Please wait - finding best movies...
In Boston of 1691, a warlock is sentenced to death, but escapes magically into the future (our present), followed doggedly by the witch hunter. There he is searching for the three parts of the Devil's Bible, trailed by the witch hunter and the woman whose house he landed in. They must stop him, as t β¦he book contains the true name of God, which he can use to un-create the world. (Read More)
Subgenre: | cult filmindependent film |
Themes: | book of magicexecutiontime travelsupernatural powerbrutalitymagicdeathmurder |
Mood: | gore |
Locations: | airportdesertlos angeles californiacemetery |
Characters: | waitresshusband wife relationship |
Period: | 17th century1980s |
Story: | bonneville salt flats utahsalt watersevered tonguepersonification of satanpremature agingevil markweathervanewitch hunterfoot torture1690smennonitetrailer narrated by percy rodriguezinsulinwarlockamish β¦spiritualismcompasscasketsaltcrashing through a windowfinger cut offeyeballcoloradosatanismseancespellpastorboston massachusettssevered fingerwhipwitchcraftlifting someone into the airbarnburned aliveflyingchild murderoccultfarmerringbraceletlightningevil manfirst of seriesperson on firegraveyardtonguecoffinimpalementbookfalling from heighthorsechasecharacter name in titleviolence (See All) |
A new girl moves to a new city with her family to start a new life. She meets up with the girls who are very interested in the occult and together, the four of them have a seemingly unstopable power. They can do anything, from getting thier dream guys to like them to... the possibilities are limitle β¦ss. (Read More)
Subgenre: | cult filmcoming of ageblack comedyteen movie |
Themes: | book of magicsupernatural powermagicmurderfriendshiprevengesurrealismsuicidedeceptionracisminsanity |
Mood: | high schoolnightmare |
Locations: | airportlos angeles californiabeachchurchswimming poolairplanebustaxiwoodslaboratory |
Characters: | father daughter relationshipteenagerfemale protagonistlawyerbest friendbullywitchself mutilationsingle fatherhomeless manstepmother stepdaughter relationshipevil witch |
Period: | 1990s |
Story: | crashing through a windowsatanismspellwitchcraftoccultlightningflashbackphotographexplosionpartyknifeshowerfiremirror β¦hallucinationcandlemansionsnakehit by a carnews reportracial slurspiritualityattempted rapehigh school studentdeath of husbandheart attackfemale stockinged legsteen angstheavy rainoverallsmental institutionvisionfemale leadbutterflyblack magictelekinesisfemale stockinged feetgothlevitationoutcastfemale bondingjukeboxbully comeuppancewrist slittingjockkarmamaggotgoth girlpower strugglewish fulfillmentcliquesockscovenlife insurancehair lossslandervirtualitymirror does not reflect realityreference to pubic hairteenage witchhereditary gift of witchcraftfrench languageprep schoolmirror as portalwhite socksdriven madluxury apartmentlove spellfemale feet in socksinjection in buttwhite magic (See All) |
300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. β¦.. (Read More)
Subgenre: | cult film |
Themes: | book of magicsupernatural powermagicrevengeghostfearangerhumiliationunrequited lovefalling in love |
Mood: | high school |
Locations: | cemeterymotorcyclemuseumsewer |
Characters: | brother sister relationshipteenage girlteenage boyzombiesister sister relationshiplittle girlbullywitchevil witch |
Period: | 17th century1990s1700s |
Story: | saltspellsevered fingerwitchcraftlifting someone into the airburned alivetwo word titlecigarette smokingtitle spoken by charactersingingsurprise endingfirecryingcatbed β¦subjective cameradecapitationgood versus evilhalloweencandlehousetied to a chairtransformationpainvirginproduct placementdeath of childscreamscene during end creditshanginghalloween costumecabinhaunted houseundeadfalling down stairstalking animalhatspidertorchrejectionimmortalityhypnosischairhalloween partyarrogancemale virgincandydead animaltrick or treatingdoubtlighterbicyclingtombstonecottageshoerhyme in titlecabin in the woodssunrisepotionwarningnoosebus rideblack catpillowlobsterwitch costumeliquidhorror for childrenvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumelifting a female into the airroadkillcaged humanspit taketalking catchased by a dogevil laughterpet foodblown coverflying broomcurseddisbelieving adultlightingsiren the alarmsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettsmagical broomstickwitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All) |
Robert and Katherine Thorn seem to have it all. They are happily married and he is the US Ambassador to Great Britain, but they want nothing more than to have children. When Katharine has a stillborn child, Robert is approached by a priest at the hospital who suggests that they take a healthy newbor β¦n whose mother has just died in childbirth. Without telling his wife he agrees. After relocating to London, strange events - and the ominous warnings of a priest - lead him to believe that the child he took from that Italian hospital is evil incarnate. (Read More)
Subgenre: | paranormal phenomenasupernatural horrorchristian horror |
Themes: | supernatural powerdeathmurdersuicidereligionfearfuneralinvestigationgriefadoptiondeath of wifedevildeath in childbirththe devil |
Mood: | gore |
Locations: | cemeteryhospitalchurchlondon englandkitchencavegas stationstormcatholic churchairplane trip |
Characters: | husband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipchildrenboypolicemanphotographerbabypriestchristianitylittle boybibleamerican abroad β¦catholic priestsuicide by hanging (See All) |
Period: | 1970s |
Story: | trailer narrated by percy rodriguezcasketlifting someone into the airchild murderoccultlightningfirst of seriesgraveyardcoffinimpalementfalling from heightviolenceblooddogtwo word title β¦gunphotographknifesurprise endingslow motion scenedemonreference to jesus christdecapitationgood versus evilorphansevered headnunchild in perilbirthday partygravestalkerpossessionu.s. presidentskeletonhangingamerican flagfirst partnewspaper headlinefireplacebulletgothicrome italyloss of wifevillainessblockbustermonkanimal attackreincarnationstabbed in the throatmillionairezoobroken glassreference to satanbible quotedeath of protagonistbody landing on a cardemonic possessiondead woman with eyes opendaggerexorcismnewspaper clippingmiscarriagenannygothbeheadingmysticismmonasteryjerusalemambassadorunsubtitled foreign languagemoving infamous scoredarkroomdisfigured facedead wifealtardog attackdiplomatburn victimantichristevil childexorcistbirthmarkdeath by hangingarmageddonluciferbible prophecygovernesstricyclerottweilerchild murdererlifting male in airdevil worship666english accentomendeath by impalementhorror movie remadearcheological digbaboonbook of revelationpushed down stairscharacter appears on front page of a newspaperfacial disfigurementswitched at birth5 year oldends with funeralstillborn childphotograph in newspaperevil dogbaby switchjackalflatbed trucklightning rodends with a quotepaternosterreligious sacrificeamerican ambassadorphotography darkroompublic suicide (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β¦ you? (Read More)
Subgenre: | cult filmindependent filmslasher flickteen movieteen horroramerican horrorindependent horror |
Themes: | supernatural powermurderrevengesurrealismfuneralpsychopathevil |
Mood: | gorehigh schoolnightmareavant gardeslasher |
Locations: | cemeterybathtubpolice station |
Characters: | husband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain β¦serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | finger cut offsevered fingerlifting someone into the airburned aliveevil manfirst of seriesperson on firefalling from heightviolencebloodbare chested malecigarette smokingsurprise endingdreamcorpse β¦blood splattermirrorface slapslow motion scenearrestbeddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeecharacter's point of view camera shothangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairselectronic music scoregothichatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladebutcherheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | cult filmindependent filmblack comedysuspensedark fantasychristian horrorreligious horror |
Themes: | supernatural powerbrutalitydeathmurdersurrealismkidnappingreligionbetrayaljealousyfearescapefuneralinvestigationdeceptionpsychopath β¦paranoiadepressioninsanitysadismevilhopepanicdyingapocalypsecannibalismhomelessnessdevilmurder of a police officernear death experienceghost townreligious conflict (See All) |
Mood: | goreneo noirarchive footagedarkness |
Locations: | desertlos angeles californiacemeteryhospitalschoolchurchsmall townapartmentpolice stationpolice carrooftopcatholic churchschool busschool teacher |
Characters: | waitresspoliceteacherzombiegirlsoldierpolice officernursedetectivepolicemanpriesthostagechristianlittle girlnative american β¦christianitypolice detectiveteacher student relationshipbiblesheriffgrandmother granddaughter relationshipcatholic priesthomeless mancoronerdeath wish (See All) |
Period: | 1990s |
Story: | personification of satanburned aliveevil manfirst of seriesperson on firegraveyardcoffinimpalementfalling from heightviolencebloodflashbackgunkissfight β¦cigarette smokingphotographtitle spoken by characterexplosionknifesurprise endingfirevoice over narrationcryingbeatingcorpseshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewritten by directorbrawlshowdownheld at gunpointsunglassesdead bodydemonhallucinationhandcuffsprayerrevolvershot in the backgood versus evilsurvivalorphanflashlightcaliforniaambulancesuicide attemptdinerdisarming someonenarrationchild in perilhit by a carfictional wardouble crossritualpolice officer killedshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerliarmissionpossessionangelrace against timestatuecover upknocked outskeletonmanipulationexploding bodyfirst partprofanitygrandmothernewspaper headlinekillingundeadhenchmanpizzamaniacpickup truckelectronic music scoregothicshot in the stomachsociopathscene during opening creditsmorgueskullmind controlcolonelback from the deadcrime scenevisioncynicismcannibalmercilessnessresurrectionprophecyreference to satanbible quoteheavenhit on the headpunched in the chestjumping through a windowthrown through a windowautopsyaerial shotarizonachoirsoulhealingeye gougingtribebody landing on a cardemonic possessionkilling spreeburned to deathexorcismnewspaper clippinglyingarrogancetelepathyclose up of eyesgothporn magazineliving deadlevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyshamanburnt bodybadgemaggotsymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingchantingtauntingchild with a gungrand canyoncourt martialluciferinvulnerabilitysatanhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithpyrokinesiskorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintdark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All) |
The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum β¦mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)
Subgenre: | martial artsblack comedysupernaturalfairy talesword and sorcerysteampunkdark fantasy |
Themes: | supernatural powermagicdeathmurdersurrealismkidnappingbetrayalescapedeath of fatherdeath of motherabductionfalling in lovemissing child |
Mood: | gore |
Locations: | desertforestsmall townvillagewoodscity |
Characters: | policebrother sister relationshiphostagetough guyaction herovillainsniperwitchsheriffmayorsniper rifleself inflicted gunshot woundevil witch |
Story: | witch hunterinsulinspellwitchcraftburned aliveflyingfarmerperson on fireimpalementfalling from heightchasecharacter name in titleviolencefemale nuditynudity β¦bloodflashbackbare chested malegunfemale rear nudityfightphotographexplosionknifepistolfirevoice over narrationpunctuation in titlebeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlshowdownrifleheld at gunpointhand to hand combatinterrogationcombatshot in the backf worddecapitationgood versus evilcleavageorphanassassinsword fightambushaxemassacrestabbingstabbed to deathcolon in titlestabbed in the chestsevered headanti herochild in perilritualpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backmissionrace against timeknocked outtough girlopening action sceneattempted rapeshot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowhead buttgothicslow motioncatfightstabbed in the stomachbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassintaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionmoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | cult filmmartial artscoming of ageblack comedysuspensesupernaturalheist |
Themes: | supernatural powerdeathmurderfriendshiprevengesurrealismsuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of father β¦paranoiasurveillanceevilhome invasionpanic (See All) |
Mood: | gorenightmare |
Locations: | airportcemeteryschoolchurchairplanelondon englandtaxipolice stationshiprooftopcatholic church |
Characters: | father daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest |
Period: | 2000s |
Story: | crashing through a windowburned alivelightningevil manperson on firecoffinimpalementfalling from heightchasecharacter name in titleviolencesexnumber in titlebloodflashback β¦bare chested malegunfightphotographexplosionpartyknifelesbian kisssurprise endingpistoldreamcorpseshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendthroat slittingstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headdouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyproduct placementrace against timeknocked outkicked in the facecollege studenthangingsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfrevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Subgenre: | cult filmindependent filmsuspensefairy talepost modernpsychological thriller |
Themes: | supernatural powerbrutalitydeathmurdersurrealismkidnappingfearescapefuneralmonsterfilmmakingdeceptiondeath of fatherparanoiacourage β¦near death experience (See All) |
Mood: | gorenightmareslasher |
Locations: | los angeles californiacemeteryhospitalswimming poolcarwaterwheelchairtrucksinging in a cartruck accident |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboypolice officerserial killernurseactorpriesthostageactresssecurity guarddirectormaid β¦film directorself referentialcoroner (See All) |
Period: | 1990s |
Story: | severed tonguelifting someone into the airburned aliveperson on firetonguefalling from heightchaseviolencebloodsequelinterviewexplosionknifesurprise endingfire β¦cell phonedreamcorpseblood splattercar accidentblonderescueslow motion scenepaintingvomitingshowdownsunglassesrunningbedcar crashdemonhallucinationtelevisiontelephonegood versus evilfoot chaseambushcaliforniastrangulationmansionstabbingdeath of friendwidowstabbed to deathstabbed in the chestsnakebrunetteno opening creditsdream sequencechild in perilhit by a carnews reporttransformationcoffeeparkattempted murderlimousinestalkercharacter repeating someone else's dialoguescreamingcharacter's point of view camera shotactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarinjectionstalkingfilm within a filmexploding bodydeath of husbandneck breakingactor playing himselfanswering machineelectronic music scorewoundhypodermic needleslow motioninjurybabysittermorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundstabbed in the throatmovie setstabbed in the legfilm settitle at the endalternate realityeye gougingdisfigurementstabbed in the eyefemale doctordemonic possessionfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectshiding in a closetstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All) |
The beautiful and kindhearted princess Snow White charms every creature in the kingdom except one - her jealous stepmother, the Queen. When the Magic Mirror proclaims Snow White the fairest one of all, she must flee into the forest, where she befriends the lovable seven dwarfs - Doc, Sneezy, Grumpy, β¦ Happy, Bashful, Sleepy, and Dopey. But when the Queen tricks Snow White with an enchanted apple, only the magic of true love's kiss can save her. (Read More)
Subgenre: | fairy tale2d animationbased on fairy tale |
Themes: | book of magicmagicmurderdeathlovefriendshipjealousyescapedeception |
Locations: | forestcastlegermany |
Characters: | brother brother relationshipfemale protagonistvillainwitchstepmother stepdaughter relationship |
Period: | 19th century1810s |
Story: | spellwitchcraftlightningcoffinfalling from heighthorsechasecharacter name in titlef ratednumber in titlesingingmirrorgood versus evilassassindisguise β¦princesstransformationattempted murderdangerpoisonrabbitsleepingqueenprinceroyaltyhuntervillainesscrushed to deathappleanthropomorphismdwarfdiamondsoapanthropomorphic animalthunderstormdungeondeerturtleminekingdomblack magicowlcrowminingschemecrownsquirrelflyheiressfriends who live togetherminersorceressraccoonthronevulturebanishmentpick axesneezingmagical potionsneezesnow whitecape the garmentevil queenyounger brothermagical mirrormirror does not reflect realityolder brothercobwebevil stepmotherbrothers grimmcandlesticktalking to mirrorcandlelight vigildark powerdisney princessbluebirdpoison applewoodsmanthrone roomstorybook in opening shotglass coffinseven dwarvesdiamond minemouseholemythical kingdomspitewashing oneselfanimal senses evilsleeping potionsleeping princess (See All) |
The curse of the headless horseman is the legacy of the small town of Sleepy Hollow. Spearheaded by the eager Constable Ichabod Crane and his new world ways into the quagmire of secrets and murder, secrets once laid to rest, best forgotten and now reawakened, and he too, holding a dark secret of a p β¦ast once gone. (Read More)
Subgenre: | cult filmblack comedyfish out of watersteampunkdark fantasyamerican horrorsupernatural horrorgothic horroradult fantasy |
Themes: | supernatural powermurderrevengemarriageghostjealousyprisonpregnancytortureheroinvestigationgreedmurder of familyamerican revolutionamerican mythology β¦beyond death (See All) |
Mood: | gorenightmare |
Locations: | cemeterynew york citychurchfarmtowntown bully |
Characters: | husband wife relationshippolicedoctorserial killerdetectivebullywitchsniper rifle |
Period: | 18th century1700s |
Story: | spellwitchcraftlifting someone into the airchild murderoccultcoffinimpalementhorsebloodflashbacktitle spoken by characterfiredreamblood splattersword β¦decapitationsword fightaxestabbingsevered headchild in periltreelegendbased on short storycourtwighauntingloss of fatherblindfoldloss of mothercult directordismembermentsplattergothicfaintingspiderskullfaked deathcommunityveteranfight to the deathstabbed in the leghit on the headautopsypumpkinblack magiccrowtorso cut in halfhorseback ridingbeheadingscene before opening creditslast will and testamentevil spiritoutsidernaivetystepmothercornfieldpotionscarecrowfeverstabbed in the shoulderwindmillorchestral music scorerepeated linescytheman with no namejack o'lanterncontrolexpressionismbeetleflintlock pistolstagecoachsliced in twocardinal the priesttorture chamberheadextreme closeuphuman skullhorsemanjealous boyfriendmysterious eventsbased on legendconstablemagistratefainting manhorseback1790sdedicationnotarysororicidethrowing a knifegerman expressionismiron maidenjealous manjealous ragegeorgian eraheadlessarachnophobiaheadless horsemanportal to helldown blousedragged by a horseoptical illusionhorseback chasecovered bridgeknife in the thighkiss of deathamerican literatureflock of sheepflying batcostume horrorjumping from a moving vehicleautopsy roomman faintingquill pensleepy hollow new yorkmarriage certificatereference to washington irvingsharpened teethamerican folkloregathering woodgeorgian fashionlegendary characterlevitatingreference to ichabod cranereference to the legend of sleepy hollowwashington irvingchases on horsebackrecapitationshakingankhdesaturated colorsplaying a violinspinning camera shotwax sealdoor in the floorhessianjealous suitorparent killed in front of childtricome (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | cult filmindependent filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
Themes: | supernatural powerbrutalitydeathmurderrevengesuicidekidnappingghostfeartorturedrunkennesspsychopathdeath of fatherdeath of motherinsanity β¦evilabductiontraumafear of water (See All) |
Mood: | gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore |
Locations: | cemeteryforestsmall townpolice stationlakeschool nurse |
Characters: | father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β¦serial murderer (See All) |
Period: | 2000s |
Story: | severed fingerlifting someone into the airburned alivechild murderevil manperson on fireimpalementfalling from heightcharacter name in titleviolencebloodsequelflashbackphotographexplosion β¦partysurprise endingpistolshowerfirevoice over narrationdreamcorpseblood splatterslow motion scenebrawlmaskcar crashdemondecapitationfoot chasestabbingsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueelectrocutioncharacter's point of view camera shotcover updeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingundeadsplattermaniacheroinemass murdermachetecomaragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagenew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
On December 28th, 1999, the citizens of New York City are getting ready for the turn of the millennium. However, the Devil decides to crash the party by coming to the city, inhabiting a man's body, and searching for his chosen bride, a 20-year-old woman named Christine York. If he bears her child be β¦tween 11:00 PM and midnight on New Year's Eve, the world will end, and the only hope lies within an atheist ex-cop named Jericho Cane, who no longer believes in God because of the murder of his wife and daughter. (Read More)
Subgenre: | suspense |
Themes: | murdertortureheroredemptionfaithhome invasionself sacrificedevilmurder of a police officer |
Mood: | goreneo noirnightmare |
Locations: | cemeteryhospitalnew york cityrestauranttrainchurchhelicopterbathtubrooftop |
Characters: | policenursepriesttough guyaction herochristianitypsychiatristbiblecatholicdeath of hero |
Period: | 1990s1970syear 1999year 1979 |
Story: | severed tonguesatanismchild murderoccultperson on fireimpalementfalling from heightchaseviolencesexfemale nuditybloodthreesomeflashbackkiss β¦title spoken by characterpistolfireshootoutbeatingshot to deathblood splatterfistfighturinationshot in the headcatswordgunfightbrawlshowdownhand to hand combatdemonshot in the backgood versus evilambushthroat slittingsuicide attemptsubwaysnakeexploding carnunone man armyshot in the foreheadattempted murderone against manymissionpossessionchristmas treebodyguardchildbirthexploding bodysemiautomatic pistolsevered armshot in the armdismembermentloss of friendexploding buildingloss of wifenew year's eveend of the worldback from the deadwoman in jeopardyvisionreference to satandeath of protagonistbulletproof vestbody landing on a carrefrigeratordemonic possessionsevered legburned to deathfemale detectivegrenade launchermain character diesatheistcrucifixionpopeex coploss of daughtertemptationglockscene of the crimesaving the worldsole black character dies clichedirector also cinematographergropinghobopool of bloodchosen onelifting person in airman with no namedeal with the devilchrysler building manhattan new york cityprotectionshoulder holsterdoomhit by a trainluciferempire state building manhattan new york citysatanic ritualdevil worshipmorphingtrain crashmillenniumstigmatadead body in a bathtubhand through headhit squadnumber 666 (See All) |
The modern world holds many secrets, but the most astounding secret of all is that witches still live amongst us; vicious supernatural creatures intent on unleashing the Black Death upon the world. Armies of witch hunters battled the unnatural enemy across the globe for centuries, including Kaulder, β¦ a valiant warrior who managed to slay the all-powerful Queen Witch, decimating her followers in the process. In the moments right before her death, the Queen curses Kaulder with her own immortality, forever separating him from his beloved wife and daughter in the afterlife. Today Kaulder is the only one of his kind remaining, and has spent centuries hunting down rogue witches, all the while yearning for his long-lost loved ones. However, unbeknownst to Kaulder, the Queen Witch is resurrected and seeks revenge on her killer causing an epic battle that will determine the survival of the human race. (Read More)
Subgenre: | black comedyconspiracysupernaturaldark fantasychristian horror |
Themes: | supernatural powermagicmurderdeathrevengesurrealismkidnappingbetrayalprisontortureescapefuneralmonsterinvestigationdeception β¦memoryapocalypseblindnessvengeancenear death experiencemurder of family (See All) |
Mood: | darkness |
Locations: | new york citybarchurchsnowairplanetaxikitchenapartmentcavecatholic churchschool bus |
Characters: | waitresstattoosoldierpriesthostagetough guywarrioraction herobiblewitchcatholic priestevil witch |
Story: | witch hunterwarlockspellwitchcraftburned aliveoccultlightningcoffinimpalementfalling from heightviolencebloodflashbackfightexplosion β¦knifesurprise endingpistolfirevoice over narrationcell phonedreamcorpseshot in the chestshotgunrescuebattleswordshowdownheld at gunpointinterrogationhallucinationshot in the backgood versus evilassassincandlestrangulationaxemassacremountaindeath of friendstabbed to deathprisonerstabbed in the chestno opening creditsanti heroone man armyassassinationchild in perilfictional wardouble crosscreaturefemme fataleflash forwardtreecursestabbed in the backprologueattackmissionrace against timecover upopening action sceneshot in the shouldermanipulationbodyguardexploding bodythreatened with a knifequeenarsonstylized violencetraitorbow and arrowrevelationassassination attemptgothicheavy raincrucifiximpersonationirishmind controltorchend of the worldback from the deadbar fighteaten alivepresumed deadretirementcrime scenepump action shotgundamsel in distressreverse footageresurrectionimmortalitycigarette lighterdark heroheartaerial shotlonercanedark pastdressing roomtragic heroblack magicburned to deathtelekinesisteleportationtelepathyimprisonmentenglishman abroadsuffocationnarrated by characterillusionfire extinguisherstabbed in the handbongold dark housegiant monsterhitlerbrooklyn bridgegun held to headcomic reliefplaguesecret societyflycrystalgreenhousepocket watchbakerydruggedman kills a womanoffscreen killingmacguffinpotionfashion showaltered version of studio logosole black character dies clichetimes square manhattan new york citycathedralmaggotopen endedrighteous ragetragic pastdeath of familysubterraneancamera phonesymbolfemale bartendermind readingpentagrampenrookieglowing eyesheart in handmagic spellchrysler building manhattan new york cityregenerationselfiechantingdiscovering a dead bodybattle axedecomposing bodyenglishwoman abroadsecret doorsecret organizationchemistryarsenalman fights a womanrepressed memoryposseirongiant creaturehand through chestcherrycouncilcatwalkstalinalternate worldlucid dreamswarmstabbed through the chestinside the mindweather manipulationfacial cutshape shiftingbiographeraxe throwingnapoleonarsenicblowing smoke in someone's facehuman brandingsiamese catclose up of handflaming swordlife forcesword throwingrapid healingsnapping fingersgiant treeair hostessmental manipulationdead flystabbed through the backweapons cabinetblack plaguefalling down a holecircumscribed pentagramwoman wearing lingeriegummy bearman holding a babyswarm of flies (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r β¦eason too. (Read More)
Subgenre: | cult filmtragedy |
Themes: | supernatural powermagicmurderdeathsuicideghostfuneralangerdeath of mothergriefdeath of wife |
Mood: | gorenightmarenightdarkness |
Locations: | airportcemeteryhospitalschoolchurchcarairplanebathtubwoodsrural settingtrucknew england |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipzombiepriestlittle girllittle boysuicide by hangingfather in law son in law relationshipdeath of boy |
Period: | 1980s |
Story: | lifting someone into the airburned aliveperson on firecoffinviolencebased on novelbloodflashbackdogphotographexplosionsurprise endingfiretitle directed by femaledream β¦corpserescuepunched in the facewatching tvcatsecrettearsbedbathroomneighbortelephoneflashlightold mandeath of friendwomanweaponchildpantyhosepainconfessiongravehangingdeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonmoonfemale stockinged legsgothicinjuryhatloss of friendtoyhidingloss of wifedead womanback from the deadhitchhikingcamera shot of feetpromiseloss of sonpet dogresurrectionshovelpsychotronicdead childdeath of sisterdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeupscalpelhit by a truckhead injuryloss of childkitenooseloss of sisterkiller childmurder of wifeorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmainesuicide noteswinginghouse firepet catdeath of loverglowing eyesevil childairlinerscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead songrave robbingkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |
An anonymous, but deadly man rides into a town torn by war between two factions, the Baxters and the Rojo's. Instead of fleeing or dying, as most other would do, the man schemes to play the two sides off each other, getting rich in the bargain.
Subgenre: | cult filmblack comedychrist allegoryspaghetti westerncult classicrevisionist western |
Themes: | brutalitymurderdeathfriendshiprevengekidnappingmoneybetrayaltortureescapegangsterherodeceptionangercorruption β¦sadismhome invasiongreed (See All) |
Locations: | desertcemeterybarsmall townvillage |
Characters: | husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guywarriorlittle boyvillainsheriff |
Period: | 19th century |
Story: | casketwhipbarnevil manperson on firecoffinimpalementhorseviolencebloodbare chested malegunexplosionpartyknife β¦pistolfirecryingshootoutbeatingcorpseshot to deathblood splattermachine gunshot in the chestface slapremakeshotgunrescuepunched in the facecatbattlegunfightshowdownrifleheld at gunpointlow budget filminterrogationrevolverriveralcoholcriminalshot in the backsubjective cameragood versus evilgangambushmassacrearmystabbed in the chestanti herodisarming someoneone man armychild in perildouble crosspolice officer killedcigar smokingshot in the legbartenderone against manyorganized crimecowboyhorse ridingfirst partshot in the armhandgunwhippingcult directorarsonpowercrime bossmachismoeavesdroppinggoldmachetecowboy hatstrangerhonorcompassionmexicandamsel in distresstarget practiceu.s. armypsychotronicpunched in the chestlaughterdynamiteoutlawbooby trapwisecrack humorbulletproof vestknife throwinglonerbody countlaughingabusive husbandgatling gundriftergang warset upstreet gangspit in the facearms dealerquick drawundertakeranimal crueltywelldouble barreled shotgungunslingercowboy bootssaloonbellsawed off shotgunhand over mouthnihilismstreet fightcriminal ganggun duelkindnesswild westnoosefriends who live togetherfamous scoreoutlaw gangsix shooterpsychotronic filmcavalrygang leaderhouse firebarrelman hits a womangrindhouse filmman with no namewinchester rifletear on cheekbullet proof vestgrave diggingpower strugglerepeating riflehorse chasestagecoachcowboy shirtanimated opening creditsshoot outwestern townhostilityburning housecowboys and outlawsabandoned minegunpowdergang warfareman kills womanballadeermoney in titlechild knocked unconscioushero for hiremaverickarizona territorycovered wagonman murders a womanshooting a womanbullwhipponchosaved from hangingmurder of a womangang that lives togetherfalse informationsuspended by armsgun for hiregun holstermexican armyfake drunkennesscrawling on the groundman shoots a womannew mexico territoryarizona desertbell tollingriding at a gallopbellringereye swollen shutfording a riverfour against oneu.s. mexican borderpretending to be drunk (See All) |
Balthazar Blake (Nicolas Cage) is a master sorcerer in modern-day Manhattan trying to defend the city from his arch-nemesis, Maxim Horvath (Alfred Molina). Balthazar can't do it alone, so he recruits Dave Stutler (Jay Baruchel), a seemingly average guy who demonstrates hidden potential, as his reluc β¦tant protege. The sorcerer gives his unwilling accomplice a crash course in the art and science of magic, and together, these unlikely partners work to stop the forces of darkness. It'll take all the courage Dave can muster to survive his training, save the city and get the girl as he becomes The Sorcerer's Apprentice. (Read More)
Subgenre: | cult filmmartial artscoming of age |
Themes: | book of magicsupernatural powermagicdeathmurderlovesurrealismkidnappingbetrayalherodeceptionrobberyhome invasionself sacrificenear death experience β¦unlikely herobook of evil (See All) |
Mood: | car chase |
Locations: | cemeterynew york citytrainwatertaxielevatorapartmentpolice carcastlerooftopindialaboratorytunnelschool bus |
Characters: | teenagerteacherpolice officerstudenthostagetough guywarrioraction herowitchchinesegirlfriend |
Period: | 2000s2010s21st centuryyear 2010year 2000 |
Story: | crashing through a windowspellringlightningbookfalling from heighthorsechaseviolenceflashbackdogkissfightexplosionknife β¦three word titleshowerfirecell phonecar accidentmirrorrescuebattleswordletterpaintingshowdownhand to hand combatapostrophe in titlecar crashbathroomdemonmanhattan new york cityfightingcombatgood versus evilfoot chasesword fightstrangulationaxemassacredisguisedeath of friendmontagemixed martial artsstabbed in the chestsubwaysnakechild in perilritualroommatenecklacetransformationtrainingduelflash forwardparkprologueelectrocutionumbrellamissionpossessionproduct placementdragondollstatuetough girlcollege studentdatethreatened with a knifesacrificehenchmanpizzawolffireplacekilling an animalwhat happened to epiloguegothicheavy rainquestfaintingrome italyhatmagicianloss of loved oneeccentricimpersonationchefjumping from heightskullrailway stationmind controlparking garagecarnivaltorchanimal attackinterracial friendshipcrushed to deathback from the deadfemale warrioryogareverse footagefloodimpostoregyptresurrectionwizardimmortalityscene after end creditsbased on storyrainstormcanenoteclassmatedemonic possessionpuppysword duelbenchalarm clockburned to deathteleportationsurprise after end creditsimprisonmentcoffee shopimpersonating a police officerlevitationrobberfountainteenage lovespiral staircasecockroachfireballlockerworld dominationbrooklyn bridgemegalomaniacmicrosoft windowsbroken mirrorradio stationsorcererpyramidreluctant herobulleaglemuggingbritaindisembodied headtimes square manhattan new york cityflamecollege campusorchestral music scorepark benchshape shiftermiddle agesshapeshiftingsorcerysymbolsorceresscockney accenturnstatue of libertychosen oneapprenticeteenage herochrysler building manhattan new york cityradio djbroomchildhood sweetheartbased on poemmistvaseantique shoppendantbritish accentel trainempire state building manhattan new york citypepsigargoyleteenager fighting adultmuggerfire breathing dragonnight cityscapefear of heightssecret laboratorycar stuntevil sorcererlovers reunitedconfettisatellite dishbegins with narrationvintage cargreat wall of chinamagical mirrormopsplit headchinatown manhattan new york cityincantationnew york universitymagical ringmaster apprentice relationshipcircleevil wizardfight in the restroomhole in wallantennahole in chestsabredemonesslecture hallbook of the deadbrushing one's teethfire axeinanimate object comes to lifeabsorbing powerfalling objectsuccessorenchanted objectevil spellawakened by an alarm clockwashington square manhattan new york citywizardryglowing eyedeath of mentortribeca manhattan new york citytesla coilmountain dewfifth avenue manhattan new york city8th centurypassing notetrapped in a mirrorasian dragonbattery park manhattan new york citychild witchsecret hiding placepompadourtrapped soulabandoned subway stationantique dollbryant park manhattan new york city (See All) |
An out-of-the-way diner becomes the unlikely battleground for the survival of the human race. When God loses faith in humankind, he sends his legion of angels to bring on the Apocalypse. Humanity's only hope lies in a group of strangers trapped in a desert diner with the Archangel Michael (Bettany).
Themes: | supernatural powerdeathmurderlovesuicidechristmaspregnancydeceptiondeath of fatherdeath of motherfaithhopeapocalypseself sacrificemurder of a police officer β¦unlikely heroreligious faith (See All) |
Mood: | darkness |
Locations: | desertlos angeles californiasmall townpolice cargas station |
Characters: | waitresshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshiptattoobrother brother relationshipteenage girlhostagewarriorreference to godinterracial relationshipself mutilationshooting a police officerpregnant girlfriend |
Story: | finger cut offsevered fingerburned aliveimpalementfalling from heightviolencebloodone word titleflashbackbare chested malefightcigarette smokingexplosionknifesurprise ending β¦pistolfirevoice over narrationcell phoneshootoutshot to deathmachine guncar accidentshot in the chestshot in the headshotgunslow motion sceneswordvomitingrifleheld at gunpointbeercar crashcriminalshot in the backf wordgood versus evilsurvivalflashlightdeath of frienddinerstabbed in the chesttied to a chairexploding carno opening creditsradiochild in perilhit by a carold womanshot in the foreheadmini skirtpossessionangeldeath of childchristmas treechildbirthexploding bodydeath of husbandtrapthreatened with a knifecouplelooking at oneself in a mirrorcookcrucifixexploding buildingsevered handcrying manend of the worldfateback from the deadmechanicpump action shotgunveteranfight to the deathgash in the facedeath threatm 16prophecybible quoteheavenjumping through a windowmurder of a childbody landing on a carsiegetrailerdaggergrenade launcheratheistman cryingshot through a windowbazookanarrated by characterbag over headpolice officer shot in the chestjukeboxstandoffacidgun held to headdisposing of a dead bodyhanging upside downbitten in the neckteethcar set on fireopen endedpolice officer shot in the headtear on cheekzippo lighterfratricidewingsbudweisermacemercyextinctionjumping from a rooftopice cream truckpower failurebattle axehand cut offwoman shot in the foreheadconvoychild killerextreme closeupmother daughter conflictmobile homedisobeying ordershelium balloonparadoxthrown through a windshieldsteakwalkerhit with a frying panfallen angelinsubordinationinstructionwoman with a gunno cellphone signalswing setpolice officer shot through the hearthook for handsaviordouble impalementexploding gasoline stationclimbing up a wallhumanity in perilbroken down carblisterice cream manraw meatquitting smokingarchangelbiting someonelocustangel wingsarchangel michaeldog tagshanging from the ceilingbegins with a quoteemergency broadcast systemsurvivalismbloody hand printexterminationpatrol carpolice officer shot in the foreheadshell casinghouseflyhuman racepregnant woman smokingboilsharpened teethangel gabrielartificial handblack and white televisionpossessed boystitching own woundcan of beerswarm of insects (See All) |
An elite team of soldiers has been used against terrorists where they use astounding physical capabilities to overcome them. Victoria, a reporter, follows them and discovers a part of their secret. When one of the team kills her cameraman she tries to escape. Luc, one of the soldiers begins to have β¦flashbacks and turns sides and helps her as the remainder of the team follows to protect their secrets. (Read More)
Subgenre: | cult filmindependent filmmartial artsblack comedyb moviecyberpunk |
Themes: | executionbrutalitymurderdeathkidnappingbetrayaldrunkennessescapeherodeceptionmilitarypsychopathterrorisminsanitysadism β¦amnesia (See All) |
Mood: | gorecar chase |
Locations: | deserthelicopterbusfarmmoteljunglegas stationlaboratorycar explosion |
Characters: | waitresspolicesoldierhostagetough guywarrioraction herosecurity guardamericanamerican soldier |
Period: | 1990s1960sfutureyear 1969the future |
Story: | barnevil manperson on fireimpalementfalling from heightchasecharacter name in titleviolencenuditybloodmale nudityflashbackmale rear nuditytwo word titlebare chested male β¦gunfightcigarette smokingphotographtitle spoken by characterexplosionknifesurprise endingpistolshootoutbeatingshot to deathblood splatterfistfightmachine gunshotgunrescueslow motion scenebattlegunfightbrawlbare buttshowdownheld at gunpointhand to hand combatfightingcombatkung fuscientistf wordreportergood versus evilsurvivalbound and gaggedambushstrangulationmassacrethroat slittingarmystabbed to deathmixed martial artsdinerexploding carfalse accusationone man armydouble crosspolice officer killedshot in the foreheadracial sluron the runflash forwardattempted murderpublic nudityone against manybeaten to deathprologuekaratepay phonefugitivemissionopening action scenemartial artistexploding bodyneck breakingfirst partmercenaryprofanitysilencerbattlefieldstylized violencemachismoexperimenticetraitorhand grenadesupermarketmartial arts masterhead buttelectronic music scoreheavy raintitle based on songsergeantvietnamvideotapeblockbustervietnam warcolonelgun fuback from the deadandroidgun battlecyborgkickboxinggrocery storeu.s. armyfight to the deathmercilessnessnew orleans louisianaresurrectionpost traumatic stress disorderspecial forcesthrown through a windowcommandoeye gougingkarate chopbroken armfemale reporterrescue missionlasersightgatling gunroundhouse kicksouthern accentkarate kickmemory lossmale objectificationvillain played by lead actorvietnam veteranfinal showdownsuper strengthbullet balletcommando unitshot in the eyecommando missionexploding truckmilitary basegun duelbullet woundtop secretsole black character dies clichehigh techcommando raidsuperhuman strengthrecreational vehiclepsychotronic filmvietnam war veteranstrong manpost traumatic stresssevered earclothed female naked malesuper soldiercfnm sceneexploding busthrown through a wallamerican midwestexploding gasoline stationfalling over a cliffmale soldierraw meatreunited familynaked on streetwhite sockselite soldierrevitalizationthrown through windshieldsexy female reporter (See All) |
A small, seemingly innocuous plastic reel of film leads surveillance specialist Tom Welles down an increasingly dark and frightening path. With the help of the streetwise Max, Welles relentlessly follows a bizarre trail of evidence to determine the fate of a complete stranger. As his work turns into β¦ obsession, he drifts farther and farther away from his wife, family and simple life as a small-town private eye. (Read More)
Subgenre: | cult filmsuspenseconspiracyfish out of waterpsycho thriller |
Themes: | brutalitymurderdeathrevengesuicidekidnappingmoneybetrayalprisonfeartortureescapefilmmakinginvestigationdeception β¦angercorruptionpsychopathobsessionparanoiasadismsurveillanceevilhome invasionhollywoodcrueltypanicdeath of daughter (See All) |
Mood: | neo noirdarkness |
Locations: | airportlos angeles californiacemeteryhospitalnew york citybarswimming poolbustaxiwheelchairmotelstrip clubbrothelfire truck |
Characters: | husband wife relationshiptattooprostitutedetectivebabyhostagelawyerfilm directorpimp |
Period: | 1990s |
Story: | crashing through a windowburned alivelightningevil manperson on fireimpalementfalling from heightchaseviolencesexfemale nuditynumber in titlebloodmale nuditymale frontal nudity β¦male rear nuditybondagebare chested malegunfemale rear nudityfightfemale full frontal nuditycigarette smokingnipplesphotographtitle spoken by charactermale full frontal nudityknifesurprise endingpistoltelephone callfirecell phonebeatingcorpsedigit in titleshot to deathblood splatterfistfightshot in the chestpunched in the facebrawlbare buttmasklettershootingshowdownheld at gunpointsunglassesinterrogationprostitutioncriminalstrippertelephoneshot in the backf wordfoot chasegay slurbound and gaggedstrangulationambulancemansionthroat slittingwidowstabbed to deathprisonerstabbed in the chestman with glassesnundisarming someoneacronym in titledouble crosslimousinelibrarybinocularsbeaten to deathdangerstabbed in the backsuburbpay phoneundercovermissing personcover upkicked in the facediaryshot in the shoulderbodyguardthreatpremarital sexcharacter says i love youthreatened with a knifesilencerarsonrunawayprivate detectiveeavesdroppingpornographyuzianswering machineundergroundrevelationheavy raintape recordersociopathscene during opening creditssexual abuserecordingstabbed in the stomachhollywood californiakicked in the stomachvideotapedesperationsadomasochismbrooklyn new york cityfaked deathhomicidemasked manmechanicduct tape over mouththugcrossbowcynicismhatredkickingstabbed in the neckheadphonesmiami floridabutlersenatorpunched in the chestsafethrown through a windowbookstoreknife fightfilm producerrainstormgasolineburned to deathmasked killerprivate investigatorsouthern accentdead girlimpersonating a police officerpervertabandoned buildingmysterious mansidekickporn magazineshot in the neckpistol whipvideo storepictureporn industryloss of daughterbrooklyn bridgesexual perversionfilm projectormasochismclimbing through a windowdegradationmessageunderworldbody in a trunkpornographersnuff filmpalm treekicked in the headstabbed in the shoulderfilmed killingdecadencegarbage truckknife murderwatching a videosex shopprivate eyecleveland ohiocriminal investigationabandoned warehousewiretappingguillotinedepravityvinylred light districtmistreatmentsuper 8mmsexual sadismsexual torturesexual crueltyfilm reelporn directorvideotaped sexfiendviolent sexwall safemicrofilmpornographic videodeviant sexunusual sex act8mmpainful sexporno shopsadomasochism clothingback alleyadult bookstoregimp maskhall of recordsmeat processing plantharrisburg pennsylvania (See All) |
Ash is transported with his car to 1,300 A.D., where he is captured by Lord Arthur and turned slave with Duke Henry the Red and a couple of his men. When Ash is thrown into a pit, he defeats two monsters and wins respect of Arthur's army and vassals. The Wiseman points Ash as The Chosen One that wil β¦l retrieve the Necronomicon but Ash is only interested in returning home. When he learns that the only way to return to his time is using the Necronomicon, Ash decides to travel to the unholy land of the Deadites. The Wiseman advises that he must say the words "Klaatu Barada Nikto" to safely get the evil book. However, Ash forgets the last word and an army of the dead resurrects to attack Arthur fortress and recover the Necronomicon. The battle between the living and the dead is about to start and the support of Henry the Red is the only way to help Ash and Arthur to defeat the army of darkness. (Read More)
Subgenre: | cult filmmartial artsblack comedyabsurdismsword and sorceryepicslapstick comedyfish out of watersteampunkdark fantasysword and fantasy |
Themes: | time travelsupernatural powermagicsurrealismfearmonsterheroevilpanicbook of evil |
Mood: | gorespoofavant gardesequel to cult horror |
Locations: | desertcemeteryforestcarwoodsenglandcastle |
Characters: | zombiesoldiertough guywarrioraction herowitch |
Period: | 1990s20th centuryyear 1992 |
Story: | spellwhiplightninggraveyardimpalementbookhorsechaseviolencesexnuditybloodbare breastssequelkiss β¦fightsingingthree word titlesurprise endingvoice over narrationblood splatterfistfightcar accidentmirrorface slapshotgunbattleswordhand to hand combatrunningdemonfightingcombatdecapitationgood versus evilsword fightambushaxearmymixed martial artsprisoneranti herodisarming someoneone man armyfictional warcreaturesearchthird partgunshotduelone against manycurseprologueuniformactor playing multiple rolespossessionstatueopening action scenescreamskeletonscarautomobilecabincult directordismembermentundeadbattlefieldstylized violencechainsawfireplacebow and arrowspearfarcequestcaptivesevered handskullknighttorchgun fuslavefull moondamsel in distressreverse footageshieldexplosivethundercrossbowhit in the crotchshot in the faceprophecypsychotronicmedieval timesarmorh.p. lovecraftsiegekingdomsword dueltragic herosequel to cult favoritearrowdoppelgangerlevitationgatespit in the facefreakarcherydouble barreled shotgunbeastfortressreluctant heroone linergun violencetrampolinewindmillchainedgravestoneblacksmithpigtailstongue in cheekbagpipeschosen onepitwinchester riflerepeating rifleshot with a bow and arrowalternate versionmistbattle axecult figureogrechemistryflaming arrowdukeprosthetic limbevil twincartcatapultvortexbannerevil deadbattering ramover the topsame actor playing two charactersnecronomiconpart stop motionanvilbraidslanceanimate objectminiature personhorseback14th centuryalternate endingsame actor playing two characters simultaneously on screencult film reference1300shuman duplicationenchantmentbook of the deadsalesclerkcitadelhead spinoldsmobileanimate skeletondiscount storedemonic undeadvoice over flashbackwise manskeleton warriorartificial handportcullistwo headed personmetal handwar crychainmailsumerian (See All) |
In the end of the Nineteenth Century, in London, Robert Angier, his beloved wife Julia McCullough and Alfred Borden are friends and assistants of a magician. When Julia accidentally dies during a performance, Robert blames Alfred for her death and they become enemies. Both become famous and rival ma β¦gicians, sabotaging the performance of the other on the stage. When Alfred performs a successful trick, Robert becomes obsessed trying to disclose the secret of his competitor with tragic consequences. (Read More)
Subgenre: | tragedysteampunk |
Themes: | executionmagicmurderdeathlovefriendshiprevengesuicidekidnappinginfidelitybetrayaladulteryprisonpregnancydrinking β¦feardrunkennessfuneraldeceptionextramarital affairangerobsessiongriefunfaithfulnessrivalrytheatredeath of wifepanicwilderness (See All) |
Mood: | rainambiguous ending |
Locations: | cemeterybarrestauranttrainforesthotelsnowsmall townlondon englandwaterwoodscourtroomstorm |
Characters: | husband wife relationshippolicefather daughter relationshipfriendbrother brother relationshipboygirlpolice officerpolicemanactorbabylawyerlittle girllittle boydaughter β¦chinesefatheramericanaunt nephew relationshipself inflicted injury (See All) |
Period: | 19th century1900s1890s |
Story: | casketfinger cut offcoloradoseancesevered fingerlightninggraveyardcoffinfalling from heighthorsebased on novelbloodflashbacktwo word titlebare chested male β¦gunphotographtitle spoken by charactersurprise endingpistolfirevoice over narrationcorpseshot to deathshot in the chestshotguncatdrinksecretlettershootingheld at gunpointbeerlingeriedead bodycafejailhandcuffsrevolvercandleold manaxemountaindisguisemontageprisonernonlinear timelinejudgetrialno opening creditsbirdvoice overdrowninggunshotflash forwardtheaterargumentcostumechampagnehangingdiarycourtdeath of brotherhairy chesttrapstagecharacter says i love youshot in the armtwinsacrificetrustapplauseropeentertainmentsabotagefireplacebulletkilling an animalrevelationcagefameperformancejail cellmagicianloss of loved onemorgueagentlossservantaudiencefaked deathtorchbroken legguardattorneythundermourninginventorbackstageimpostorpartnershovelwizardtheatre audiencemakeupevidencefogcanetied feetblind manlanternbroken armhorse and carriagecoinframed for murderteleportationmain character diesposterplaying cardsdoppelgangervictorian eraillusionstage showelectricitywifemagic trickburied alivenotebookgatebandagetwist endingjournaltelling someone to shut upinventiontombstoneperformerwatchdouble barreled shotguntwin brotherdrunkardshow businesshusbandnewspaper articletavernassistantbusiness cardshot in the handhanged manchainedenglishmanentertaineranimal experimentationcarouseldead birdlimpin medias resblack catdeath by drowningtrapdoorhorse and wagoncockney accentsledgehammerdeath by gunshotfake moustacheflashback within a flashbackfake accentlockdovetop hatarm slingcryptfalling through the floorflintlock pistoldoubleprotective malestagecoachmistlight bulbshacklestransportationdevotionhand injuryillusionistman wearing a wigoil lampbaby carriagebroken fingergallowsgeneratorheadstonehanged womanransackinghidden identitylimpingstopwatchtheatrical agentdualitystage magicianhand woundsame actor playing two characterslocksmithsolicitoractor playing dual roleelectric fencecanarymagician's assistantlightbulbcompetitorexecution by hangingmachinerydying repeatedlywater tankreference to thomas edisonlookalikesame actor playing two characters simultaneously on screenhuman duplicationpledgeartificial humancondemned to deathyear 1899duplicatepantaloonarm in a slingsleight of handencryptionhangman's noosecoin trickduplicationprotective fathershowmanfingers shot offholding someone's head underwateridentity swappingdoor keyfalling through a staircasestage actvoice over diaryelectrical generatorhansom cabparallel montageunderwater escapefake hangingshowmanshipfinger injuryroyal albert hall londonworkhousebookingbouncing a balluncertainty principlecolorado springs coloradoprestigerubber ballgymnastic ringscatching a bulletroyal albert hall (See All) |
In 1944 falangist Spain, a girl, fascinated with fairy-tales, is sent along with her pregnant mother to live with her new stepfather, a ruthless captain of the Spanish army. During the night, she meets a fairy who takes her to an old faun in the center of the labyrinth. He tells her she's a princess β¦, but must prove her royalty by surviving three gruesome tasks. If she fails, she will never prove herself to be the the true princess and will never see her real father, the king, again. (Read More)
Subgenre: | cult filmcoming of agetragedyfairy taledark fantasymythologicalcoming of age filmspanish horrormexican horroradult fantasy |
Themes: | executionbrutalitymagicmurderdeathlovesurrealismpregnancyfeartorturemonstermilitarymemorydeath of fatherdeath of mother β¦illnesssadismcrueltydeath of wifecommunismcourageself sacrificehuntingafterlifedeath in childbirthdying in childbirth (See All) |
Mood: | gorerain |
Locations: | trainforestsmall townbathtubwoodskitchenwheelchaircavespain |
Characters: | husband wife relationshipfather son relationshipmother daughter relationshipdoctorsingerfemale protagonistgirlsoldiernursebabypriestmotherfathermayorpregnant β¦military officerstepfather stepdaughter relationshipstepbrother stepsister relationshipmythical creaturedeath of girlpregnant mother (See All) |
Period: | world war two1940syear 1944 |
Story: | eyeballlifting someone into the airburned alivechild murderfarmercoffinbookhorsechasecharacter name in titleviolencefemale nuditybloodguncigarette smoking β¦explosionsingingknifesurprise endingvoice over narrationsongfoodmirrorshot in the chestshot in the headrescuepunched in the facebattleshootingvomitinglierifleinterrogationrevolvershot in the backgood versus evilspycookingambushstabbingeatingarmyfour word titlestabbed in the chestweaponchild abuseno opening creditsanti herokingcreatureprincesstransformationpainlimousinegravetreebinocularskeyliarpoisonumbrellastorytellingstatuereadingrabbitskeletoninjectiontragic eventtied upflowerloss of mothergeneralmagical realismsacrificequeenprincestrong female characterrecord playerdestinyshavingcard gamesabotagespiritsyringefireplacegrenadewounddressheroinepropagandarecordingcookcaptivehammerhidingservantrebelfrogstrong female leadhomeburialfull moonpromiseimaginationchild's point of viewbraveryfairyresistanceshot in the faceinsectthunderstormcard playingrosedead childfascismcapturehousekeeperlanternkingdomdaggerwar crimechauffeurdrugged drinkmuddead girlhorseback ridingbandagemazelotteryeuthanasiaportalbreadtween girlno title at beginningmedalfascistwhisperingparamedicbubble bathpocket watchfantasy worlddisciplinemercy killingfemale heroamputationtyrantmilitary uniformfeverspanish civil waranarchisthiding under a bedimmortalparallel universeinformermonumentstuttering10 year oldtailorpsychotronic filmcavalrysecret passagealternate dimensionguerrillafetusgiant animalalice in wonderlandbludgeoningberetanarchismsuspendersphonographknife held to throatlabyrinthtoadcowardicebirthmarkstabbed in the mouthfeastlottery ticketparallel worldsecret doorruthlessnesshand injurywalking stickfire fightyoung girlfantasy becomes realityhourglassleechlugermilking a cowlullabycalligraphytrain wrecknew homechalkechomouthembryoreference to dwight d. eisenhowerlifting a male into the airsecret compartmentmorning sicknessinfiltratorlipsmagical creaturerationingstraight edge razorcult favoritesedationmagic booktrickerymagical stonereference to francocold feetrootantibioticwater millneck wounddead treeopening creditshedge mazefaunmandraketalking to an unborn babychild heroinefig treerabbit huntingration carddead child with eyes openfur stolestitching one's own woundimaginary childpolishing bootsstone carving (See All) |
Peyton Westlake is a scientist who has discovered a way to produce synthetic skin. This could revolutionise skin grafting, except for one minor glitch; the synthetic skin degrades after 100 minutes of exposure to light. When gangsters attack Peyton, he is horrifically burnt, and assumed dead. In his β¦ quest for revenge, Peyton, aka the Darkman, is able to take on the appearance of anyone (using the synthetic skin,) but he only has 100 minutes per disguise. (Read More)
Subgenre: | cult filmblack comedysuperhero |
Themes: | brutalityloverevengepsychopathmental illness |
Mood: | neo noiravant gardepoetic justice |
Locations: | cemeterycarhelicopterlaboratoryhelicopter accident |
Characters: | lawyertough guyhitman |
Period: | 1980s1990syear 1989year 1990 |
Story: | finger cut offsevered fingerlifting someone into the airfirst of seriesfalling from heightcharacter name in titleviolenceone word titlefighttitle spoken by characterexplosionshootoutmachine gunshot in the headcat β¦cameramaskheld at gunpointscientistf wordbound and gaggedexploding caranti herocontroversypolice officer killedcigar smokinglatex glovesorganized crimebeaten to deathscarsacrificewarehousegothicexploding buildingcaucasianimpersonationcarnivalback from the deadretirementimpostorgash in the facegunshot woundframe upamusement parkdark herothrown through a windowhologramdisfigurementbody landing on a cartragic heroexploding helicoptermoral dilemmaframed for murdergeniusgrenade launcherdesert eaglegothmedical masksurgical masksuper strengthsuit and tieintelligenceskyscraperdental maskburnt facestethoscopenihilismmicroscopedisfigured faceorchestral music scorerighteous ragemasked herotrenchcoatfedorawhite coatorigin of heromoral ambiguitybroken fingertall manlifting a female into the airfirst of trilogyprosthetic legmelting faceaftermathname tagbig manbuilding constructionchinatown los angelesslurred speechcigar cuttermaiming (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk β¦s at a terrible cost. (Read More)
Subgenre: | tragedychrist allegory |
Themes: | supernatural powerbrutalitydeathmurderloverevengesurrealismsuicidekidnappingbetrayalfeardeceptiondeath of motherhopedeath of wife β¦self sacrificemythologynear death experience (See All) |
Locations: | churchforestlondon englandwoodscastlecave |
Characters: | husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampirewarrioraction heroself mutilationex soldierself healingblood lust |
Period: | 15th century |
Story: | burned alivelightningevil manperson on fireimpalementfalling from heighthorsechasecharacter name in titleviolencebloodflashbackbare chested maleexplosionknife β¦surprise endingfirevoice over narrationbeatingcorpseblood splatterrescueslow motion scenepunched in the facebattleswordshowdownhand to hand combatrunningdemonrivercombatsubjective cameragood versus evilcandlesword fightambushaxemassacremountainthroat slittingarmystabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in periltransformationon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingcharacter's point of view camera shottentskeletonshot in the shoulderscarcrossthreatened with a knifedirectorial debutsevered armgeneralbare chested male bondagerefugeesubtitled scenebattlefieldfreeze frameprincestylized violencemaniacdestinywolfbow and arrowhead buttspeargothicheavy rainhelmetcrucifixloss of wifespiderskulltorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
In the sixth year at Hogwarts School of Witchcraft, and in both wizard and muggle worlds Lord Voldemort and his henchmen are increasingly active. With vacancies to fill at Hogwarts, Professor Dumbledore persuades Horace Slughorn, back from retirement to become the potions teacher, while Professor Sn β¦ape receives long awaited news. Harry Potter, together with Dumbledore, must face treacherous tasks to defeat his evil nemesis. (Read More)
Subgenre: | cult filmteen romancedark fantasy |
Themes: | magicmurderdeathlovefriendshiprevengechristmasbetrayaljealousydrunkennessdeceptionmemoryguilt |
Mood: | rain |
Locations: | snowlondon englandvillagecaveoceanschool of magic |
Characters: | husband wife relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshiplove triangleteacher student relationshipprofessoryounger version of characterboy hero |
Period: | 1990schristmas partyyear 1997year 1996 |
Story: | evil markspelllifting someone into the airburned aliveringbookfalling from heightcharacter name in titlebased on novelbloodflashbackkissphotographsurprise endingfire β¦corpseslow motion scenegood versus evilfoot chasenewspaperdeath of friendno opening creditsunderwater scenenecklacelibrarycursepoisondragonkicked in the facetough girldiarymanipulationscardisappearancetragic eventpubstrong female characterwerewolfeavesdroppingfireplaceteen angstkilling an animalrevelationlooking at oneself in a mirrorstrong female leadorphanageappleinterracial romancebroken glasswizardprophecyhealingteleportationdrugged drinkinvisibilitylevitationreturning character killed offdinner partysports teamsubway stationremorseboy with glassestwin brotherinterracial kisschandelierdripping bloodpotionseizureluckbroken noseopen endedorchestral music scoresixth partdead birdheadmastercut handhouse on firelocketevil childgiant spidercult figuremagic wandhourglassmagical potionlifting a female into the airbased on young adult novelsteam traincliffhangerinfirmaryfalse memoryvowbreaking up with girlfriendcabinetfoaming at the mouthwet jeanslove potionclosing credits sequenceevil wizarddrugged foodclosing eyes of dead personring of firebox of chocolateshereditary gift of witchcraftbad guys winfavoritismfictitious sportburnt down housebildungsromanblack male white female relationshipdestroyed bridgemagic shopwalking up a wall (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | independent filmsuspensesupernaturalpost apocalypsesurvival horrorzombie apocalypsedisaster film |
Themes: | supernatural powerbrutalitymurderdeathrevengesuicidefeardrunkennessescapedeceptionparanoiainsanitysurveillancehome invasionpanic β¦apocalypsecannibalismnear death experience (See All) |
Mood: | gorebehind the scenesnightmareambiguous ending |
Locations: | airportcemeterybartrainforestairplanewoodskitchenapartmentcampfiretunnelschool teachercar bombnew englandcar fire β¦train driver (See All) |
Characters: | father son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteacherzombiepolice officerstudentartistsecurity guardteacher student relationship |
Period: | 2010s |
Story: | boston massachusettsburned aliveperson on fireimpalementfalling from heightchaseviolencebased on novelbloodone word titledogfightcigarette smokingdancing β¦title spoken by characterexplosionpartyknifesurprise endingpistolfirebased on bookcell phonebeatingdreamcorpseshot to deathblood splattershot in the chestshot in the headshotgunrescueslow motion scenecatswordbrawlshowdownrifleheld at gunpointbombshot in the backsurvivalfoot chaseflashlightambushaxemontagestabbed to deathdinertoiletstabbed in the chestsubwayexploding cardisarming someonedrawingchild in perilhit by a cardouble crosssearchtransformationshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingkeyattackfantasy sequencepay phoneon the roadbaseball batexploding bodyundeaddisasterfireplacebow and arrowrevelationmachetelistening to musicscene during opening creditssurvivormutantviruscooksecurity cameracaught having sexeccentriccovered in bloodmind controlend of the worldburialeaten alivebarefootmobile phonedual wielditalian americancannibalchaosshovelstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murdermutationburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manliving deadvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayhooded figurec4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned cartire ironairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | cult filmblack comedyconspiracysupernatural |
Themes: | supernatural powerbrutalitymurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyfearescapewedding β¦deceptionseductionrobberypsychopathparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
Mood: | gorecar chaseslasherpoetic justice |
Locations: | cemeteryhotelbathtubwaterkitchenpolice stationpolice carroad tripmotel |
Characters: | homosexualpoliceteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerserial killerdetectivepriesthostagethiefpolice detective β¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
Period: | 1990s |
Story: | spellsevered fingerringlightninggraveyardcoffinimpalementchasecharacter name in titleviolencesexbloodsequelbare chested malegun β¦kissfightcigarette smokingphotographknifesurprise endingpistolfirecryingcell phonebeatingcorpseshot to deathblood splattercar accidentmirrorshot in the chestrescueslow motion scenewatching tvbare buttlettershowdownheld at gunpointrock musiccar crashdead bodymarijuanahandcuffsrevolvertelephonef wordorphanflashlightambushstrangulationmansionmontagethroat slittingbridgestabbed in the chesttied to a chairexploding carfalse accusationdisarming someonedrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalenews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timedollknocked outbaseball batskeletonscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamenew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | cult filmindependent filmpsycho thrilleramerican horror |
Themes: | brutalitydeathmurderrevengefearpsychopathinsanitysadismevilexploitationpolice investigation |
Mood: | gorerainnightmarenightslasherdarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | policemother son relationshipteenagerbrother brother relationshipserial killerkillervillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | eyeballlifting someone into the airbarnevil manimpalementchaseviolencesexfemale nuditynumber in titlebloodbare breastssequelfemale frontal nuditykiss β¦dancingsurprise endingpantiesdigit in titleblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacrethroat slittingchild in perilgravestalkercharacter's point of view camera shotdeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetemutilationstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillymeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
Mike, a young teenage boy who has just lost his parents, afraid to lose his brother follow him to a funeral, where Mike witnesses the Tall Man lifting a coffin on his own. Mike decides to investigate, and discovers that the Tall Man, protected by his flying spheres, is shrinking dead bodies down to β¦half their normal size and reanimating them as slaves. It is then up to Mike, his brother, and Reggie the ice cream man to stop the Tall man. (Read More)
Subgenre: | cult filmindependent film |
Themes: | murderfearfuneralphotographybeyond death |
Mood: | nightmare |
Locations: | cemeterycarsmall town |
Characters: | brother brother relationshipboyzombiealienmysterious villain |
Story: | casketsevered fingerflyingevil manfirst of seriescoffinfemale nudityone word titlesingingknifesurprise endingdreambedcar crash β¦good versus evildeath of friendno opening creditspart of serieschild in perilactor shares first name with characterstalkingautomobilefirst partgrandmothercult directordismembermentelectronic music scorepresumed deaddwarfpsychotroniceye gougingmadmanguitar playingundertakerdirector also cinematographerparallel universemopedvolkswagen beetlestrong manice cream truckfingerantique shopmausoleumdead parentstall manburning cargrave robbingchild driving a cardrill in the headmysterious eventice cream manattempted child strangulationpart of tetralogyfirst of tetralogy (See All) |
Four best friends, young warlocks of the same coven who all share a same secret: a magic powers, suddenly have to protect themselves from a stranger-another warlock just like them who has come to town to destroy their coven after a 300 years old hate...
Subgenre: | gay interest |
Themes: | supernatural powermagicdeathfriendshipghostdeath of father |
Mood: | high schoolcar chase |
Locations: | schoolswimming poolmotorcyclemotorcycle accident |
Characters: | mother son relationshipteenagerstudent |
Story: | warlockcrashing through a windowwitchcraftfalling from heightfemale nuditymale nuditymale rear nuditybare chested malefemale rear nudityfightpartyshowercorpseblondepunched in the face β¦bare buttcar crashhallucinationcleavageexploding cardream sequencescantily clad femalehit by a carlocker roommini skirthigh school studentfriendship between menspiderbloody nosewizardthunderstormhomoeroticismlanternbonfirefamily secretfemale in showermale in showerdoppelgangerinvisibilitylevitationfilm starts with textheritageman in swimsuitmassachusettsford mustangshapeshiftingspeedomale vomitingshower roomgroup showerflying carpreparatory schoolinvisible mangay subtextbroken windshieldfoosballwoman in a towellecture hallmaking out in a carjumping off cliffbroken lightbulbjumping onto a carswimming teamlogging truckswimming race (See All) |
A war has been raging between the Vampires and Lycan for centuries, Selene (Beckinsale) is a death dealer, assigned to hunt down and eradicate the last of the Lycan. When she comes across Michael Corvin (Speedman) who holds the key to end the war she must decide where her allegiances will lie.
Subgenre: | cult film |
Themes: | supernatural powerdeathmurderlovekidnappingbetrayaldeceptionmemoryrivalryphotography |
Mood: | gorerainnight |
Locations: | hospitaltrain |
Characters: | female protagonistvampirewarriortalking to oneself in a mirror |
Story: | whipburned aliveevil manfirst of seriesimpalementfalling from heightbloodflashbackbare chested malecigarette smokingexplosionpartyknifesurprise endingpistol β¦voice over narrationcorpseshot to deathblood splattermachine gunshot in the chestface slapshotgunslow motion scenepunched in the facecamerabattleswordrifleheld at gunpointcar crashshot in the backsubjective cameradecapitationfoot chaseambushmansionsubwayhit by a carunderwater scenetransformationshot in the foreheadbeaten to deathshot in the shoulderexploding bodyneck breakingcharacter says i love youfirst partshot in the armwhippingdismembermentstrong female characterwerewolftraitorundergroundsyringegrenadehypodermic needlegothiclooking at oneself in a mirrorladderstrong female leadforbidden loveaction heroinebroken legapartment buildingslavefemale warriorfull moontarget practicegash in the faceimmortalityfeudstabbed in the legjumping through a windowlatexhealingbroken armmutationlaptop computertorso cut in halftombneedleshot in the necksubway stationstabbed in the armfemale vampirebitten in the neckman punching a womanmedical studentstabbed in the shoulderstar crossed loversopen endedbladein medias resshot through a doorfemale gunfighterkicking in a doorregenerationcamera focus on female buttvampire slayerfalling through the floorsubway trainwoman punching a manthrowing stararsenalbudapest hungarydark heroineshurikenlifted by the throatshot through a wallfangsawakeningdowntownhybridvampire bitecovenhead cut in halfchased by a doglycanthropymurder of a pregnant womanvampire human lovethrown through a wallsilver bulletclimbing over a fencebreaking through a wallcamera shot from inside human bodyultraviolet lightdeath of pregnant womaneyes different colorsexy female vampirelatex catsuiturban gothicskin torn offtrain depotwerewolf bitedeath of expectant mothermedical internnocturnalvampire versus werewolffather murders daughterhuman allyripped necksubway chaseancient vampirepass out from blood lossvampire driving car (See All) |
Based on the popular video game of the same name "Mortal Kombat" tells the story of an ancient tournament where the best of the best of different Realms fight each other. The goal - ten wins to be able to legally invade the losing Realm. Outworld has so far collected nine wins against Earthrealm, so β¦ it's up to Lord Rayden and his fighters to stop Outworld from reaching the final victory... (Read More)
Subgenre: | cult filmindependent filmmartial artsb movie |
Themes: | supernatural powerdeathmurderrevengesurrealismkidnappingmonster |
Mood: | gore |
Locations: | los angeles californiabeachforestboatnightclubwoodschina |
Characters: | actorhostagetough guywarrioraction heroamerican abroad |
Period: | 1990s |
Story: | lightningfirst of seriesperson on fireimpalementfalling from heightviolencebloodflashbackbare chested malefighttitle spoken by characterknifepistolshot to deathblood splatter β¦machine gunshot in the chestshotgunrescueslow motion scenepunched in the faceshowdownheld at gunpointhand to hand combatislandgood versus evilbased on comic bookdisguisemontagemixed martial artssevered headno opening creditscreatureprincesscharacter repeating someone else's dialoguefbininjadragonkicked in the facetough girldeath of brothermartial artistexploding bodyneck breakingpolicewomanfirst partprincestylized violencehenchmanmachismodestinyspearelectronic music scorehong kongfbi agenttempleswat teamskulltournamentaction heroinefemale warriordamsel in distressshieldcameofight to the deathbased on video gamehit in the crotchmovie setfalling to deathexploding headthrown through a windowfilm setwisecrack humorsoulalternate realityeye patchstick fightteleportationdoppelgangerinvisibilitytowerworld dominationmegalomaniacsorcererfall from heightman punching a womansaving the worldkicked in the headopen endedfemale copimmortalshapeshiftingcockney accentbo staffbanquetglowing eyesmartial arts tournamenttitle appears in songwoman punching a manparallel worldwoman kills manfire breathingone eyed mankicked in the chestunderground fightingreptilehead cut in halfevil sorcererfreeze to deaththrown through a wallshape shiftingfighting moviewoman fights manmortal kombatpunch into the camerascore employs electronic instrumentswoman breaks man's neckcrashing through glassface peeled offsoul takermultiple armsreptile manthunder god (See All) |
After finally catching serial killer and occult "sorcerer" Lord Blackwood, legendary sleuth Sherlock Holmes and his assistant Dr. Watson can close yet another successful case. But when Blackwood mysteriously returns from the grave and resumes his killing spree, Holmes must take up the hunt once agai β¦n. Contending with his partner's new fiancee and the dimwitted head of Scotland Yard, the dauntless detective must unravel the clues that will lead him into a twisted web of murder, deceit, and black magic - and the deadly embrace of temptress Irene Adler. (Read More)
Subgenre: | cult filmmartial artsconspiracy |
Themes: | executionbrutalitymagicmurderfriendshipprisondrunkennessdeceptionrobberydeath of fathergamblingmurder of a police officermurder of father |
Mood: | rainnightmare |
Locations: | hospitalrestauranttrainhotelbathtublondon englandshiplaboratorysewerabandoned factory |
Characters: | father son relationshipboyfriend girlfriend relationshipserial killerthieflove trianglewarrioraction heroamateur detectivemysterious villain |
Period: | 19th century1890s |
Story: | burned aliveoccultlightningperson on firegraveyardcoffinfalling from heightchasecharacter name in titleflashbacktwo word titlebare chested maletitle spoken by characterexplosionfire β¦shootoutcorpsefistfightmirrorshot in the headshotgunslow motion scenepunched in the faceswordundressinggunfightbrawlheld at gunpointhand to hand combathallucinationhandcuffssciencegood versus evilfoot chasenewspaperoperabound and gaggedsword fightstrangulationaxedisguisemixed martial artsmapnonlinear timelineno opening creditsanti heroritualfemme fatalenecklacegraveprologuerace against timeknocked outreadingopening action scenehangingshot in the shoulderwitnessnewspaper headlinesubtitled scenestylized violenceprivate detectiveteaassassination attemptkicked in the stomachfaked deathrailway stationviolinback from the deaddamsel in distresshit in the crotchpunched in the stomachresurrectiontitle appears in writingbribebible quotejumping through a windoweye patchwar veteransword duelhorse and carriagechainblack magicstick fightpipe smokinggeniusengagement ringbullet timedrugged drinkbattombvictorian erafianceesidekickspiral staircasehuman sacrificetwo man armysecret societyfraternitynewspaper articlesawed off shotgunambassadormeat cleaveraltered version of studio logoclueslaughterhousesorceryman on firefrenchmanriddlesherlock holmesman hits a womankicking in a doorred winestrong manbulldogparliamentillegitimate sonjumping out a windowantidotesecret organizationhidden roomsliced in twobig ben londonillusionistfalling asleephidden doorchambermaidgallowstall mandrink thrown into someone's facebare knuckle fightingpoison gashandcuffed womanfirst of trilogyshipyardson murders fathersinking shippalm readingwall safedead body in waterhandcuffed to a beddead ratexecution by hangingfly the insecttinnituscharacter appears on front page of a newspapercharacter appears in newspaperpushed from heighttower bridge londondrowning in a bathtubdiamond necklaceelectro shockarch villaindead body in bathtubhit in the throatsword canearm in a slingevil geniusphotograph in newspaperjumping into a rivernecklace yanked offbuzzsawdeductiongypsy womanfake nosebridge constructionhouse flysecret orderdeath of fianceeenglish bulldoghouse of lordsscotland yard inspectordenouementfrog dissectionparliament buildingbook of revelationsretired doctorindustrial agereference to don giovannideductive reasoninglate victorian eralondon bobbystolen necklacethames river (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | cult filmindependent filmblack comedysupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
Themes: | supernatural powermurderdeathsurrealismdrugsghosttorturepsychopathdeath of motherinsanitysadismevilamnesia |
Mood: | gorerainhigh schoolnightmareslasherdarkness |
Locations: | small townairplaneroad trip |
Characters: | family relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillervillainterrorself mutilationyounger version of characterdeafnessslasher killerserial murderergerman american β¦evil father (See All) |
Period: | 1990s1970s1960s1940s1950s |
Story: | finger cut offsevered fingerburned alivechild murderevil manimpalementfalling from heightcharacter name in titleviolencef ratedbloodsequelflashbackbare chested maletitle spoken by character β¦knifefirepunctuation in titletitle directed by femaledreamblood splatterrescueslow motion sceneapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadmaniacfalling down stairskilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameocrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamechild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
The cynical and skeptical writer Mike Enslin writes books evaluating supernatural phenomena in hotels, graveyards and other haunted places, usually debunking the mystery. While writing his latest book, he travels from Los Angeles to New York to spend one night in the Dolphin Hotel's posessed room 14 β¦08, which is permanently unavailable for guests. The reluctant manager Mr. Gerald Olin objects to his request and offers an upgrade, expensive booze and finally relates the death of more than fifty guests over decades in the cursed room. However Mike threatens Mr. Olin, promising to sue the hotel, and is finally allowed to check into the room. Later in the night, he finds that guests of room 1408, once they have checked in, might never leave the room alive. (Read More)
Subgenre: | paranormal phenomenasupernatural horrorparanormal activity |
Themes: | supernatural powerdeathmurdersurrealismsuicideghostdrinkingfearfuneralinvestigationmemoryangerparanoiaguiltinsanity β¦illnessevilpanicself sacrificedeath of daughterclaustrophobia (See All) |
Mood: | rainnightmare |
Locations: | los angeles californiacemeteryhospitalnew york citybeachrestauranthotelsnowwatertaxiwheelchairpolice carhotel fire |
Characters: | waitresshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipafrican americangirlpolice officerwriterlawyerbiblemaid |
Story: | burned aliveoccultperson on firecoffinbookfalling from heightchasenumber in titlebloodflashbackcigarette smokingphotographtitle spoken by characterknifesurprise ending β¦showertelephone callfirecryingsongdreammirrorwatching tvcomputerdrinksecretpaintingtearscafebathroomhallucinationmanhattan new york citytelephonethroat slittingdinermapradiounderwater scenedrowningflash forwardgravelibraryauthorhotel roomkeybased on short storypossessionkicked in the facehauntingsuspicionhaunted housearsonblack americanicedestructiontape recordersurfingbarefoottrappedinsecttitle appears in writingbookstoreeye gougingmarital separationrefrigeratorsurgeonbonfirealarm clockatheistlaptop computerfiremandoppelgangerinvestigatorcandyclosetapparitionmolotov cocktailbandagemazerepeated scenepostcardpublishermetaphorremorsewebcambugsurferblood stainhearing voicesmind gamemailsurfboardwarningnursing homenoosehanged manburnt bodyshockhome videopost officedemolitionrescue from drowninghit with a hammertuberculosislocked in a roombludgeoningpoltergeistdeja vufloodingjumping out a windowconcussionbook signingskepticismhand injuryghost hunterhotel managerhospital gowndeath of a childturned to stoneledgekeyholeceiling fanestranged couplebased on the works of stephen kingcold the temperaturesingle locationcount downdeliriumnumber as titleinfra redmicrofilmair ventcognachotel desk clerkfly the insectsiren the alarmcrushed handboiling waterfire sprinklerbook editorsanityreference to franz kafkacall for helpletter openerwalking on broken glassreference to truman capoteunplugged electronic worksventilation shaftdoor handlebook tourdebunkinghaunted hotelclock radiosense of timefalling through the ceilingfire rescuehanging from a ledgepost office boxarmoirescene at a windowthermostattransom (See All) |
A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village β¦ council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)
Subgenre: | cult filmmartial artsfairy talesword and sorcerydark fantasysword and fantasychrist allegory |
Themes: | book of magicmagicfriendshiprevengesurrealismkidnappingbetrayaladulteryescapemonsterheroredemptionsadismcourageforgiveness |
Mood: | rainpoetic justice |
Locations: | forestsnowboatvillagefarmlakecastlecampfireroad movie |
Characters: | husband wife relationshipfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendlittle girllittle boyvillainwitch β¦self discoverycrying babybaby girl (See All) |
Story: | spelllifting someone into the airfarmerlightningimpalementbookfalling from heighthorsechasecharacter name in titlebloodone word titledogkissfight β¦dancingtitle spoken by characterknifecryingpunched in the facecatbattleswordmaskshowdownhand to hand combatislandrivercombatsubjective cameragood versus evilsword fightmountaindisguisedeath of friendthroat slittingprisoneranti herofictional warritualjourneyold womanprincesstransformationcursemissiondragontentkicked in the faceskeletonbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightloss of friendhidingvillainessanimal attackgoatapplefemale warrioradventurerdwarfshieldfairywizardprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamsmokedaggercrowhorseback ridingfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All) |
A poetic guitarist Eric Draven is brought back to life by a crow a year after he and his fiancee are murdered. The crow guides him through the land of the living, and leads him to his killers: knife thrower Tin-tin, drugetic Funboy, car buff T-Bird, and the unsophisticated Skank. One by one, Eric gi β¦ves these thugs a taste of their own medicine. However their leader Top-Dollar, a world-class crime lord who will dispatch his enemies with a Japanese sword and joke about it later, will soon learn the legend of the crow and the secret to the vigilante's invincibility. (Read More)
Subgenre: | cult filmmartial artsblack comedyallegorydark fantasy |
Themes: | supernatural powerbrutalitymurderdeathrevengerapedrunkennessheroincestpsychopathjusticeafterlife |
Mood: | gorerainneo noirpoetic justice |
Locations: | cemeterychurchbathtuburban settingrooftopinner cityrooftop fighthelicopter chase |
Characters: | waitresspolicemother daughter relationshipwarrioraction herofiance fiancee relationshipmysterious villain |
Story: | occultperson on firegraveyardimpalementfalling from heightcharacter name in titleviolencefemale nuditybloodflashbackgunfemale rear nudityfighttitle spoken by character β¦showerfirevoice over narrationshootoutcorpseshot to deathblood splattershot in the chestshot in the headslow motion scenecatswordgunfightshootingshowdownhand to hand combatbombrock musicreference to jesus christguitarcombatkung fushot in the backsubjective cameragood versus evilhalloweensword fightbased on comic bookconcertmontagethroat slittingstabbed to deathmixed martial artsstabbed in the chesttied to a chairexploding caranti heroone man armychild in perilmarriage proposalgunshotduelone against manycharacter repeating someone else's dialoguecharacter's point of view camera shotfirst partdirectorial debutshot in the armvigilanteundeadarsonfreeze framecrime bossfalling down stairssyringebulletgothicloss of loved onedrug abusesergeantexploding buildingvillainessskateboardgun fubreakfastback from the deadgun battledrug overdosekatana swordnostalgiadual wieldstabbed in the throatironyjunkiedark herothrown through a windowgang rapedead maneye gougingslaughterbody landing on a carknife throwingsword dueltragic herolasersightmain character diesengagement ringjewelrystabbed in the handkendodetroit michiganfencemegalomaniacstabbed in the armhot dogbullet balletbased on graphic novelnihilismgun duelguitar playerraveshot in the handpawnshoptragic loverighteous ragedeath of title characterfart jokerock musicianblack copfade to blackrebirthoverhead shotstairwellexit woundlong haired malefalling off a roofjeet kune doorigin of herogrungehot dog standgun katadrinking gamegun saustar died before releasecold casefalling off a balconyabandoned churchlead actor's last filmindustrial musiccalling parent by first nameknife in handdeath of cast membercrowd surfingurban gothicnocturnaldark angelreference to amelia earhartsmashing guitarhole in handmusician in castflashback montagerain fightslow motion shootoutcharred bodyeyes pecked outdevil's nighteve of weddingmurder of fiance (See All) |
In a gritty and alternate 1985 the glory days of costumed vigilantes have been brought to a close by a government crackdown, but after one of the masked veterans is brutally murdered an investigation into the killer is initiated. The reunited heroes set out to prevent their own destruction, but in d β¦oing so discover a deeper and far more diabolical plot. (Read More)
Subgenre: | conspiracysuperherodark comedydystopiaepicpost modernconspiracy theoryalternate history |
Themes: | supernatural powerbrutalitymurderdeathlovefriendshipsurrealismrapeprisonpregnancylesbianismfuneralinvestigationterrorismcancer β¦mental illnessabusecrueltyutopianuclear holocaust (See All) |
Mood: | satire |
Locations: | los angeles californiacemeterynew york cityrooftoprussiausalaboratoryairship |
Characters: | policemother son relationshipmother daughter relationshipdetectivelove trianglebullykillerpolice detectivebiblecomedianamerican dreamdeath of herokiller dogdeath of a friendacquaintance rape β¦lesbian nurse (See All) |
Period: | 1980s1970s1960s1940s1950syear 1969year 1985 |
Story: | lifting someone into the airburned aliveflyingchild murderevil manperson on firefalling from heightviolencefemale nuditymale nudityone word titlefemale frontal nudityflashbackdog β¦bare chested malekissfemale rear nudityfightcigarette smokingphotographtitle spoken by charactermale full frontal nudityexplosionknifelesbian kisssurprise endingpantiesvoice over narrationwoman on topshot to deathsex on couchblood splattershot in the chestface slapshot in the headslow motion scenewatching tvbare buttmaskvomitingmanhattan new york cityscientistshot in the backf wordreportercleavageassassinbased on comic bookdineranti heroscantily clad femaleassassinationcontroversycigar smokingshot in the legshot in the foreheadattempted murderbusinessmanprotestpoisonu.s. presidentattempted rapediaryshot in the shoulderscaramerican flagpresidentmurderersevered armvigilantecult directorsacrificedismembermentmoonriotcold wartv newsmass murderfriendship between mensociopathloss of friendspacecraftvietnameccentricswat teamvietnam warpress conferencetimecompassionrapistsocial commentaryclockmasked manretirementcynicismhit in the crotchgash in the facebroken glassevacuationsuper villainfalling to deathtitle appears in writingafghanistanstabbed in the headdark herojumping through a windowamerican presidentastronautoutlawvegetarianalternate realitypolice raidbroken armexistentialismtragic herogadgetdead woman with eyes opensecret identitydc comicsflamethrowerworld trade center manhattan new york citymelancholymoral dilemmablack bra and pantiesframed for murdergatling gunteleportationshot multiple timesatheistflagcartoon on tvmolotov cocktailkilling a dogpicturetwo man armydouble lifeintelligencebully comeuppancewatchbank robberearringrumorbased on graphic novelnihilismfemale herosaving the worldnuclear warcrime fighterman wearing glassesmarsarm cut offburn victimsovietlifting person in airtycoontrenchcoatdate rapeinnocent person killedantarcticakennedy assassinationmasked superheroflashingright wingprison riotmegacorporationjail breakdoomsdaynewscastersuper speedruthlessnessmoral ambiguitypregnant woman murdereddevastationmasked vigilanteone eyed manworld war threedead woman on bedbreast flashingmisanthropeanti villainfreak accidentkidnapped girlbuilding on firepartnershipvirtual setassassination of presidentminiature personnumber in character's namehit in the groindefenestrationpaternity revealedwater tankpost coital scenereading newspaperchest hairpostmodernsevered limbdestroyed citymilitary funeralfriends falling outnihilistpush buttonbig manpromiscuous mothersuicide pillstreet crimebad guys winwoman breaks man's necklesbophobiadeath of expectant motherpity sexrelease from jailthrown from a buildingsmileypregnant woman shotbased on cult comic bookdomino maskfalse promise of the american dreaminkblotman on topcyanide capsuleear bitten offhappy facefire rescuekent statered squaredeath of superherofake assassinationtv anchormanfloppy drivesex with hologramsoviet american cooperation (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god β¦ Horus. (Read More)
Subgenre: | martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
Themes: | supernatural powerbrutalitydeathmurderloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionseductiondeath of father β¦redemptionfaithhopeapocalypseblindnesscourageself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
Mood: | darknesspoetic justiceaustralian supernatural |
Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
Characters: | husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guywarrioraction heroex husband ex wife relationshipdeath of girlfriend |
Story: | burned aliveflyingbraceletlightningevil manimpalementfalling from heighthorsechaseviolencebloodflashbackbare chested malekissfight β¦explosionknifesurprise endingfirevoice over narrationbeatingcorpsefistfightshot in the chestrescueslow motion scenepunched in the facebattleswordbrawlshowdownhand to hand combatbeddemonorgycombatdecapitationgood versus evilsurvivalbedroomassassinsword fightambushold manaxemassacremountainbridgearmystabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armyfictional wardouble crossunderwater scenekingcreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueopening action sceneskeletondeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionbow and arrowspearassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
Maximus is a powerful Roman general, loved by the people and the aging Emperor, Marcus Aurelius. Before his death, the Emperor chooses Maximus to be his heir over his own son, Commodus, and a power struggle leaves Maximus and his family condemned to death. The powerful general is unable to save his β¦family, and his loss of will allows him to get captured and put into the Gladiator games until he dies. The only desire that fuels him now is the chance to rise to the top so that he will be able to look into the eyes of the man who will feel his revenge. (Read More)
Subgenre: | cult filmmartial artsstop motionepic |
Themes: | brutalitydeathmurderrevengesurrealismrapebetrayaljealousypoliticsescapeincestcorruptionredemptiongamblingmental illness β¦crueltydeath of wifedyingvengeancefreedomjusticecheatingcourageself sacrificeafterlifemurder of familymurder of son (See All) |
Mood: | goresurreal scene |
Locations: | desertforestitalygermanyspain |
Characters: | husband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshiptattoobrother sister relationshipsoldierwarriorsingle motherdaughteruncle nephew relationshipdeath of hero |
Story: | whipburned aliveflyingchild murderfarmerringevil manperson on fireimpalementhorseviolencebloodone word titledogbare chested male β¦kissfighttitle spoken by charactersingingfireblood splattershot in the chestface slapbattleswordarresthallucinationprayerrivercombatdecapitationsurvivalsword fightstabbingarmywidowstabbed to deathprisonerstabbed in the chestmapsnakesevered headno opening creditschilddream sequencejourneyshot in the legtrainingstabbed in the backfantasy sequencepoisonrace against timestatuetenthangingcourtspeechwigdeath of sonloss of fathertied upcharacter says i love yougeneraldismembermenttrustbattlefieldhatepowerafricanapplausegoldentertainmentgameloyaltydestructionbow and arrowspearwoundcageinjuryfamehelmetsurvivorrome italyslaverymutilationelephantcaptivehunterenemyloss of wifeblockbustersevered handparadehomehonorcrying mantorchanimal attackambitionslaveshieldvisioncrossbowfight to the deathloss of sonstabbed in the throatpet dogsonpeacebutchertime lapse photographysenatorstabbed in the legdeath of protagonistlionsundungeonslaughterarmortigerstadiumtragic heroarrowbloodbathholding handscrowdmain character diesimprisonmenttorso cut in halfcamelcontractsuffocationflagwifecrucifixionbandageskirtstreet marketsexual tensionplaguearcherycrownstabbed in the armemperormedalcheering crowdhugwetting pantscampaignarenapatricidepopularitytyrantaltered version of studio logosword and sandalcapedocumentempirefailurefamous scorebarbarianmurder of wifecrotch grabarcherscarfbladefur coatcaravanancient romegladiatorbloodshedbowdeath of title charactercaresshorse and wagoninfantryvictoryretributionphilosopherslapincestuous desiregiraffestrengthveilcarriagechantingdepravityrewardmacefurdeserterscrollleadershipbattle axecobraroman empiresliced in twospaniardstabbed in the footwisdomdevotionflaming arrowsenatemessengernephewdebaucherystabbed in the sideromanprocessionromabody armorcatapulthomesicknessnorth africagodstriumphbustbannerstar died before releasefamous songpracticesaluteantiquityslave tradeconquestchariotlancewatching someone sleeplegioncolosseumencampmentserviceroman soldiertridentanimal bitegrapessavagerywheat fieldrepubliclast man standingreference to julius caesarfighting moviesobbinggloryplacardregicidewooden swordscene based on paintingrememberingdeath of cast memberspectaclevalorhailheadless horsemanimageryburnt corpseriding accidentfrostnativesrobinroman legionsuccessorfamily betrayalgerman languagepikesalt minecaesarforced perspectivevindicationflying debriscropsidearefusalsanitationtent city2nd centuryapplescruel fatherenvoymortal woundgladiatorial combatjasminereference to hannibalroman senatethumbs upbotched executionfamous speechinsigniaoverkillroman centurionchainmailcommanddream imageryformer slavegladiatorial sportlying in statetiredcall to armscoliseumlaurel wreathroman salutetemperanceancestorsartistic imagerydigitizationskip motionthumbs down (See All) |
After its victory over Leonidas' 300, the Persian Army under the command of Xerxes marches towards the major Greek city-states. The Democratic city of Athens, first on the path of Xerxes' army, bases its strength on its fleet, led by admiral Themistocles. Themistocles is forced to an unwilling allia β¦nce with the traditional rival of Athens, oligarchic Sparta whose might lies with its superior infantry troops. But Xerxes still reigns supreme in numbers over sea and land. (Read More)
Subgenre: | epic |
Themes: | executionbrutalitydeathmurderrevengerapebetrayalpoliticsdeceptiondeath of fatherredemptionsadism |
Mood: | gore |
Locations: | desertbeachboatseashipcaveoceanstorm at seasea battlewalled cityship fire |
Characters: | father son relationshipsoldierpriesttough guywarrioraction hero |
Story: | burned alivefarmerlightningperson on fireimpalementfalling from heighthorseviolencenumber in titlebloodbare breastssequelfemale frontal nudityflashbackmale rear nudity β¦dogbare chested malesex scenefemale rear nuditynipplesexplosionknifesurprise endingfiretopless female nudityvoice over narrationwoman on topbeatingcorpsedigit in titleshot to deathblood splatterfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facebattleswordbrawlshowdownhand to hand combatsecond partcombatshot in the backdecapitationgood versus evilspyorphansword fightambushtoplessmassacredeath of friendmontagethroat slittingarmystabbed to deathstabbed in the chestnonlinear timelinechild abusesevered headno opening creditsanti herounderwater scenekingfemme fataleshot in the legdrowningtransformationtrainingstabbed in the backmoaningtentkicked in the facetough girlskeletonshot in the shoulderlong takemanipulationscarexploding bodyneck breakingthreatened with a knifesevered armgeneralwhippingqueenbattlefieldstylized violencetopless womancivil warmachismotraitordestinybow and arrowspearheavy rainshot in the stomachhelmetelephantvillainessjumping from heightskullrape victimtorchaction heroinecrushed to deathmasked manslavefemale warriorguardshieldfloodface painttarget practiceinvasiondual wieldstabbed in the throat3 dimensionalstabbed in the neckgreecenipplewizardprophecystabbed in the headmentoroilsenatorstabbed in the legrainstormeye gougingknife throwingstabbed in the eyeaxe murdersevered legdaggerprequelpalacecrowfemale soldierblood on camera lenshistorical fictiongreeksex slavestandoffshot with an arrowyoung version of charactercommandernavycornfieldbased on graphic novelman punching a womanswimming underwatercrushed headcowgirl sex positionaltered version of studio logosword and sandalarcheropen endedexploding shipbreastwarlorddeformitychild rapearmy baseathens greecethronesex from behindman slaps a womanburning buildinghunchbackstarts with narrationwoman moaning from pleasurewoman moaningancient greecemoaning womanflaming arrowmessengerman fights a womandefectorfuneral pyrekicked in the chesttidal wavestabbed in the crotchantiquityspear throwingsinking shipnaval battlevirtual setdark horse comicsmeleetunicbound in chainsarmadadoggie style sex positionwar roomsex against the wallsea serpentmultiple sex positionssex against a wall5th century b.c.hell hound (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
Subgenre: | tragedypsycho thriller |
Themes: | brutalitymurderdeathrevengesuicidekidnappingrapetorturepsychopathdeath of fatherdeath of mothersadismevildeath of wifecannibalism β¦self sacrificemadnessmurder of familyghost town (See All) |
Mood: | goreslasherhorror movie remake |
Locations: | desertcavegas stationsuv |
Characters: | family relationshipsbrother sister relationshipteenage girlteenage boyserial killerbabykillervillainterror |
Period: | year 2006 |
Story: | severed fingerburned aliveevil manperson on fireimpalementfalling from heightviolenceblooddogsurprise endingpistolblood splattercar accidentshot in the chestshot in the head β¦shotguncar crashrevolverfoot chaseaxestabbed in the chestexploding carsevered headcontroversyshot in the foreheadstabbed in the backvacationbaseball batamerican flagglassesmurdererfirst partsevered armdismembermentkillingsplattermaniacclaim in titlekilling an animalmutantragemutilationwalkie talkievictimrapisthomiciderampagestabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailerminebody countaxe murdermutationsevered legkilling spreedeath of loved onemannequinserial murderpsychopathic killerbad guyhysteriamadmancrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violencehomicidal maniacexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesbloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn β¦'t, and converts him to their cause - to destroy the underground movement. (Read More)
Subgenre: | cult filmindependent filmsuspenseconspiracytragedyparanormal phenomenabody horror |
Themes: | supernatural powerbrutalitymurderdeathsurrealismsuicidepregnancytortureescapeinvestigationdeceptionpsychopathterrorismsurveillancehome invasion β¦exploitationregret (See All) |
Mood: | gorecar chasenight |
Locations: | trainhotelhelicoptertaxigas stationschool busart museumabandoned factorycar on fire |
Characters: | doctorbrother brother relationshipartisthitmansecurity guardprofessorself mutilationhomeless mansuicide by gunshotself inflicted gunshot wounddeath of killer |
Period: | 1980s |
Story: | crashing through a windowburned aliveevil manperson on firefalling from heightchaseviolencebloodone word titleflashbackbare chested malecigarette smokingphotographtitle spoken by characterexplosion β¦surprise endingpistoltelephone callfirecorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapshot in the headshotguncomputerwritten by directorshowdownheld at gunpointcar crashinterrogationhallucinationrevolvertelephonescientistshot in the backsubjective camerafoot chaseassassinterroristsubwayexploding carbrunetteapologyman with glassescigar smokingshot in the legshot in the foreheadon the runduelscreamingfactorypay phonecharacter's point of view camera shotmissionproduct placementstatuecover upshot in the shoulderinjectionexploding bodyautomobileshot in the armcult directorpsychictraitorfalling down stairssabotagedestructionrevelationassassination attemptelectronic music scorehypodermic needledrugtied to a bedsecurity cameramagazinenosebleedphone boothpress conferencevisitgrindhousedriving a carladdermind controlart gallerycrushed to deathreverse footagesurveillance camerablood on facegash in the faceshopping mallsculptureblack and white sceneexploding headlaughterthrown through a windowopening a doormeetingburned to deathtelekinesisholding handspipe smokingtelepathyshot through a windowvillain played by lead actoryellingneedlehit in the facesubway stationarmored cartelephone boothescalatorworld dominationfilm projectormegalomaniachot dogdenialhearing voicesautumncabin in the woodsman kills a womanlying on bedwoman kills a manshot in the handseizurebullet woundsuper powerburnt bodypsychic powershot in the footlighting a cigarettemurder by gunshotman on firehuman experimenttwo brothersmind readingschizophrenicwoman with gunfade to blackdriving at nightfast food restaurantkicking in a doorscience runs amokpackagefratricideman slaps a womanrevolving doormusic storepublic phonethreatened with a gunmegacorporationthreat to killwaiting roomlooking at pictureshaking handsextrasensory perceptiontranquilizer dartburned bodyforced suicideclimbing stairscanuxploitationpsionic powerpublic telephonethrown through a wallmelting facesprinkler systemdrill in the headcomputer programpharmaceuticalsbus crashdart gunscannerknocking on a windowside effectcanadian science fictioncar crashing through a windowreference to sleeping beautyburnt corpsehypodermicexploding eyecrashing through glasswhite eyesclimbing ladderraising one's handcain and abelbrother killing brotherdriveby shootingexploding gas stationcomputer roomcomputer operatorcar crashes into buildinglighting pipe (See All) |
Arkin escapes with his life from the vicious grips of "The Collector" during an entrapment party where he adds beautiful Elena to his "Collection." Instead of recovering from the trauma, Arkin is suddenly abducted from the hospital by mercenaries hired by Elena's wealthy father. Arkin is blackmailed β¦ to team up with the mercenaries and track down The Collector's booby trapped warehouse and save Elena. (Read More)
Subgenre: | martial artssurvival horrorsadistic horrorhorror b movie |
Themes: | murderdeathrevengekidnappingtortureescapetrauma |
Mood: | gore |
Locations: | hospitalnightclub |
Characters: | husband wife relationshipfather daughter relationshipbrother sister relationshipserial killerfatherself mutilationyounger version of charactermysterious villainserial murdererkiller dog |
Story: | severed tonguecrashing through a windowsevered fingerburned aliveperson on fireimpalementchaseviolencefemale nuditybloodsequelflashbacktwo word titlebare chested maledancing β¦title spoken by characterexplosionpartyknifelesbian kisssurprise endingpistolcorpseshot to deathblood splatterfistfightshot in the chestshotgunslow motion scenepunched in the facecar crashsubjective cameramassacredeath of friendthroat slittingstabbed to deathstabbed in the chestsevered headanti herochild in perilnews reportcharacter repeating someone else's dialoguestabbed in the backcharacter's point of view camera shotkicked in the faceskeletonexploding bodytrapcharacter says i love youmercenaryex convictsevered armobscene finger gesturedismembermentsyringegrenadekilling an animalwarehousemass murdertied to a bedstabbed in the stomachspiderswat teamskullmexican standoffcrushed to deathbroken legmasked mancamera shot of feetswitchbladetrappedteamgash in the facejunkietitle appears in writingexploding headthrown through a windowassault riflebooby trapknife fighttitle at the endslaughterbody landing on a carraised middle fingerlens flarebroken armrescue missionsevered legmasked killerfirefightertorso cut in halfimpersonating a police officerserial murdercrucifixionstabbed in the handbrainwashingmazekilling a doggerman shepherdstandoffstabbed in the armhanging upside downbody in a trunkheld captiverazor bladecrushed headravestabbed in the shouldergraphic violencecheating boyfriendstabbed in the facehomeless personcut into piecesclose up of eyegrindhouse filmcaptivityreturning character with different actorcoercionbear traphung upside downflickering lightwoman punches a manswattied to a tablecadavercircular sawbreaking a car windowgiallo esquehearing aidstrapped to a bombpeepholearm casthuman skeletonstabbed through the chinlocked in a cageteam uptrip wireabandoned hotelhung from a hookiron maidenrube goldberg machinebuilding firefusepleading for helpclimbing down a ropenailed to a wall (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their β¦ dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | cult filmindependent filmsupernaturaldark fantasyurban fantasy |
Themes: | supernatural powerbrutalitymurderdeathrevengesurrealismkidnappingbetrayalpregnancyfearescapedeceptionextramarital affairangerdeath of mother β¦paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All) |
Mood: | gorenightdarkness |
Locations: | trainswimming poolairplanebathtubelevatorurban settingapartmenttruckrooftoprussiatunnelyachtfire escape |
Characters: | father son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherlittle boywitchrussian β¦pregnant womanself mutilation (See All) |
Period: | 1990s2000s20th century21st centuryyear 1992 |
Story: | spellwitchcraftlifting someone into the airlightningimpalementhorsechaseviolencefemale nuditybased on novelbloodflashbackdogtwo word titlebare chested male β¦female rear nudityfightphotographtitle spoken by characterexplosionknifesurprise endingvoice over narrationcell phonebeatingcorpseblood splatterrescueslow motion scenepunched in the facebattleswordarrestbrawlbare buttshowdownsunglassesneighborsubjective cameradecapitationgood versus evilfoot chaseflashlightsword fightambushconcertaxebridgearmystabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuescreamingcharacter's point of view camera shotmissionrace against timeknocked outtough girlopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetexploding buildingspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingpsychotronic filmimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All) |
Marvel's "Doctor Strange" follows the story of the talented neurosurgeon Doctor Stephen Strange who, after a tragic car accident, must put ego aside and learn the secrets of a hidden world of mysticism and alternate dimensions. Based in New York City's Greenwich Village, Doctor Strange must act as a β¦n intermediary between the real world and what lies beyond, utilising a vast array of metaphysical abilities and artifacts to protect the Marvel Cinematic Universe. (Read More)
Subgenre: | martial artssuperheroparanormal phenomena |
Themes: | book of magicsupernatural powermagicdeathmurdersurrealismbetrayalghostescapedeceptionapocalypsecouragephilosophyself sacrificenear death experience β¦space travel (See All) |
Mood: | raindarkness |
Locations: | deserthospitalnew york citychurchhelicoptersnowbuslondon englandapartmentpolice carouter spacefire truck |
Characters: | doctornursetough guywarrioraction heroteacher student relationship |
Period: | 2010s |
Story: | spelllightningevil manimpalementfalling from heightchasecharacter name in titleviolenceflashbackbare chested malefighttitle spoken by characterexplosionknifesurprise ending β¦firecell phonebeatingcorpsefistfightcar accidentmirrorrescueslow motion scenepunched in the facewritten by directorbattleswordbrawlhand to hand combatcar crashdemonfightingcombatdecapitationgood versus evilfoot chasebased on comic bookambushambulancemansionbasketballdeath of friendmontagemixed martial artsstabbed in the chestsevered headno opening creditsanti heroone man armyritualtransformationlatex glovestrainingone against manylibraryspiritualityelectrocutionattackproduct placementrace against timekicked in the facetough girlopening action scenescene during end creditsexploding bodylaptoplove interestbattlefieldpowerstylized violencestrong female characterhenchmansurgerytraitorfalling down stairsdestructionbulletrevelationhead buttheavy rainhong kongmagiciantemplebeardexploding buildingkicked in the stomachblockbustereccentricwristwatchtimeend of the worldaction heroineinterracial friendshipback from the deadfemale warriorshieldcameobraveryfight to the deathdual wieldresurrectionwizardimmortalitymentorscene after end creditsmarvel comicspunched in the chestbutterflyblack eyewisecrack humore mailtitle at the endhealingfemale doctorlaughingsurgeonblack magicreckless drivingteleportationarrogancesurprise after end creditsenergylevitationalleyfinal showdownmysticismfemale fighterabuse of powerportaltwo man armyworld dominationbrooklyn bridgelibrarianmegalomaniacskyscraperold flameno title at beginningsorcererartifactbullet woundguardianoperationamuletimmortalgodvending machinebo staffbaldalternate dimensionnew agetime looprelicattempted robberyx rayed skeletonearth viewed from spacementor protege relationshipnepalparallel worldsurprise during end creditssecret organizationorigin of herobrain surgerybritish actor playing american characterbroken handcollapsing buildingmysticbrass knucklesipodsequel mentioned during end creditsdisobeying ordersdefibrillationdefibrillatoranti villaincosmoshenchwomanmarvel entertainmenthand woundsupervillainout of body experiencealternate worldcloakmarvel cinematic universeevil sorcerermount everestevil godalley fightfighting in the airdying repeatedlyman wearing a tuxedomagical ringmaster apprentice relationshipoccupation in titleastral projectionzealotmagical objectlovecraftianmultiverseneurosurgeonupside downreference to beyoncereference to emineminanimate object comes to lifetime reversalparallel dimensionmentoringremoving a bulletarrogant manreference to bonoprayer wheelpsychedelic imagedimensional portalkathmandu nepalstan lee cameonew york cityscapethrown outcar falling off cliffsevered spinesuperhero origindisembodimentnerve damageenergy beamexperimental surgerysuturing a wounddisintegrating bodydoctor strangemiracle cure (See All) |
Anton belongs to the Forces of the Light as do his powerful girlfriend and apprentice, but his son is a powerful teenager from the Darkness and Anton protects him. When the balance between Light and Darkness is affected by the death of some evil vampires, Anton is framed and accused of the murders, β¦and he chases an ancient chalk that has the power of changing the destiny of its owner. (Read More)
Subgenre: | cult filmdark fantasy |
Themes: | time travelsupernatural powermurderdeathlesbianismdrunkennessredemptionapocalypseregret |
Mood: | nightdarkness |
Locations: | russia |
Characters: | father son relationshipvampirewitchrussian |
Story: | severed fingerwitchcraftimpalementfalling from heightviolencebased on novelbloodsequelflashbacktwo word titlefemale rear nudityfightlesbian kisssurprise ending β¦cell phoneshot to deathblood splattershot in the headslow motion scenewritten by directorbattlesecond partcar crashdecapitationgood versus evilflashlightsword fightdeath of friendstabbed to deathstabbed in the chestfalse accusationsevered headbirthday partypantyhosestabbed in the backpoisonpossessiondarkfemale stockinged legsdestructionhead buttstabbed in the throatblack and white sceneevidencedeath of loved oneparrotlightfemale in showerframed for murdermoscow russiamarketbugsecret societyburnt facesorcerysuntan pantyhosesevered footbody swapbody painttrolleymosquitohit by a busclairvoyanceyo yodog collarchalksoul transferencestrawbreaking through a walltruceflip bookfemale pantyhosed buttocksflieschanging historynight watch (See All) |
Set in 1935, a professor, archaeologist, and legendary hero by the name of Indiana Jones is back in action in his newest adventure. But this time he teams up with a night club singer named Wilhelmina "Willie" Scott and a twelve-year-old boy named Short Round. They end up in an Indian small distresse β¦d village, where the people believe that evil spirits have taken all their children away after a sacred precious stone was stolen! They also discovered the great mysterious terror surrounding a booby-trapped temple known as the Temple of Doom! Thuggee is beginning to attempt to rise once more, believing that with the power of all five Sankara stones they can rule the world! Now, it's all up to Indiana to put an end to the Thuggee campaign, rescue the lost children, win the girl and conquer the Temple of Doom. (Read More)
Subgenre: | cult filmmartial artsstop motion animationchrist allegorylow comedydieselpunk |
Themes: | magicmurderdeathlovefriendshipkidnappingtortureescapegangsterheroredemptionsadismcrueltyjusticestarvation |
Mood: | gorepoetic justice |
Locations: | airplanenightclubwatervillagejunglecampfireindiaairplane accidentnightclub shootoutmine car |
Characters: | father son relationshipchildrensingerboywarrioraction herovillainamerican abroad |
Period: | 1930s |
Story: | eyeballwhipsevered fingerlifting someone into the airoccultevil manperson on firefalling from heightchasecharacter name in titleviolencebloodsequelbare chested malekiss β¦pistolfireshootoutfistfightblondeface slaprescueswordgunfightriflesecond partrivercleavagesword fightbridgeprisonerstabbed in the chestsnakecultdisarming someoneone man armyargumentcursedangerpoisonskeletonhangingstreet shootouttraplove interestmonkeycard gamebow and arrowspearballoonheroinegothicslaveryroyaltyelephanttempleblockbusterfemale singerpart of trilogyhonorcompassionmexican standoffcrushed to deathslaveeaten alivebarefootadventurerreverse footagediamondbraveryseven word titlefalling to deathinsectfather figureairplane crashbooby trapheartfallmusical numbersexy womantuxedominepassionate kissvoodooprequelpalaceleather jacketheroismyellingbrainwashingspit in the facehuman sacrificecrocodilebugcomic reliefroller coasterforeignerraftadventure herofalling into watertriadlavaarcheologysoupunsubtitled foreign languagetyrantmacguffinchild kidnappingkindnessfriends who live togetheralligatorperfumefamous scorearcheologistrighteous rageoutlaw gangshrineheart ripped outtommy gunsecret passagebanquetchosen oneexploding airplaneimmolationlifting person in airheart in handtap dancingfedorahinduismbeetlecaged animalchild laborgross out humorantidoteshacklesscreaming in fearfaminestudio logo segues into filmchild driving cartyrannychild actorindiana jonesemaciationrickshawhand through chestlifting male in airbolt action riflebritish empirevoodoo dollrope bridgeconveyor beltmine shaftbelchshanghai chinawinkriver rapidschild driving a carbelchingburpcremated remainsburpingdeath trapgongsprayed with wateryawningsuspension bridgeplaying pokerturntablebritish colonialcheating at cardsprequel and sequelhallucinogeniclive chickenfemale dancervictim invited to dinnermusical sequence in non musical worksleddingthompson sub machine gunbeating heartlife raftreligious ceremonyeating brainsopening champagneflying batjourney shown on a mapkalimedium breastsyawnore cartwhite tuxedosplitsyear 1857ancient ritualcliffhangingeaten by a crocodilegrindstoneriding an elephantinnocent deaths avengedred carnationthuggeewhite dinner jacket (See All) |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β¦p her from constantly getting visions of Jessica's fate. (Read More)
Subgenre: | independent film |
Themes: | supernatural powermurderdeathsuicideinfidelityghostjealousyadulteryinvestigationdeceptionincestextramarital affairdeath of fatherunfaithfulnessmental illness β¦father daughter incest (See All) |
Mood: | rainnightmare |
Locations: | cemeteryschoolsmall townbathtubwaterwoodsrural settingwheelchaircourtroomstormbackwoods |
Characters: | husband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshiptattooboylawyersingle motherlustwitchsheriffsuicide by hanging |
Story: | satanismburned aliveoccultlightningperson on firegraveyardviolencefemale nudityf ratedbloodfemale frontal nudityflashbackmasturbationmale rear nuditydog β¦two word titlebare chested malegunfightdancingphotographexplosionpartyleg spreadingpantiestelephone callfirebeatingdreamcorpsewatching tvthongbare buttsecretliedead bodysex standing uphallucinationhandcuffscleavagecandlestrangulationwomanwidowwhite pantieschild abusetrialscantily clad femaleritualunderwater scenesearchgraveliarmissing personbaseball batflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upgrandmotherwhippingcult directorpsychictherapygarageheart attackgirl in pantiespickup trucknipples visible through clothingsexual attractioncaught having sextherapistdysfunctional marriageback from the deadchokingmechanicsexual desirecamera shot of feetredneckwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.sexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All) |