksonreference to john waynepsychotronic filmwitness protectionbreaking a mirrorsurprise partymotor scooterknife held to throatcrime lordphysical comedytoy carforkliftjumping from a rooftopcassette tapedouble entendresurprise during end creditshundred dollar billpolice officer knocked unconsciousmotorcycle stuntdouble decker bushead bandagethrown through a windshieldgangster bossoutnumberedbriefcase of moneycar stuntmale in a showerpolice protectionpolice officer kickedpie in the faceplay fightshantytownundercover operationtraffic policemanbaby strollerdriving in reversecar flippolice forcehong kong policecake in the facetestifying in courtpolice superintendentactor performing own stuntschase on footchase scenereload guncontainer truckparallel parkingundercover officercar rolling down hillchinese noodlespolice station wagonworld cinema (See All) |
The movie is based on the infamous "Stanford Prison Experiment" conducted in 1971. A makeshift prison is set up in a research lab, complete with cells, bars and surveillance cameras. For two weeks 20 male participants are hired to play prisoners and guards. The 'prisoners' are locked up and have to β¦follow seemingly mild rules, and the 'guards' are told simply to retain order without using physical violence. Everybody is free to quit at any time, thereby forfeiting payment. In the beginning the mood between both groups is insecure and rather emphatic. But soon quarrels arise and the wardens employ ever more drastic sanctions to confirm their authority. (Read More)
Subgenre: | psycho thriller |
Themes: | claustrophobiasurveillancemurderdeathloverapemoneyprisontorturefuneralangerbrutalityhumiliationsadismevil |
Locations: | beachcartaxicanadagermanytaxi driver |
Characters: | father son relationshipfather daughter relationshipdoctorsingerprofessor |
Period: | 1970s |
Story: | panic attackpsychological torturesexfemale nuditybased on novelbloodmale nudityviolencefemale frontal nudityflashbackmale frontal nuditymale rear nuditygunsex scenefight β¦cigarette smokingphotographsingingknifebased on true storysongbeatingdreamfoodcar accidenturinationshot in the headcomputercamerakissingshootingvomitingsunglassesinterrogationhandcuffssciencereportergay slurflashlightjournaliststabbingbasketballprisonertied to a chairnonlinear timelineunderwater scenenews reportshot in the leggunshotpilotbeaten to deathsuburbuniformattempted rapeuniversitymanipulationautomobileisolationdominationpowerriotexperimentundergroundpsychologyrebelflatulencepsychopsychologistrebellionmilksubmissionrole playingguardcivil rightsprison guardresearchresistanceconfrontationanxietylosthit on the headfascismprison cellnervous breakdownasylumphysical abuseimprisonmentmale objectificationreference to elvis presleyoppressionvideo surveillancefire extinguishergay bashingmental breakdownmajornight visionwhistledegradationseagullpush upssimulationleadervolunteermercedes benzprison breakinmateelvis impersonatorchoicesociologyferrarihuman experimentsolitary confinementaggressioncontrolpower strugglescientific researchloss of controlslide showprison riotconcussionhuman experimentationbarefoot womanwatching someoneprivacyfollowingdehumanizationauthorityindividualitysocial experimenttape over mouthobediencedefiancenewspaper adhuman guinea pigstanford universityhit with a fire extinguishermental abusebilly clubpsychological experimentnude womanhierarchytv monitorweaknessfollowerpsychological testingshaving one's headstate of emergencydiscomforthuman behaviorundercover journalistlactose intoleranceprisoner revoltcontrolled environmentforced drinking (See All) |
Millionaire industrialist Steven Taylor is a man who has everything but what he craves most: the love and fidelity of his wife. A hugely successful player in the New York financial world, he considers her to be his most treasured acquisition. But she needs more than simply the role of dazzling acces β¦sory. Brilliant in her own right, she works at the U.N. and is involved with a struggling artist who fulfills her emotional needs. When her husband discovers her indiscretion, he sets out to commit the perfect murder and inherit her considerable trust fund in the bargain. (Read More)
Subgenre: | suspensepsycho thriller |
Themes: | home invasionpsychopathmurderdeathrevengemarriageinfidelitymoneybetrayaljealousyadulteryescapeartinvestigationextramarital affair β¦obsessionparanoiablackmailinsanityunfaithfulnessgreedwealth (See All) |
Mood: | neo noir |
Locations: | new york citytrainkitchenurban settingapartmentcitykitchen knifefrench restaurant |
Characters: | husband wife relationshipdetectiveartistmaidolder man younger woman relationship |
Story: | woman in jeopardysexphotographchasethree word titlesurprise endingpistolshowerbased on playcryingcell phoneblood splattershot in the chestblondeface slap β¦punched in the facepaintingsunglassesstrangulationstabbingstabbed to deathpaintercigar smokinglatex glovesduelcharacter repeating someone else's dialoguebusinessmankeypassionshot in the shouldersuspicionsubtitled scenemaniaccard gameassassination attempttape recorderstabbed in the stomachvisitscamcynicismfight to the deathunfaithful wifestabbed in the neckmay december romancewedding ringbalconynoteopening a doorvillain played by lead actoradulterous wifetaking a showerbreak inrobberunited nationsspiral staircasemarried couplehired killerbubble bathscene of the crimehitchcockiancashhomosexual subtextfemale victimkiss on the cheekstupid victimpoker gamecrime of passiongold diggerdeeply disturbed personbank vaultpayphonethreat to killwoman punches a mannypdferry boatscrewdrivercareer criminalsafe deposit boxwife murders husbandkiss on the foreheadplan gone wrongcheating on husbandmale in a showercrime gone awryinterrogation roombalaclavathreatening telephone calltrain compartmentwoman in bathtaking a pillwoman murders a manwishing someone good luckterracederangedquestioned by policecombination safefancy restaurantmother daughter hugkeychainviolent husbandmale female hugcompromising photographhusband hits wifeloft apartmentwife's sexual pretencechoking someonepainter as artistthrown to the floorwashington square manhattan new york cityshoeboxbearer bondsvictim fights backsecret recordinghidden keyleaving message on answering machinemasked attackerrecorded conversationwife shoots husbandspeaking arabicsubway ridewife hits husbandhusband wife hughigh financekiss on the handmailing a letterplot to murder wifepost traumaticremake of hitchcock filmmark twain quotation (See All) |
The violinist Sydney Wells has been blind since she was five years old due to an accident. She submits to a surgery of cornea transplantation to recover her vision, and while recovering from the operation, she realizes that she's having strange visions. With the support of Dr. Paul Faulkner, Sidney β¦finds who the donor of her eyes and begins a journey to find out the truth behind her visions. (Read More)
Themes: | blindnessghostfearcheating death |
Mood: | rainnightmarehorror movie remake |
Locations: | hospitallos angeles californiabustaxielevatorkitchenwheelchairmexicochinese restaurant |
Characters: | sister sister relationshiplittle girlwitch |
Story: | loss of eyesightpanic attackexplosionshowerfireslow motion scenewatching tvsunglassesperson on fireproduct placementdeath of brotherblindfoldsurgerybirthday cakeanswering machine β¦heavy rainred dressclassical musicskateboardorchestralooking at self in mirrorburned to deathsmokeviolinistbandageeyebroken windowfish tankbroken mirrorwhisperingcoughinggurneysick childhappy birthday to youdoormanpeep holeimmolationlifting person in airsurprise partysheet musiccityscapebreaking glassconcert hallhelium balloonbandannaeye injurytearfemale musiciansunflowerorchestra conductorlava lampseeing dead peoplebrailleintravenouseye surgeryremake of asian filmblurry visioneye transplantmaking facesspectermumblingreport cardwhite canefalling off a chairregaining sightburned out buildinghyper keen sensescorneal transplantfogged mirrorchrysanthemumremake of chinese film (See All) |
An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.
Subgenre: | cult filmsuspense |
Themes: | psychopathmurderdeathkidnappingrapeadulterytortureseductionbrutalityobsessiondrug useinsanitygrief |
Mood: | rainnightmarenight |
Locations: | hospitaltrainaustraliapolice carseashipoceanyachtstorm at seaship on fire |
Characters: | husband wife relationshippolicedoctorserial killerpolicemandancerphotographerhostageaustralianterroraustralian abroaddeath of killer |
Story: | psychological torturewoman in jeopardysexfemale nuditybased on novelbloodmale nudityviolencefemale frontal nudityflashbackmale rear nuditydogtwo word titlebare chested malekiss β¦female rear nudityfightcigarette smokingdancingphotographknifechaseshowerfirecryingsongbeatingcorpsefoodcar accidentshotgunrescuebare buttheld at gunpointtearssunglassesdead bodysubjective cameraswimmingflashlightsubwayapologyradiounderwater scenedrowningduelbinocularsmicrophonekeyevil mandeath of childdeath of sonisolationsuspicionmurdererdie hard scenariomaniacsociopathsurvivorcaptivewristwatchstrangerhome movierailway stationblack humorpassportdivingphoto shoottrappedpillsloss of sonhit in the crotchdeath threattitle appears in writingrowboatmedicationexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedpsychoticpsycho killerminimal castalonesailboatsailingraftdegradationmarried coupleflareunconsciousnessdruggedswimming underwaterlying on bedman in swimsuitstabbed in the shouldershot through the mouthtitle same as booksole survivorbreaking through a doorflare gunmass murdererdriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceandeeply disturbed personhands tiedwriting in bloodlooking at picturebathing suitmovie projectorsleeping pillsharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlearm injurysalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasday for nightplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All) |
In an America wracked by crime and overcrowded prisons, the government has sanctioned an annual 12-hour period in which any and all criminal activity-including murder-becomes legal. The police can't be called. Hospitals suspend help. It's one night when the citizenry regulates itself without thought β¦ of punishment. On this night plagued by violence and an epidemic of crime, one family wrestles with the decision of who they will become when a stranger comes knocking. When an intruder breaks into James Sandin's (Ethan Hawke) gated community during the yearly lockdown, he begins a sequence of events that threatens to tear a family apart. Now, it is up to James, his wife, Mary (Lena Headey), and their kids to make it through the night without turning into the monsters from whom they hide. (Read More)
Subgenre: | suspensedystopiapsycho thrillersurvival horror |
Themes: | home invasionsurveillancepsychopathmurderdeathrevengebetrayalfeartorturedeceptiondeath of father |
Mood: | satireneo noirslasherone night |
Characters: | husband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiphomeless manneighbor neighbor relationship |
Period: | 2020s |
Story: | bloodviolencetitle spoken by characterknifesurprise endingpistolcell phoneshootoutbeatingcorpseshot to deathblood splattermachine gunshot in the chestshot in the head β¦shotgunrescuewritten by directorheld at gunpointinterrogationneighborrevolvershot in the backf wordsurvivalflashlightbound and gaggedaxemansiondeath of friendstabbed to deathstabbed in the chesttied to a chairchild in perildouble crossnews reportshot in the legattempted murdercharacter repeating someone else's dialoguebeaten to deathstabbed in the backsuburbstalkingthreatdeath of husbandbasementdie hard scenariocharacter says i love youfirst partclass differencesmacheteshot in the stomachscene during opening creditssecurity camerastabbed in the stomachnosebleedsocial commentaryclockmasked manmoralityduct tape over mouthpower outagepool tabletitle appears in writingstabbed in the legjumping through a windowone dayschoolgirl uniformfamily dinnerlens flareaxe murderkilling spreemoral dilemmamedia coveragehit with a baseball batblood on camera lenshiding in a closetminimal castself defense18 year oldfilm starts with textupper classdeath of boyfriendfilmed killingbroken nosehiding under a bedtormenttreadmillsocial decaycat and mousechild with a gundog tagsecurity systemfamily in dangerleft for deadsingle set productionmasked womanremote controlled toy cartooth knocked outcontainmentemergency broadcast systemmasked intruderhit with a pool cueunder the bed (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | independent filmblack comedysuspensepsycho thrillerslasher flickpsychological thrillerholiday horrorchristmas horror |
Themes: | surveillancepsychopathmurderdeathrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionloneliness β¦obsessionparanoiainsanitymental illnessabductioncrueltypanicmadnessnear death experience (See All) |
Mood: | goreneo noircar chaseslasherdarknessone night |
Locations: | new york citycarsnowwatertaxielevatorurban settingpolice carcityoffice |
Characters: | policefemale protagonistpolice officerpolicemanhostagesecurity guardpolice detectiveslasher killermysterious villain |
Period: | winter |
Story: | psychological torturewoman in jeopardynumber in titlebloodviolenceone word titledogfightexplosionpartyknifechasesurprise endingtelephone callfire β¦cryingcell phonehigh heelsbeatingcorpsedigit in titleblood splatterfistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunningcar crashhandcuffsvoyeurmanhattan new york cityf wordsubjective cameracleavagesurvivalfoot chasenewspaperflashlightbound and gaggedwinestrangulationaxevideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootdamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdowncharacters killed one by oneburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarfemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
Donnas senior prom is supposed to be the best night of her life, one of magic, beauty, and love. Surrounded by her best friends, she should be safe from the horrors of her dark past. But when the night turns from magic to murder there is only one man who could be responsible, the man she thought was β¦ gone forever. Now, Donna and her friends must find a way to escape the sadistic rampage of an obsessed killer, and survive their Prom Night. (Read More)
Subgenre: | coming of agesuspenseslasher flickteen movieteen horror |
Themes: | home invasionpsychopathmurderdeathfriendshipdrunkennessdanceobsessionrivalrymurder of a police officermurder of family |
Mood: | high schoolnightmareslasherhorror movie remake |
Locations: | hotelelevatorpolice stationfire truck |
Characters: | husband wife relationshippoliceteenagerfriendboyfriend girlfriend relationshipteenage girlteacherdetectivekillerpolice detectiveuncle niece relationshipaunt niece relationshipdeath of girlfriend |
Story: | threatened with a knifebloodmale nudityviolenceflashbackmasturbationdancingtitle spoken by characterpartyknifechasepistolshowercell phonecorpse β¦shot to deathblood splattermirrorshot in the chestremakeslow motion scenehallucinationsurvivalorphanstrangulationaxedisguiseambulancedeath of friendthroat slittingbridgestabbed to deathstabbed in the chestjokedream sequencepolice officer killednews reportlimousinestalkervirginclownrace against timekicked in the facedeath of childhigh school studentstalkingloss of loved oneswat teampsychologistrapistbarefootcrime scenehaunted by the pastfloodunderage drinkingevacuationpedophileblood on shirtmurder of a childone daycharacters killed one by oneuncleengagement ringparentsdjpervertauntgraduationfire extinguisherhiding in a closethigh school teacherpedophiliacomic relieftrashflaskescaped convictbody in a trunkmtvpromdeath of boyfriendgarbagemugshothiding under a beddeath of familychild molesterstupid victimbreaking a mirrorrookie copsexual predatorrenovationcliquebitten handsex offenderclicheflasherbad actinghotel suitemedicine cabinetbroken dishblack stereotypeprom queenbathroom mirrorcut telephone linecockinesserotomaniaprom kinghotel staffmaster keybridgeport connecticutstupid cop (See All) |
Peter Devereaux is a former CIA agent who is asked by the man he worked for to extract a woman who is in Russia and is presently close to a man running for President, who is believed to have committed crimes during the Chechen war. She can give them the name of someone who can prove it. His friend s β¦ays that she will only come to him. So he goes and she gets the info and tries to get out but the man finds out and tries to stop her. (Read More)
Subgenre: | independent filmmartial artsconspiracy |
Themes: | home invasionsurveillancemurderdeathrevengekidnappingpoliticsdeceptionangerbrutality |
Mood: | neo noircar chase |
Locations: | barrestauranthotelmotorcyclebusnightclubtaxiairportelevatorapartmentstrip clubtrain stationyachtcar bomb |
Characters: | father daughter relationshiphostagetough guywarrioraction herosniperrussianamerican abroadsniper riflepimp |
Period: | 2000s2010s |
Story: | assumed identitythreatened with a knifebased on novelbloodviolencefemale frontal nudityflashbackbare chested malesex scenefemale rear nudityfightphotographtitle spoken by characterknifechase β¦three word titlesurprise endingpistolshowercell phoneshootoutbeatingshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facecatgunfightbrawlbare buttfalling from heightheld at gunpointhand to hand combatcar crashinterrogationcafesex standing uppianorevolverstrippershot in the backf wordspyfoot chaseorphanjournalistassassinwinestrangulationdisguiseambulancethroat slittingstabbed to deathmixed martial artspoliticianstabbed in the chestexploding carno opening creditsanti heroone man armyassassinationchild in perilhit by a cardouble crossnews reportshot in the foreheadon the runlimousinefugitivemissionundercovercover upknocked outkicked in the facedeath of childbodyguardwigpremarital sexsilencerespionageciasubtitled scenechild murderak 47falling down stairshead buttassassination attemptsexual abusesecurity cameraloss of loved onekicked in the stomachnosebleedpress conferenceparking garagemexican standofffemale killerstealing a carstabbed in the throatgash in the faceshot in the facementorstabbed in the leghit on the headpunched in the chestsafedark heroaccidental killinge mailundercover agentsocial workerbody countswitzerlandnewspaper clippingpolitical corruptionmoscow russiafemale assassintext messagingshot through a windowvillain played by lead actorcia agenttaserhiding in a closetfake identitycomputer crackerdronefemale spyembassyambassadorcorrupt politiciancar set on firehit with a shovelrogue agentdeath of familypresidential candidatecamera phonetramwar criminalmonth in titlecoming out of retirementsafe deposit boxflash drivethrown through a windshieldshipping containerwearing a sound wirechechnyaairbaginternet cafeex cia agentchild prostitutedriving licencemontenegrobelgrade serbiacell phone trace (See All) |
After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu β¦rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)
Subgenre: | black comedysuspense |
Themes: | psychopathmurderdeathfriendshiprevengekidnappingbetrayaljealousydrinkingescapeinvestigationvoyeurismdeath of fatherparanoiaphotography β¦panicmurder of a police officer (See All) |
Mood: | neo noirhigh schoolslasher |
Locations: | swimming poolcarbicyclepolice carcourtroomrooftopstormfishing boat |
Characters: | father son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyteenage boyteacherserial killerstudentpolicemandancerwriter β¦police detectivevillainterrorcousin cousin relationship (See All) |
Story: | woman in jeopardybreaking and enteringwitnessbloodviolenceone word titledoggunkissfightdancingtitle spoken by characterpartyknifechase β¦telephone callcell phonecorpseblood splatterfoodcar accidentpunched in the facewatching tvcomputerdrinkarrestbikinibookplace name in titlerunningdead bodybathroomneighborhandcuffsvoyeurclassroomswimmingnewspapervideo camerawomaneatingimpalementstabbed to deathstabbed in the chestjudgesevered headtrialfishingduelflash forwardbinocularssuburbmissing personevil manreadingrabbitbaseball batlightningskeletonpranklong takescarwighigh school studentstalkingbasementneck breakinggardenclassobscene finger gesturesubtitled scenegaragemaniacflirtingtv newsteen angstlistening to musicsociopathcaptiveassaultpsychoskullparking garagebroken legrampagebarefootwindtelescopethunderspanishbroken glassshovelscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreereckless drivingchocolatexboxpsychopathic killerbad guyearphonesmadmanboredomclosetlaundryhuman monsterhomicidal maniaccoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostlawn mowerchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All) |
A blind girl gets a cornea transplant so that she would be able to see again. However, she got more than what she bargained for when she realised she could even see ghosts. And some of these ghosts are down right unfriendly. So she embarks on a journey to find the origins of her cornea and to reveal β¦ the history of the previous dead owner ... (Read More)
Subgenre: | supernatural horrorasian horror |
Themes: | blindnessdeathsuicideghostsupernatural powercancerforgiveness |
Mood: | nightmare |
Locations: | hospitalcemeteryelevatorkitchen |
Characters: | mother daughter relationshipboygirlsister sister relationshipuncle nephew relationshipgrandmother granddaughter relationshipdoctor patient relationship |
Story: | loss of eyesightwoman in jeopardyflashbackexplosionbased on true storyfirevoice over narrationmirrorremakehallucinationbedroomconcertexploding carperson on firehanging β¦tragic eventsurgeryslow motionjumping from heightfatetensionvisiondead childalternate realitydisfigurementexorcismviolinistblindcroweyetraffic jamhallwaypsychic powertraffic accidentbus rideconductorburn victimimmolationblind girlclairvoyanceable to see the deadhorror movie remadechild suicidevirtualityprecognitioneye surgerygas leakeye transplantchain reactiontransplantationcorneal transplantstring ensembleeye operation (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | independent filmsuspenseamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
Themes: | home invasionpsychopathmurderdeathtortureescapebrutalityinsanitysadismevilexploitationcrueltymurder of a police officer |
Mood: | gorenightslasherblood and gore |
Locations: | strip clubtrying to escape |
Characters: | husband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlserial killerhostagethiefkillervillainterrorself mutilationtalking to oneself in a mirrormysterious villainthe family β¦mysterious killerkiller dogdirector of photography (See All) |
Story: | woman in jeopardythreatened with a knifefemale nuditycharacter name in titlebloodviolencebare breastsfemale frontal nudityflashbacktwo word titlefightcigarette smokingnipplesknife β¦lesbian kisssurprise endingpistolbeatingcorpseblood splattermirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbingimpalementstabbed to deathstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manscreamactor shares first name with characterisolationneck breakingtrapfirst partex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationpsychocovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten aliverampageburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathbutcherygrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
The teacher Gail Hartman is facing problems with her marriage with her husband, the workaholic architect Tom Hartman. On the birthday of their son Roarke, Gail decides to leave her daughter with her parents and take her family to raft down a wild river where she was a guide. On the departure, a youn β¦g man named Wade befriends Roarke and leaves the place with his friends Terry and Frank. Later the family encounters Wade and Terry, who do not have rafting experience, and Gail helps them to cross a whitewater. They get closer to the family and soon Gail and Tom learn a dark secret about Wade and Terry. What will they do to get rid of the men? (Read More)
Subgenre: | black comedysuspenseheist |
Themes: | psychopathmurderkidnappingmoneyfeardeceptionhumiliationpaniccamping |
Locations: | foresthelicopterwoodscavecampfire |
Characters: | husband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipserial killerhostagethiefdeafness |
Story: | psychological torturewoman in jeopardydoggunfightcigarette smokingknifepistolcryingbeatingshot to deathfistfightshot in the chestface slapbrawl β¦showdownheld at gunpointrevolverrivercriminalfoot chaseflashlightgangchild in perilunderwater scenepolice officer killedstalkerorganized crimetenttough girlstalkingtied upstrong female charactermaniacsociopathcaptivewalkie talkiearchitectstrong female leadfight to the deathboston massachusettsdeath threathousewifeescape attemptextortionsign languagepsycho killervillain played by lead actorbag of moneybarking dogrobbercanoecomic reliefdegradationfemale victimrock climbingchild abductionwoman in dangerestranged fathermysterious strangerdeeply disturbed personchild killerfamily in dangerpark rangerplan gone wrongmurderer duowet jeansraftingestranged husbandwhite water raftingkidnapped wifeman versus nature (See All) |
A city is ravaged by an epidemic of instant "white blindness". Those first afflicted are quarantined by the authorities in an abandoned mental hospital where the newly created "society of the blind" quickly breaks down. Criminals and the physically powerful prey upon the weak, hoarding the meager fo β¦od rations and committing horrific acts. There is, however, one eyewitness to the nightmare. A woman whose sight is unaffected by the plague follows her afflicted husband to quarantine. There, keeping her sight a secret, she guides seven strangers who have become, in essence, a family. She leads them out of quarantine and onto the ravaged streets of the city, which has seen all vestiges of civilization crumble. (Read More)
Subgenre: | post apocalypsedystopiaallegory |
Themes: | blindnessmurderdeathrevengesuicidemarriageinfidelityrapemoneyvoyeurismtheftbrutalityillnessexecutiongreed β¦crueltypanicdyingapocalypsevengeancestarvation (See All) |
Mood: | rainavant gardedarkness |
Locations: | hospitalbarchurchhotelwatertaxielevatorurban settingtaxi drivercar theftcar thiefbus accident |
Characters: | husband wife relationshipfamily relationshipspoliceafrican americandoctorchildrensingerboyprostitutesoldierpolice officerpolicemanthiefinterracial relationshipjapanese β¦asianterror (See All) |
Story: | loss of eyesightfemale nuditybased on novelbloodmale nudityfemale frontal nuditymale frontal nuditymale rear nuditydogbare chested malegunsex scene β¦kissfemale rear nudityfighttitle spoken by charactersingingsurprise endingpistolshowertelephone callfirevoice over narrationcryingcell phonesongbeatingcorpseshot to deathblood splatterfoodmachine gunshot in the chesturinationface slapshot in the headundressingbare buttshootingrifleheld at gunpointtearssunglassescar crashdead bodysex standing upprostitutionmale pubic hairsubjective camerasurvivalwinecandleambulancestabbingmontageeatingweaponassassinationbathcoffeebartendergunshotgravebeaten to deathprologueperson on firesuitcaseisolationobscene finger gesturesubtitled scenepowerblack americantv newsdestructionburned alivelistening to musicrace relationssurvivordiseaseragevandalismcheating husbandburialmoralitygas maskguardstealing a carinnocencemobile phonestabbed in the throatchaosstabbed in the neckshovelscissorscigarette lighterdiscriminationbathingairplane crashinfectionblind maneye patchbigotryextortiondictatorsmokedormitorybriberybarbed wiremenstruationmedical maskepidemicbreadplaguedegradationtraffic jampharmacyanarchywetting pantslistening to radiofallingroadblockbleedingblind womann wordsurrogate motherquarantinegropingstabbed in the facedigging a graveexploding airplanepeep holeman with no namemedical professionextreme close upintercomleg injurytotalitarianismdepravitystabbed with scissorssurrogate fatherdrugstorearmageddonbechdel test failedcaught in the actsao paulo brazildevastationtraffic lightwalking stickhazmat suitransackingmatchessurrogate soncontagionrationingdark glasseshelplessnessinfectious diseasesense of sightblind childstepping in shitkicked in the shintransistor radiopretending to be blindsqualoreye examhospital wardmontevideo uruguayvisual impairmentgun sightdeserted cityeye doctorregaining sightfood rationingsmashing a tv setanimal licking someonetv control boothblind leading the blind (See All) |
Heading home late one night after a party, Kate falls asleep while waiting for her train. She awakens to find herself trapped in the London underground, with all the doors locked for the evening. While being attacked by a co-worker who has followed her, a mysterious unseen creature drags him away an β¦d kills him. This begins a terrifying ordeal, as Kate and a young homeless couple are stalked through the dark tunnels by something dangerous with payback on its mind. (Read More)
Subgenre: | british horror |
Themes: | psychopathmurderrapetortureescapemonsterinsanityillnesscannibalismabortionfear of sex |
Mood: | goreslasher |
Locations: | trainlondon englandenglandtunnelsewertrain tunnel |
Characters: | female protagonistserial killersecurity guardself mutilationacquaintance |
Story: | breaking and enteringthreatened with a knifebloodviolenceone word titledogbare chested malefightcigarette smokingphotographknifechasesurprise endingbeatingcorpse β¦blondepunched in the facefalling from heightflashlightstrangulationthroat slittingimpalementstabbed to deathsubwaydrug addictbeaten to deathknocked outattempted rapedisappearancestalkingneck breakingtrapratdismembermentsurgeryundergroundcagesurvivorsecurity cameracovered in bloodfaked deathpuzzlecrushed to deathpresumed deadrednecktrappedgash in the facepunched in the stomachstabbed in the headhit on the headautopsyeye gougingstabbed in the eyebruisesodomycellarserial murdervideo surveillancehead woundhuman monstersubway stationescalatorunited kingdomhospital bedhead bashed inheld captivelocked doorcrushed headhallwaybleeding to deathsole black character dies clichedisfigured facehomeless persondeformitystrangled to deathchainsdragging a bodypeep holestupid victimgrindhouse filmsheltercandlelightno endingtrail of bloodsubway trainpower failurepretending to be deadsliced in twonight watchmanintoxicationmidnight movierape attemptstabbed in the crotchwalking caneabortion clinicrubber glovesvagrantlondon undergroundunderground tunnelthrown from a trainreference to george clooneysubway tunnelfingernail cut offcrawling through an air shaftblood drainingskin torn offfetus in a jarcut headventbreaking someone's neckhorror moviethe unknown (See All) |
Martin Bishop is the head of a group of experts who specialise in testing security systems. When he is blackmailed by Government agents into stealing a top secret black box, the team find themselves embroiled in a game of danger and intrigue. After they recover the box, they discover that it has the β¦ capability to decode all existing encryption systems around the world, and that the agents who hired them didn't work for the Government after all... (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracyheistcaperheist movie |
Themes: | blindnesshome invasionsurveillancemurderfriendshiprevengekidnappingchristmasmoneybetrayalfeardrunkennessescapedancedeception β¦voyeurismseductionextramarital affaircorruptionparanoiaredemptionexecutionpanictechnology (See All) |
Mood: | car chase |
Locations: | barrestaurantswimming poolsnowelevatorkitchenapartmentofficerooftoprussiasan francisco californiatunnelchinese restaurant |
Characters: | husband wife relationshippolicehostagesecurity guardprofessorrussianhomeless manjapanese americancomputer datingformer best friend |
Period: | 1990s1960syear 1969 |
Story: | breaking and enteringone word titleflashbackdogdancingpartyknifechasesurprise endingpistolshot to deathmachine guncar accidentshot in the chestshotgun β¦rescuewatching tvcomputerwritten by directorarrestkissingshowdownheld at gunpointsunglassescar crashinterrogationpianovoyeurrevolvertelephonespyflashlightambushdisguisemontagebridgeman with glassesanti herodouble crossvannews reportshot in the legracial sluron the runflash forwardattempted murderlimousineorganized crimebinocularsdangerprologuefbifugitiveproduct placementrace against timecover upknocked outchristmas treecollege studentbankconvertiblebodyguardinjectionlaptopsuspicionex convictnewspaper headlinehenchmanpizzaeavesdroppinganswering machinesabotagehypodermic needleheavy raintape recordersociopathscene during opening creditssecurity camerawalkie talkiefbi agentvideotapeblockbusterfaked deathsocial commentarypresumed deadtrappedconstruction sitecynicismbackpackintrigueburglaryimpostorframe uppolice raidblind manlens flaresports carframed for murdervideo surveillancemagic trickbreak inhackerfinal showdownbag over headpistol whipfake identitystairwayalarmbeggarcomputer crackerworld dominationmathematicsintelligencetrashmegalomaniacold flamefish tankponytailsecuritybody in a trunkcomputer hackerpurseembassyforeplayambassadorbaseball capblizzardbusiness cardoffice workermacguffinpondfight the systemtop secretteamworkcamcorderhigh techcamouflageorchestral music scoreoverturning carrogue agentpasswordgolden gate bridgenew world orderwanted posterelevator shaftscrabbledelivery boyknocked out with a gun buttwiretappingphonographcat and mouse555 phone numberbank vaultbritish actor playing american charactermicrochipnsaconspiracy theoristsuitcase full of moneyultrasoundmanor housesafe deposit boxsecrecysuper computermathematicianpiano teacherplanningwearing a sound wiresource musicgeesekaraoke barbody in trunkrecruitinglicense plateair ductmaster of disguisebraillepost cold warair conditionerstring quartetex cia agentmoney transferd box motion codedriving in reverseman with a ponytailcrawlspacecryptographywinnebagoanagramtemperaturefriend turned foepartnersdemandnsa agentvideo manipulationblack boxelectronics experttoy factoryencryptioncoin trickmotion sensorclassical concertcomputer fraudgreased back hairkey cardleitmotifblind driverhelium inhalationsecurity expertmathematical geniuscryptographer (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | cult filmcoming of ageblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof |
Themes: | home invasionpsychopathmurderdeathfriendshiprevengeinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcebrutality β¦death of motherparanoianear death experiencedeath of daughter (See All) |
Mood: | goresatirehigh schoolslasherdarkness |
Locations: | forestsmall townwoodskitchenpolice stationschool bus |
Characters: | husband wife relationshipfamily relationshipsfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistserial killervillainsheriff β¦single fatherslasher killerself referential (See All) |
Period: | 1990s |
Story: | psychological torturethreatened with a knifef ratedbloodviolenceone word titlebare chested malecigarette smokingtitle spoken by characterpartyknifechasesurprise endingpistolfire β¦cell phonecorpseshot to deathblood splattercar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalfoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partcult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidwrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
A well respected Chicago surgeon Dr. Richard Kimble has found out that his wife, Helen, has been murdered ferociously in her own home. The police found Kimble and accused him of the murder. Then, Kimble (without Justifiable Reason) was tried, convicted, and sentenced to death. However, on the way to β¦ prison, Kimble's transport crashed. Kimble escapes and is now on the run. Deputy Samuel Gerard from Chicago takes charge of the chase of Kimble. Meanwhile, Kimble takes up his own investigation to find who really killed his wife, and to lure Gerard and his team into it as well. (Read More)
Subgenre: | martial artssuspenseconspiracymedical |
Themes: | home invasionsurveillancepsychopathmurderdeathinfidelitymoneybetrayaldrunkennessescapeherodeceptionrobberycorruptionparanoia β¦drug useguiltabductiongreeddeath of wifemurder of a police officerprison escapeescape from prison (See All) |
Mood: | raincar chasenight |
Locations: | hospitaltrainforesthotelhelicoptersnowsmall townbuselevatorpolice stationpolice carlakerooftopchicago illinoisusa β¦tunnelsewerbus accidentprison buspolice helicoptertrain explosion (See All) |
Characters: | husband wife relationshippolicedoctorserial killernursehostagethieftough guyaction heropolice detectivepsychiatristsheriffpolice shooting |
Period: | 1990swinter |
Story: | threatened with a knifebloodflashbackbare chested malefightcigarette smokingphotographtitle spoken by characterexplosionchasesurprise endingpistolfireshootoutbeating β¦dreamcorpseshot to deathblood splatterfistfightshot in the chestremakeshotgunslow motion scenepunched in the facecomputerarrestgunfightbrawlfalling from heightshowdownheld at gunpointjailhandcuffsrevolvershot in the backfoot chasenewspaperassassindisguiseambulancedrug dealerbridgeweaponsubwayfalse accusationjudgedisarming someonedouble crosspolice officer killedvancigar smokingon the runattempted murderhotel roombased on tv seriesbeaten to deathpay phonefugitiveundercovermistaken identityrace against timecover upringcourtscarspeechinjectionautomobilebasementsuspicionsemiautomatic pistolex convictcorrupt copfalling down stairsstreetbeer drinkingtape recorderwalkie talkieloss of loved onekicked in the stomachblockbusterpress conferencejumping from heightparadecompassionmechanicjanitorprison guardhit in the crotchmanhuntpunched in the stomachheadphonesmedicationblack and white sceneawardblood on shirtconvicttough copsnowingpolice raidsurgeonreckless drivingframed for murdernews reporterbriberyhit and runlaundryneedletasersubway stationtelephone boothcomputer crackerglockx rayclimbing through a windowescaped convictknocked unconscioushead bashed instakeoutdeath rowdamdruggedscene of the crimeconventiondeath penaltymarching bandwrongful convictionwalkingseizuremicroscopecop killerillinoisbased on tv showmugshothitchcockianoverhead camera shotgarbage truckneck braceknocked out with a gun buttmiscarriage of justicelogballroomhostage situationfederal agentred herringsittinghit by a trainfalling off a rooffoot pursuithit with a chairel trainhostilityu.s. marshalprosthetic limbrailroad crossingphoto boothblockadereceptionfake idskylinetrain crashpharmaceutical companysearchlightexploding busone armed manplanting evidencesentenced to deathwet jeanshandcuffed to a pipepolice departmentreference to peter pancontrol roomescapeechain link fencepolice escortescape from custodysound recordingoffice workstorm drainpanhandlingbulletproof glassprosthetic armhiding in a bathroomprosthetic body parthit with a metal pipefalling through a rooftop windowflip bookst. patrick's dayarm amputationfalling through a glass rooforganismrunning into a treetracing a telephone callcorrupt lawyerfalling down a shaftprosthesisapplication formbeneficiaryknocked down stairsmaking a scenehusband suspected of murdering his wiferenting a roomsanitationsound recorderradiologycomputer databaseemergency brakex ray imageelevated trainhiding in plain sighthusband suspected of killing his wifekicking in a windowlistening to a tape recordingorange peelchicago skylinecrash victimpicture of suspect (See All) |
An intertwined drama about the United States' war on drugs, seen through the eyes of a once conservative judge, now newly-appointed drug czar, his crack-addicted daughter, two DEA agents, a jailed drug kingpin's wife, and a Mexican cop who begins to question his boss's motives.
Subgenre: | epic |
Themes: | surveillancemurderdeathkidnappingmarriagedrugspoliticspregnancytortureescapefuneralcorruptiondrug usedrug addictionpolice corruption |
Mood: | high school |
Locations: | swimming poolhelicopterdesertcourtroommexicogay barcar explosioncar bombmexico city |
Characters: | policefather daughter relationshipteenage girlhitmaninterracial relationshipsniperold friend |
Story: | drug dealingwitnessviolenceone word titleflashbackinterracial sexchasecell phoneremakearrestshootingmarijuanaprostitutionhandcuffsclassroom β¦criminalshot in the backf wordassassincaliforniawomancocainejokejudgeassassinationdrug addictorganized crimebased on tv seriessuburbthreatsilencerteenage sexheroinwashington d.c.runawayloss of frienddrug abusepress conferencewhite housebreakfastinterracial friendshipgun battledrug overdoseattorneyensemble castghettobulletproof vestmeetingstolen carmultiple storylineplastic surgerydrug smugglinggolf clubinformantdrug traffickingpoisoningteenage daughterrehabilitationmercedes benzdirector also cinematographersan diego californiashot in the footcorrupt officialcrack cocainedrug cartelalcoholics anonymouswiretappingu.s. mexico bordergrave diggingmultiple perspectivesensemble filmmexican borderrunaway childinterlinked storiesteenage prostitutionfood poisoninglemonadedrug rehabilitationtijuana mexicosexual favorcincinnati ohiodrug wardrug ringcolumbus ohioman on the verge of tearscrack housedrug courierel paso texas12 step programcolor filtergeorgetown washington d.c.remunerationla jolla california (See All) |