Best popular movies like Watership Down:

Do you need specific genre & keyword selection to find films similar to Watership Down?
<< FIND THEM HERE! >>

Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Watership Down (1978)

Based upon Richard Adam's novel of the same title, this animated feature delves into the surprisingly violent world of a warren of rabbits as they seek to establish a new colony free of tyranny and human intervention. Frightening and bloody in some scenes. Not recommended for young children.

Subgenre:
adult animationallegorycult filmindependent film
Themes:
friendshipsurrealismdeathlove
Mood:
gore
Locations:
englandfarmboatforest
Characters:
villainbrother brother relationship
Story:
philosophy of lifeutopia questdeath threatbird attackriver crossinganimal deathphilosophical conversationsnareforeshadowinginjured animaldigruntdrainseerballadeer β€¦dog attacktrancehillfriends who live togetherbullet woundcapefableseagullraftfencesuffocationphysical abuseraidsiegeecologyvisionanimal attackhomeblockbusterlifetalking animalquestkilling an animalundergrounddirectorial debutsadnessthreatcountrysidefarmerrabbitkeytreeshot in the legjourneybirdambushriverplace name in titlecatslow motion scenevoice over narrationbased on noveltwo word titlefightdogviolenceblood (See All)

Homeward Bound: The Incredible Journey (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Homeward Bound: The Incredible Journey (1993)

Three pets (Chance, a young dog unfamiliar with the world; Shadow, an aging, wise dog; and Sassy, a snobby cat) are left behind when their family goes on vacation. Unsure of what happened, the animals set out on a quest to find their family. This journey across America is very dangerous and the anim β€¦als risk never seeing their masters again. The group of pets travel across forested mountains and areas of wide-open countryside, while their family searches for them in the same areas. (Read More)

Themes:
friendshipescapedysfunctional familywilderness
Mood:
affection
Locations:
farm
Characters:
family relationshipsboygirllittle girllittle boyhuman animal relationshipstepfather stepson relationshipdog actorcat actor
Story:
animal attacktalking animalquestcountrysiderabbitjourneycatbased on noveldogremakerescuemountainon the roadreunionfirst part β€¦chickenwaterfallbearloyaltyinjurypresumed deadveterinariansarcasmfalling into watergrasscross countrydog moviepitturkey the birdgolden retrieverskunkanimal sheltershrimplost in woodspet owner relationshipporcupinemountain lionsierra nevada mountainspet owner reunionboxer doglost pettriangle the musical instrumentanimal escapes pounduse of phrase bad hair day (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Monty Python And The Holy Grail (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Monty Python And The Holy Grail (1975)

History is turned on its comic head when, in 10th century England, King Arthur travels the countryside to find knights who will join him at the Round Table in Camelot. Gathering up the men is a tale in itself but after a bit of a party at Camelot, many decide to leave only to be stopped by God who s β€¦ends them on a quest: to find the Holy Grail. After a series of individual adventures, the knights are reunited but must face a wizard named Tim, killer rabbits and lessons in the use of holy hand grenades. Their quest comes to an end however when the police intervene - just what you would expect in a Monty Python movie. (Read More)

Subgenre:
cult filmindependent filmblack comedyabsurdismsword and sorceryepicslapstick comedybritish comedybased on sketch comedy
Themes:
surrealismmurdermonsterseductioncannibalismcommunism
Mood:
goresatirespoofbreaking the fourth wall
Locations:
englandforestvillagecastlecave
Characters:
father son relationshippolicefrench
Story:
balladeerfriends who live togethersiegeanimal attackquestdirectorial debutcountrysiderabbitvoice over narrationviolencebloodsingingsurprise endingrescuelow budget film β€¦britishdecapitationsword fightthroat slittingimpalementlegendwritten and directed by cast memberactor playing multiple rolesskeletonsevered armcowdismembermentheart attackhand grenadeeccentricflatulenceknightpart animationmonkcrushed to deatheaten alivepresumed deadabsurd humorreverse footagearranged marriagehit in the crotchwizardensemble castmedieval timesdungeonducksevered legwedding receptionirreverenceflagnarratorspiral staircaseplaguecomedy troupegorillaarcherymacguffinchapter headingsriddlehermitanachronismanarchismabsurdno endingtauntingcowardiceexcrementcoconutfired from a jobswallowcatapultmidnight moviecult movie castking arthurrope bridgeholy grailwhite rabbitdepiction of godcamelotarthurian legendabyssllamadark agesmovie reality crossovermonty pythonanthraxscriptureminstrelflagellation10th centuryintermissionmusical sequence in non musical worktrojan horsefrench stereotypeno ending creditslancelotexploding animalstorybook in opening shotcorporeal mortificationrotisserietauntsuspected witchattempted filicideblack knightkiller rabbit (See All)

Princess Mononoke (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Princess Mononoke (1997)

While protecting his village from rampaging boar-god/demon, a confident young warrior, Ashitaka, is stricken by a deadly curse. To save his life, he must journey to the forests of the west. Once there, he's embroiled in a fierce campaign that humans were waging on the forest. The ambitious Lady Ebos β€¦hi and her loyal clan use their guns against the gods of the forest and a brave young woman, Princess Mononoke, who was raised by a wolf-god. Ashitaka sees the good in both sides and tries to stem the flood of blood. This is met be animosity by both sides as they each see him as supporting the enemy. (Read More)

Subgenre:
adult animationcult filmmartial artstragedyepicdisneydark fantasysword and fantasychrist allegory
Themes:
lovefriendshipherodeceptionnatureprejudicemythologysamurai
Mood:
goreanime
Locations:
forestjapan
Characters:
warriorhuman animal relationshipsamurai sword
Period:
16th century15th century
Story:
utopia questfableblockbusterlifejourneytwo word titlefightviolencebloodf ratedcharacter name in titleguntitle spoken by characterknifechase β€¦blood splatterhorseswordshowdownriflehand to hand combatdemonfightingcombatshot in the backdecapitationsword fightweaponanimaldisarming someonefictional warprincesstransformationduelcurseopening action scenemanipulationsevered armhateprincestrong female characterspiritwolfbow and arrowheroinemutilationhunterstrong female leadcompassionfemale warriorkatana sworddual wieldpeaceenvironmentalenvironmental issuedark heroknife fightsword duelenvironmental issuesdaggerfolklorekendosuper strengthconservationgirl powerkindnessfamous scoretolerancemusketdeforestationgiant animalfortshot with a bow and arrowboarhorse chasemoral ambiguityirondilemmawild boarforest protectionleprosyelknature conservationanimal protectionferal childsevered limbpanterritoryhuman versus animalwhite wolfthe westcutting off a handanimal allytalking wolf (See All)

The Secret Of Nimh (1982) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Secret Of Nimh (1982)

Mrs. Brisby, a widowed mouse, lives in a cinder block with her children on the Fitzgibbon farm. She is preparing to move her family out of the field they live in as plowing time approaches, however her son Timothy has fallen ill, and moving him could prove fatal. Mrs. Brisby visits The Great Owl, a  β€¦wise creature who advises her to visit a mysterious group of rats who live beneath a rose bush on the farm. Upon visiting the rats, Brisby meets Nicodemus, the wise and mystical leader of the rats, and Justin, a friendly rat who immediately becomes attached to Mrs. Brisby. While there, she learns that her late husband, Mr. Jonathon Brisby, along with the rats, was a part of a series of experiments at a place known only as N.I.M.H. (revealed earlier in the story as the National Institute of Mental Health). The experiments performed on the mice and rats there boosted their intelligence, allowing them to read without being taught and to understand things such as complex mechanics and electricity. The rats and Mr. Brisby escaped from N.I.M.H. and came to live on the Fitzgibbon farm. The rats created a home for themselves under Mrs. Fitzgibbon's rose bush, creating an elaborate habitation of beautiful chambers, elevators, and Christmas lights. However, the rats are unhappy in their dependence on the humans, who they are stealing electricity from, and have concocted a plan to leave the farm and live independently. Because of her husband's prior relationship with the rats, they agree to h… (Read More)

Subgenre:
allegorycult filmindependent film2d animation
Themes:
surrealismdeathmurderescapemagiccourageself sacrifice
Locations:
farmforest
Characters:
villainchildrenmotherdaughter
Story:
balladeerfriends who live togetherhometalking animalsadnessfarmercatbased on noveldogviolencebloodknifecryingswordsecret β€¦bedscientistgood versus evilsword fightwidowanimalduelstabbed in the backmissionratmurderertied upropeheroinecagemousespiderfrogcrushed to deathanthropomorphismticklingsonwizardsocietymustachepuppysword duelowlcrowmudauntelectricitytractorlast will and testamentsoupcartoon violencefinal battleanimal experimentationamuletanimal that acts humandeterminationnew housewashingpneumoniamothreference to the book of matthewspider webmild violencerelocationsadhalf dressed cartoon animalanthropomorphic mousecobwebcat versus mousebarefoot cartoon animalbubblesplowropesfarmboyill childcat attackbig catdaughtersrose bushsick animalferal catmale hits a femalepsychadelic image (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Willow (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Willow (1988)

A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village β€¦ council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)

Subgenre:
cult filmmartial artsfairy talesword and sorcerydark fantasysword and fantasychrist allegory
Themes:
friendshipsurrealismrevengekidnappingbetrayaladulteryescapemonsterheromagicredemptionsadismcourageforgivenessbook of magic
Mood:
rainpoetic justice
Locations:
farmboatforestsnowvillagelakecastlecampfireroad movie
Characters:
villainfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendlittle girllittle boywitch β€¦self discoverycrying babybaby girl (See All)
Story:
dog attackraftanimal attacktalking animalquestfarmerjourneyrivercatdogbloodfightcharacter name in titleone word titlekiss β€¦dancingtitle spoken by characterknifechasecryinghorsepunched in the facebattleswordfalling from heightmaskbookshowdownhand to hand combatislandcombatsubjective cameragood versus evilsword fightmountaindisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualold womanprincesstransformationcursemissiondragontentkicked in the facelightningskeletonbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raincagecatfightlifting someone into the airloss of friendhidingvillainessgoatapplefemale warrioradventurerdwarfshieldfairywizardprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamsmokedaggercrowhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dogfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltarstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All)

Babe: Pig In The City (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Babe: Pig In The City (1998)

After Babe's great victory in the shepherding contest, Farmer Arthur Hoggett turns down all offers to make money with his pig's talents. But when he gets hurt severely in the well, his wife has to take up farming. She does her best but cannot meet the bank's requirements, which results in the necess β€¦ity of getting back to Babe. Soon, Esme Hoggett is sitting in a plane headed for "the" city. There, Babe unwillingly causes deep trouble. He has to stay with Mrs. Hoggett in the only hotel in town that accepts pets. Friendly neighbours send officials who catch all animals from the hotel: Cats, dogs, chimpanzees and many others. Babe, who managed to stay free, decides to help his new friends and gets unexpected help - not only by Ferdinand, who flew all the way to the city. (Read More)

Subgenre:
allegorycult filmfish out of wateraustralian fantasy
Themes:
pregnancyheromagictheftredemption
Locations:
farmhospitalhotelhelicopterbicycleairportrural settingurban settingaustralia
Characters:
husband wife relationshipsingeractorthiefdog actorcat actor
Period:
1990s
Story:
runtballadeerdog attackfriends who live togetherfableraidtalking animalfarmercatvoice over narrationdogcharacter name in titlesequelsingingchase β€¦firesongrescuesecond partanimal in titlemanhattan new york citybridgeanimalclownchampagnemissionon the roadsuitcasepigmonkeyballoonmousestealingsheepbirthcommunitytarget practiceaviationaccidental killinganimal name in titlegiving birthfire extinguishereiffel tower parisepisodic structuresydney australiastrandedanimal rightswellfalling into watergoldfishbankerkittendrug traffickingstatue of liberty new york citychandelierbankruptcychimpanzeerescue from drowninginner title cardx rayed skeletonchrysler building manhattan new york citycanalfinanceguard doggooseboarding houseforeclosurepoodlemetropolisbig cityorangutanstray dogfiring rangechaptersdogcatcherfishbowlhomesteadmonkey actorterrierjack russell terrierchildren's wardpregnant animalpig actorcharity ballfat personstate fairdrug sniffing dogfalling down a well (See All)

The Wizard Of Oz (1939)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wizard Of Oz (1939)

In this charming film based on the popular L. Frank Baum stories, Dorothy and her dog Toto are caught in a tornado's path and somehow end up in the land of Oz. Here she meets some memorable friends and foes in her journey to meet the Wizard of Oz who everyone says can help her return home and possib β€¦ly grant her new friends their goals of a brain, heart and courage. (Read More)

Subgenre:
allegory
Themes:
friendshipescapedancemagicdysfunctional familyguiltabductioncourage
Locations:
farmforestsnowbicyclevillageroad tripcastlewalled city
Characters:
husband wife relationshipsingerhostagewitchuncle niece relationshipaunt niece relationshipcoronerevil witchgirl and her dog
Story:
animal attackhometalking animalquestthreattreejourneycatdogtitle spoken by charactersingingfirecryingsongdream β€¦horserescuesecretfalling from heightgood versus evilaxedisguisechild in perilperson on fireflowermonkeyrunawayfaintinglifting someone into the airwitchcraftvillainesscompassioncrushed to deathclockguarddwarfinnocenceimpostorpet dogwizardawardlionjumping through a windowheartdeath of sisterdungeonsnowingsecret identityfortune tellerbrainadolescentcrowauntlevitationgatefireballfarmhousetween girlmedalhot dogtornadoshoecornfieldunconsciousnessfantasy worldchandelierscarecrowhot air balloonbeauty salonbechdel test passedreference to abraham lincolnkansaspigtailsrecluselocked in a roomintellectualdoormanvoyagemagic spellcurtainbroomcowardicebubblecrystal ballfalling asleepniecehomesicknesshourglassbasketrich snobalternate universetalking to a dogdeus ex machinait was all a dreampleadingwizard of ozcrossroadslittle personpet owner relationshipcharlatandrawbridgereference to julius caesarfarm handapple treegreen skinreference to cleopatracycloneanimate treedeath certificatediplomaowner dog relationshipwavinghaunted forestreference to isistin mansmall dogtalking treefacadeslipperwoodsmanreference to the egyptian god osirisaccidental herobroomstickomaha nebraskahome sweet homepigstybucket of waterflying monkeyimaginary landmagical shoegood witchskywritingfloating headloyal doganthropomorphic treemelting womanoil canpoppy fieldflying witchhonorary degreeruby slippers (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Lord Of The Rings (1978) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lord Of The Rings (1978)

A young Hobbit named Frodo (Guard) is thrown on an amazing adventure, when he is appointed the job of destroying the one ring which was created by the dark lord Sauron. He is assigned with warriors including Gandalf (Squire), Aragorn (Hurt) and Boromir (Cox). It's not going to be an easy journey for β€¦ the Fellowship of the Ring, on the ultimate quest to rid Middle-Earth of all evil. (Read More)

Subgenre:
cult filmsword and sorcery2d animationepicdark fantasysword and fantasy
Themes:
surrealismmonsterheromagicself sacrificeend of mankind
Mood:
gore
Locations:
castle
Characters:
villainwarriordeath of hero
Story:
friends who live togethersiegequestjourneyambushbased on novelviolencebloodsequelchaseshot to deathblood splatterrescuebattleshowdown β€¦demoncombatgood versus evilfoot chasebridgeno opening creditsfictional warmissionringfirst partcult directorbattlefieldbow and arrowwitchcraftback from the deaddwarfhungersuper villainfalling to deathwizardkingdomelfgroupsidekickwar violencestandofffortresssorcererfantasy worldmacguffinsword and sandalgoblinstabbed in the shoulderprehistoric timescavalrystaffstarvingshot with a bow and arrowlast standhorse chasefictional countryaxe fightbattle axeprehistoryemaciationrotoscopingmultiple cameosorchobbitcavalry chargemiddle earthenchantmentright hand manwizardryhalflingpsychadelic image (See All)

Babe (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Babe (1995)

Gentle farmer Arthur Hoggett wins a piglet named Babe at a county fair. Narrowly escaping his fate as Christmas dinner when Farmer Hoggett decides to show him at the next fair, Babe bonds with motherly border collie Fly and discovers that he too can herd sheep. But will the other farm animals, inclu β€¦ding Fly's jealous husband Rex, accept a pig who doesn't conform to the farm's social hierarchy? (Read More)

Subgenre:
australian fantasychrist allegory
Themes:
friendshipchristmasjealousyfearherolonelinessfaithadoptionprejudicecourage
Mood:
affection
Locations:
farmcemeterywater
Characters:
dog actorhorse actor
Story:
runtfableblockbustertalking animalfarmercatvoice over narrationbased on noveldogbloodcharacter name in titleone word titlegunsingingcrying β€¦horsesecretfalling from heightcompetitionorphandeath of friendattackpigfirst partloss of mothercowrunawaysurvivorloss of friendmousehidingnew year's evesheepcompassionembarrassmentwatching televisionmisunderstandingchristmas evemustacheduckpuppyalarm clockseparationanimal name in titleheroismunderdoggatepaintinspirationadopted sonkindnesspunfamous scoreroosterpasswordslaughterhousefireworkhaygranddaughtergrandsonmotivationalmockeryfastingbarkingpet owner relationshipmother figurebaby bottlecomfortfuse boxborder colliesheepdogyarncommon coldscally cappig actorhearing impairmentcrowingpawprint (See All)

Epic (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Epic (2013)

Young Mary Katherine (M.K.) returns to her eccentric scientist father's home, but his all-consuming quest to discover a tiny civilization in the neighboring forest drives them apart. However, M.K. soon finds herself shrunken down by Queen Tara of that forest who was mortally wounded by the putrefyin β€¦g Boggans, and charged to deliver a pod bearing the new Queen to safety. Together with a veteran Leafman warrior, two goofy mollusks and a young maverick, M.K. agrees to help. As the villainous Boggan leader, Mandrake closes in, M.K. and her new friends must draw on the best of themselves together and discover what they have to save their world. (Read More)

Subgenre:
martial artscgi animationsword and fantasy
Themes:
friendshipescapemagic
Locations:
foresttaxi
Characters:
father daughter relationshipteenage girlfemale protagonistwarriorsamurai swordself doubt
Story:
siegehometalking animalquesttreebirdambushdogkisschasebased on bookrescuebattleswordbrawl β€¦showdownhand to hand combatsciencescientistgood versus evilsword fightvideo cameraarmyno opening creditsfictional warsearchduelloss of motherlove interestqueenmoonbow and arrowhelmetloss of friendmousefull moonsurveillance cameraloss of son3 dimensionaldeerarmorplantbatswordsmandoubtparkourshot with an arrowno title at beginningfantasy worldpunfinal battlesole black character dies clichewoman shotsnailstaffjumpminiaturizationipodsaddlesurprise attackdecaymild violenceminiature personslugmoonlightsudden change in sizedeath of queenfruit flyparchmentbat the animalbud (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Secret Of Kells (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Secret Of Kells (2009)

Young Brendan lives in a remote medieval outpost under siege from barbarian raids. But a new life of adventure beckons when a celebrated master illuminator arrives from the isle of Iona carrying an ancient but unfinished book, brimming with secret wisdom and powers. To help complete the magical book β€¦, Brendan has to overcome his deepest fears on a dangerous quest that takes him into the enchanted forest where mythical creatures hide. It is here that he meets the fairy Aisling, a mysterious young wolf-girl, who helps him along the way. But with the barbarians closing in, will Brendan's determination and artistic vision illuminate the darkness and show that enlightenment is the best fortification against evil? (Read More)

Themes:
surrealismnaturetheftabuse
Mood:
rain
Locations:
forestcavesea monster
Characters:
boyuncle nephew relationship
Story:
siegevisionlifequesttreecatsingingfirebookcandleattackstorytellingsplit screenpigunderwater β€¦irelandmagical realismwolfbow and arrowvandalismmonktrappedthunderconstruction sitefairyfather figureeye gougingcrowmonasterylong haireyetowervikingshot with an arrowwallconstructionwhisperingmacguffinclimbing a treemanuscriptbarbarianfeathergoosestarts with narrationrascalinkabbeydisobediencequillmagic bookabboticonographythird eyescribehouse catforest spiritcodexquill penoubliettefox spiritcity wall (See All)

Pan (2015) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pan (2015)

Subgenre:
martial artscoming of ageabsurdismslapstick comedyfish out of watersteampunkswashbucklersword and fantasychrist allegory
Themes:
friendshipdeathsurrealismmurderrevengekidnappingbetrayalfearescapeherodeceptionmagicfaithhopecourage β€¦near death experience (See All)
Locations:
boatforestlondon englandwoodsshipouter spacecavecampfirecable car
Characters:
mother son relationshipchildrenboybabyhostagewarriornative americanamerican abroadmermaidship captaincrying boyboy crying
Period:
world war two1940s1930s
Story:
visionanimal attackkeytreejourneyambushriverslow motion scenevoice over narrationbased on novelfightviolencecharacter name in titleone word titlegun β€¦title spoken by characterexplosionknifechasesurprise endingpistolfirefistfightface slaprescuepunched in the facebattleswordbrawlfalling from heightlettershowdownheld at gunpointhand to hand combatbombcombatsubjective cameragood versus evilorphanflashlightsword fightaxemountainmixed martial artsmapnunno opening creditschild in perilfictional warunderwater scenecreaturesearchprincesson the runtrainingflash forwardattempted murdercharacter repeating someone else's dialogueprologueattackfugitivecharacter's point of view camera shotstatueevil manknocked outkicked in the facetough girlskeletonmartial artistexploding bodytied upthreatened with a knifebattlefieldstylized violencehenchmanflirtingropepiratedestinycaptainflyingspearslaverycowboy hatjail cellkicked in the stomacheccentricgiantjumping from heightirishorphanagetorchaction heroinesocial commentarybald manslavecannoneaten alivefemale warriorguardexplosivechild's point of viewbraveryfairydual wieldanimated sequencechild protagonist3 dimensionalfalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestbooby trapmusical numbertribeminekingdomsword duelcellarflamethrowerprequelclose up of eyesheroismflagminingfemale fightershipwreckcrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfantasy worldfighter pilotreluctant heroilliteracyaltered version of studio logohumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanegiant animalpirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laboralternate worldblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcewarrior racereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying fishflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All)

Alice In Wonderland (1951)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Alice In Wonderland (1951)

Alice is a daydreaming young girl. She finds learning poems and listening to literature boring. She prefers stories with pictures and to live inside her imagination. One day, while enduring just such a poetry reading, she spots a large white rabbit...dressed in a jacket and carrying a large watch. H β€¦e scurries off, saying he's late, for a very important date. She follows him through the forest. He then disappears down a rabbit hole. Alice follows, leading her to all manner of discoveries, characters and adventures. (Read More)

Subgenre:
cult filmfairy tale2d animation
Themes:
surrealismmagicanger
Locations:
englandforestbeachseaocean
Characters:
female protagonistgirlsister sister relationship
Period:
19th century1860s
Story:
blockbustertalking animalrabbitkeytreebirdcatbased on noveldogcharacter name in titletitle spoken by charactersingingpartychasethree word title β€¦firecryingdreamfalling from heighttearsbirthdayfishjudgetrialanimalbirthday partyunderwater scenekingcreaturetransformationsmokingumbrellaflowersunderwatergardenflowertwinfireworksqueenmoonsisterteaeggcakehatmousehammerladderrealityeaten aliveanthropomorphismimaginationchild's point of viewsandanthropomorphic animalrosesunbutterflycaneirreverencevictorian erainvisibilitybottlelizardcrownharmonicajurypocket watchfantasy worldtoastgiving a toastcookiemushroompipereading a bookaltered version of studio logomatchredcarpenterparallel universecarrotlobstercardsecret passagealternate dimensioncalendardooralice in wonderlandsugarlabyrinthcaterpillartitle appears in songminiaturizationdaydreaminghedgehogangryshrinkingoystertalking cattea partykeyholesneezeplaying cardit was all a dreamwhiteshoremalletwhite rabbitdimensionsentenced to deathcroquetflamingopaintbrushbad temperwalrusrocking horsestarfishmustardharehookahteapotspiderwebfalling into a holejamwonderlanddoorknoblift skirtsudden change in sizebird's nestrose gardenchanging sizesmoke ringteacupangry womanhybrid animalmad hatteranthropomorphic rabbitbloomersdodogrowing in sizerabbit holeanimal wearing clothesanthropomorphic flowergiantesscharacter shaped holecheshire catdodo birdenlargementlewis carrollno narrationqueen of heartsanthropomorphic sunred paintpied pipermispronounciationtalking flower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

King Arthur: Legend Of The Sword (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history
Themes:
friendshipdeathsurrealismmurderrevengekidnappingmoneybetrayaljealousyprisonfearescapefuneralmonsterdeception β€¦magicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All)
Mood:
rainnightmaredarkness
Locations:
englandboatforestlondon englandwatervillagewoodslakeshipcastlecavebrothelsewer
Characters:
brother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy β€¦maidwitchuncle nephew relationshipmermaidself doubt (See All)
Story:
death threatraidvisionanimal attackblockbustershot in the legambushriverslow motion scenedogviolencebloodfightcharacter name in titleflashback β€¦bare chested maletitle spoken by characterexplosionknifechasesurprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataletransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedgiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknametarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the faceprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingdark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All)

The Hobbit: The Desolation Of Smaug (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: The Desolation Of Smaug (2013)

After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h β€¦is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)

Subgenre:
martial artscoming of agesword and sorcerydark fantasysword and fantasy
Themes:
deathmurderrevengedrunkennessescapemonsterdeceptionmagicredemptionunrequited lovehome invasiongreed
Mood:
rainnightmare
Locations:
boatforestsnowsmall townvillagewoodscastlecave
Characters:
father son relationshipfather daughter relationshipbrother sister relationshipsoldierhostagethieftough guylove trianglewarrioraction heromayorsingle father
Story:
balladeerfriends who live togetheranimal attackblockbusterquestkilling an animalkeyshot in the legjourneyambushriverbased on novelfightbloodviolence β€¦character name in titlesequelflashbackphotographtitle spoken by characterexplosionpartyknifechasefiredreamshot to deathblood splatterfistfightshot in the chestshot in the headrescuewritten by directorbattleswordarrestbrawlfalling from heighthand to hand combatsecond parthallucinationcombatshot in the backsubjective cameradecapitationgood versus evilfoot chaseassassinsword fightstrangulationaxemountainthroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestmapfishsevered headno opening creditschild in perilfictional warunderwater scenekingcreaturetransformationshot in the foreheadcharacter repeating someone else's dialoguestabbed in the backperson on firefantasy sequencepoisoncharacter's point of view camera shotdragonrace against timeknocked outtough girlskeletonringshot in the shoulderscarneck breakingtrapwaterfallshot in the armpubsubtitled scenestylized violencesingle parenticegoldfalling down stairsbow and arrowspearassassination attemptbarnjail celltreasuregiantskullaction heroinegoatfemale warriorguarddwarfshieldburglarflooddual wieldstabbed in the throat3 dimensionalstabbed in the neckshot in the facewizardprophecystabbed in the headstabbed in the legfogcapturedisfigurementknife throwingstabbed in the eyeeye patchlens flarekingdomprequelteleportationpipe smokingtorso cut in halfelftombfemale soldierinvisibilitydirector cameoshot in the neckfemale fightergiant monsterbeeshot with an arrowamputeestabbed in the armwellshot in the eyecrystaldammushroomstabbed in the shoulderclimbing a treeshot in the throatdisfigured faceopen endedcorrupt officialshapeshiftingsubterraneanjewelfreedom fighterbarrelclose up of eyeanimal killingforce fieldarmoryleg woundburning buildinghumangiant spiderchopping woodstabbed in the mouthgold coinwheelbarrowhidden doorwine cellargiant creaturelost in the woodsorbdog sledfire breathing dragoncliffhangerspider webhealing powerstaringcocoonsignalhobbitmoonlightprequel and sequelnecromancersinger offscreenflying dragonminstrellive action remaketapestryflatterywinged dragonwhite mouseapprehensiongold ringstone bridgetalking dragongold statuepoisoned arrowsilver coinbare foot manpile of goldsleepyglowing crystalthrush (See All)

The Hobbit: An Unexpected Journey (2012) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: An Unexpected Journey (2012)

Bilbo Baggins is swept into a quest to reclaim the lost Dwarf Kingdom of Erebor from the fearsome dragon Smaug. Approached out of the blue by the wizard Gandalf the Grey, Bilbo finds himself joining a company of thirteen dwarves led by the legendary warrior, Thorin Oakenshield. Their journey will ta β€¦ke them into the Wild; through treacherous lands swarming with Goblins and Orcs, deadly Wargs and Giant Spiders, Shapeshifters and Sorcerers. Although their goal lies to the East and the wastelands of the Lonely Mountain first they must escape the goblin tunnels, where Bilbo meets the creature that will change his life forever ... Gollum. Here, alone with Gollum, on the shores of an underground lake, the unassuming Bilbo Baggins not only discovers depths of guile and courage that surprise even him, he also gains possession of Gollum's "precious" ring that holds unexpected and useful qualities ... A simple, gold ring that is tied to the fate of all Middle-earth in ways Bilbo cannot begin to know. (Read More)

Subgenre:
sword and sorcery
Themes:
monstercouragecooking over a campfire
Locations:
forestcastlecavetunnel
Characters:
warrioryounger version of character
Story:
balladeerfriends who live togetheranimal attacklifequestundergroundkeyjourneyvoice over narrationbased on novelfightflashbackexplosionchasesurprise ending β€¦firerescueswordfalling from heighthand to hand combatgood versus evilsword fightaxemountainstabbingbridgecolon in titlestabbed in the chestmapsevered headdisarming someonekingfive word titledragonringfirst partwaterfallsevered armgoldwolfbow and arrowhead butttreasureexploding buildingwitchcraftgiantsevered handcrushed to deathdwarf3 dimensionalwizardbutterflyaerial shotwilhelm screamprequelelfcontractnarrated by characterinvisibilityeyecomic reliefshot with an arrowamputeesunrisetrolleaglegoblinslingshotclimbing a treepart computer animationprehistoric timesopen endedwriting a letterblacksmitharm cut offriddleclose up of eyemale male hugred wineleaving homegold coinponyogrerunning for your lifehedgehogmale singerprehistorywalking stickemaciationlooking in a windowmothturned to stonecaught in the rainfire breathing dragonancientbridge collapseburied treasureuninvited guestfootbridgeorclighting a candlemagical ringinvented languagehobbitmiddle earthbeheadedunderground citydiversiongiant birdnecromancerrunesinger offscreenlive action remakescenic beautysmoke ringactor reprises previous rolefictional languagesmoking a piperockslidecrescent moonelongated cry of nofissurequill penrotisserieunexpected visitorbuglerhanging from a ledgewriting memoirsstolen treasurefalling down a holefish dinnerpile of goldrunning on a bridgeunexpected gueststhrushunderground lake (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Balto (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Balto (1995)

A half-wolf, half-husky named Balto gets a chance to become a hero when an outbreak of diphtheria threatens the children of Nome, Alaska in the winter of 1925. He leads a dog team on a 600-mile trip across the Alaskan wilderness to get medical supplies. The film is based on a true story which inspir β€¦ed the Iditarod dog sled race. (Read More)

Subgenre:
cult film2d animation
Themes:
surrealismprejudicecouragewilderness
Locations:
boatforesthospitaltrainsnowwoodscavestormalaska
Characters:
boyfriend girlfriend relationshipdoctorchildrengirlbullyself esteemself identity
Period:
1920s
Story:
balladeerfriends who live togethertalking animalsadnessthreattreedogcharacter name in titleone word titlebased on true storyrescuefalling from heightliepianochild β€¦coffindrowningpop musicfirst of seriesactor playing multiple rolesrace against timeknocked outcheerleaderracingrockwolfmedicineracediseaseclassical musicpart animationpresumed deadsunfalllightlyingarroganceanimal name in titlesidekickoutcastnarratorcartoon dogoutsiderhot dogunconsciousnessblizzardglasssense of smellpart live actionpolar bearrescue from drowningavalanchecolddog moviebiplanetreesbroken bottleanimal that acts humanstrengthfootprintgoosetauntingbandanasnowstormfalling off a clifffrozen lakeserumboulderpneumoniacold weatherchorushowlingdog sledboiler roomspider webtenorpart animatedaudio flashbackfurnaceunconsciousbear attackhalf breediciclenorthern lightsfalling over a clifftelegraphspiderwebhusky dogdog racedog racingsled doghowlsinger offscreenyear 1925mockingright hand manfootprintsill childknocked unconciouswhite wolfcartoon wolfdiptheriaiditarodilluminationwolf dogfootprint in the snownome alaskapawprint (See All)

Sin Nombre (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sin Nombre (2009)

Honduran teenager Sayra reunites with her father, an opportunity for her to potentially realize her dream of a life in the U.S. Moving to Mexico is the first step in a fateful journey of unexpected events.

Subgenre:
video
Themes:
deathmurderrobberytraveldeath of father
Mood:
raintrain robbery
Locations:
boattrainchurchcarcemeterypolice carmexico
Characters:
family relationshipsfather daughter relationshipboyfriend girlfriend relationshiptattooboyteenage girlteenage boygirlbabyuncle niece relationshipdeath of girlfriend
Story:
river crossingraftlifetreejourneyrivercatviolencefightdoggunsex scenekisscigarette smoking β€¦chaseshowertelephone callcryingcell phoneshootoutbeatingshot to deathface slappunched in the facecameraundressinggunfightshootingliedead bodybedroomgangimmigrantmapaccidentsearchimmigrationgunshotpay phoneattempted rapelong takescartransvestitehuggingbulletheavy rainmachetehidingaccidental deathrailway stationmexicanblood on facebackpacksmugglingkickingtaking a picturehit on the headbananaborderillegal immigrantwoman in underweartext messagingborder crossinggang violenceman in underwearrailroadtrain trackstrain ridekiller childgang memberillegal immigrationgang leaderchild with gunborder patrol555 phone numbertelephone numberbucketcentral americarailroad trackdigital cameraguatemalamexican borderhiding in a carmexican american bordersign of the crossblisterhuman smugglinghondurasrock throwingmemorizationfalling from a traininner tuberailroad trestletrestlebiting a handriding the railschiapascrossing the bordermexican gangmara salvatruchateardrop tattooveracruz mexicodeath warrantreference to salma hayek (See All)

The Sword In The Stone (1963)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sword In The Stone (1963)

Arthur (aka Wart) is a young boy who aspires to be a knight's squire. On a hunting trip he falls in on Merlin, a powerful but amnesiac wizard who has plans for Wart beyond mere squiredom. He starts by trying to give Wart an education (whatever that is), believing that once one has an education, one  β€¦can go anywhere. Needless to say, it doesn't quite work out that way. (Read More)

Subgenre:
sword and sorcery2d animationdisney
Themes:
surrealismmonstermagic
Locations:
englandforestsnowlondon englandwoodscastle
Characters:
boywitchmerlin
Story:
friends who live togetherblockbustertalking animalrabbittreebirdcatbased on noveldogtitle spoken by characterhorseswordorphansnakefish β€¦ritualunderwater scenetransformationfive word titledueldragonchickenwolfbow and arrowelephantmousefrogknighttournamentgoatdivingwizardprophecymedieval timesfalldeerturtlekingdomowlcrocodilecrownsquirrelblackboardcrabrattlesnakecoldhawkthronetitle appears in songminiaturizationhuman becoming an animalrhinocerosmagic wandwashing dishesdisobeying ordersfire breathing dragonking arthuranvilplatewalrustalking birdexcaliburarthurian legenddisobediencethermometertalking fishround tablesquirestorybook in opening shot6th centurychicken poxgiantesssword in stonecharacter turns greenanimal licking someonewizards' dueldirty dishesrefusing to believe (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Peter Pan (1953) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Peter Pan (1953)

An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.

Subgenre:
coming of age2d animationdisneyswashbuckler
Themes:
surrealismfriendshipkidnappingjealousyheromagicangerchildhoodmythology
Locations:
englandboatlondon englandseacavejunglecity of children
Characters:
brother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenboybrother sister relationshipgirllittle girlnative americanlittle boymermaid
Period:
1900s
Story:
friends who live togetherseagullblockbusterrabbitjourneybased on noveldogfightcharacter name in titletitle spoken by characterbased on playdreamrescueswordbed β€¦islandgood versus evilorphansword fightmapcigar smokingprincessduelattempted murderumbrellafirst partwaterfallbearmonkeypiratecaptainflyingwoundlifting someone into the airimpersonationteddy bearclockexplosivefairychild protagonistshadowpipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassescloudfantasy worldaltered version of studio logoskyoutlaw gangracial stereotyperaccoonhookpirate shiprhinocerosbig ben londonskunkhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandseashell bikinimagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All)

10,000 Bc (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

10,000 Bc (2008)

A prehistoric epic that follows a young mammoth hunter named D'Leh's journey through uncharted territory to secure the future of his tribe. When a band of mysterious horse-riding warlords raid the Yaghal camp and kidnaps his heart's desire - the beautiful Evolet along with many others, D'Leh is forc β€¦ed to lead a small group of hunters south to pursue the warlords to the end of the world to save her. Driven by destiny, the unlikely band of warriors must battle saber-toothed cats and terror birds in the Levant. (Read More)

Subgenre:
epic
Themes:
lovefriendshipdeathmurderkidnappingbetrayalprisondancemonstermagicdeath of motherabusedyingblindnessself sacrifice β€¦huntingdeath in childbirthmurder of motherfight for freedom (See All)
Mood:
rain
Locations:
boatsnowdesertvillagelakejunglecampfire
Characters:
father son relationshipmother son relationshipfriendboygirldancerpriestwarriorreference to godwitch
Story:
seerraidanimal attackquesttreejourneybirdrivervoice over narrationfightbloodnumber in titlekissdancingknife β€¦chasefirecryingbeatingcorpsefoodhorserescuepunched in the facebattlefalling from heightmasklietearshand to hand combatdead bodyjailhallucinationcombatorphanmassacremountainstabbingdeath of friendeatingarmyprisoneracronym in titlefictional warritualsearchflash forwardlegendstabbed in the backprologuespiritualityliartentlightningskeletonscarpursuitstalkinggifttrapwhippingsubtitled scenemoongolddestinybow and arrowspearwoundinjuryslaveryjail cellcaptivehuntertempletorchburialdinosaurslavepromiseshieldfloodface painttarget practicetelescopeconstruction sitewhiprejectionresurrectionfalling to deathbutcherprophecyfather figureabsent fathersuperstitionaerial shotfallrainstormtribesmokeheroismspittingsunsetmysticismagriculturemeathuman sacrificesailboatshot with an arrowarcherywhistledrumhuntstretcherpyramidpremonitionblizzardprehistoric timesdeath of familyrevoltstealthritescoldingcavalryuprisingbonedreadlocksnegotiationpitrebirthvulturesailing shiploinclothchantingspiritualismcustomfloodingsnowstormnetmessiahhornanimal rescuefuneral pyrepharaohnorth africaexhaustionethnographytalking to an animaltrekcaught in a netseedstar gazingstone agecollapsestampedechantseparation from familythrown from heighttrackingpriestessblessingwar paintherdmammothancient cultureconstruction craneallycave womanstabbed with a spearcave drawinggiant birdwoolly mammothdying in someone's armsfalling objectmanaclesancient citydragged along the groundslave revoltlong fingernailssabertooth tigertrampledtransferencetribal warfarearmbandcauterizing a woundcheerprimitive artbuilding a firefalse godclub the weaponmedicine womansabre toothed catwhipping a slave10000 b.c.arrow in one's backrising from the gravethatched roofthe onewalking in circleshearthimpaled on a spearmurder of a kingslave uprising (See All)

Straw Dogs (1971)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Straw Dogs (1971)

Upon moving to Britain to get away from American violence, astrophysicist David Sumner and his wife Amy are bullied and taken advantage of by the locals hired to do construction. When David finally takes a stand it escalates quickly into a bloody battle as the locals assault his house.

Subgenre:
cult filmindependent film
Themes:
deathmurderrevengemarriagerapedrinkingfeardrunkennessvoyeurismseductionangercorruptionbrutalitysadismevil β€¦home invasionalcoholismcrueltytraumahunting (See All)
Mood:
gorenight
Locations:
farmbarchurchcarcemeterysmall townvillagerural settingtruck
Characters:
brother brother relationshiphusband wife relationshipsingerteenage girlwriterbullylustalcoholiccousin cousin relationshipamericanuncle nephew relationshipamerican abroad
Story:
siegehomesadnessthreatcountrysidebirdcatslow motion scenebased on novelbloodfightviolencedogsexfemale nudity β€¦flashbackgunkisscigarette smokingsingingpartyknifepantiesfirecryingsongshootoutbeatingshot to deathunderwearblood splattercar accidentmirrorshot in the chestface slapshotguncomputerdrinkgunfightshootingrifleanimal in titlebedbathroomvoyeurreference to jesus christprayerfightingcombatscientistsubjective camerabedroomcandlegangold manstrangulationwomanmontageman with glassesscantily clad femalehit by a carcontroversycigar smokingbartenderpaingunshotauthorbeaten to deathfired from the jobmini skirtpassionscreamsensualityspeechpianistisolationtrapratstagepubarsonrecord playerchessmachismoeyeglassesfireplacedestructiondesirenipples visible through clothingmass murdershot in the stomachsexual abusesexual attractionrecordingragemagicianvandalismhidingdysfunctional marriageaccidental deathlossdesperationfemale singerrape victimrapistmexican standoffhomicidesexual desirerampagewhiskeyswitchbladebraveryhypocrisyburglarymercilessnessironybroken glassstairsaccidental killingfogswingknife throwingcaneduckliving roomsexual assaultroomalienationexhibitionismshamedead girlintimidationmagic trickclosetbottlemental retardationbitternesssexual violencemajorfarmhousebroken windowoutsiderold flameanimal crueltyself defenseanal rapedenialexhibitionistgreenhouseblackboardyuppiegun dueldisappointmentreverendbreaking a windowcarnagechewing gumex conshocksoccer ballshot in the footcar radiogravestonemurder by gunshotchild molesterdead birddead catcaressblack cathypocriteantiquemasculinityhouse firevillagerpet catarm slingcurtainloss of controlexit woundmissing girlchurch bellpunchingclothes rippingbear traphooliganphonograph recordburnmistreatmentbarricaderesentmenthostilitytricyclevicarsexual crueltyexterminatorgrandfather clockpacifistbreaking glassmathematiciandeath of petsex offendersanctuaryflirtloud musicdartsfinger cutmoral corruptionpacifismrefugekilling a catchalkcornwallteaseariamagistrateparty hatunderage girlcountry homefireplace pokerdefianceskipping ropepeace signprovocationburn injurypathologydestroying propertydart boarddiversionnauseanubile womangirl wearing a miniskirtcomplicitynewton's cradlealetree swingangry wifegun combatmentally challenged manfake nosetimiditychurchyardderanged manfoot blown offhand slapchildish behaviorcut telephone linemaking a scenestalled carimmature adultroof repairrooferworking at homehanged catnoise maker (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Colony (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Colony (2013)

Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.

Subgenre:
independent filmmartial artssuspensepost apocalypsedystopiacreature featuresurvival horror
Themes:
deathmurdersuicidebetrayalfearescapedeceptionnaturebrutalitysadismsurveillanceexecutionpaniccannibalismcourage β€¦self sacrificenear death experiencestarvation (See All)
Mood:
gorenightmaredarknesssavage
Locations:
farmhelicoptersnowwatertunnel
Characters:
husband wife relationshipboyfriend girlfriend relationshipteenage boyzombiehostagetough guywarrioraction herointerracial relationshiplittle boysecurity guardengineerex soldier
Period:
futurewinternear future
Story:
bullet woundundergroundthreatrabbitkeyshot in the legambushslow motion scenevoice over narrationtwo word titlefightviolencebloodflashbackgun β€¦kisstitle spoken by characterexplosionknifechasesurprise endingpistolfireshootoutbeatingdreamcorpseshot to deathblood splatterfistfightfoodshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattlegunfightbrawlfalling from heightshootingshowdownrifleheld at gunpointhand to hand combatdead bodyhandcuffsrevolvercombatshot in the backf worddecapitationgood versus evilsurvivalfoot chaseorphanflashlightaxethroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headdream sequenceanti herodisarming someonecreaturesearchshot in the foreheadattempted murderbeaten to deathdangerstabbed in the backscreamingfactorymissionrace against timetough girlshot in the shoulderpursuitexploding bodydeath of sonlaptopthreatened with a knifechickenprofanitydismembermentblood spatterchessicehead buttspearmachetesurvivormutantdiseasevirussecurity camerabeardmagazineexploding buildingkicked in the stomachladderbald maneaten alivefemale warriorculturereverse footagehaunted by the pasttensionexplosivebraveryfight to the deathstabbed in the throatcannibalmanhuntmercilessnesspower outagestabbed in the neckmutehungerbutcherenvironmentalstabbed in the headcigarette lighterenvironmental issuestabbed in the legdynamiteinfectionknife fightdark pastlens flareaxe murderrescue missionglobal warmingweathermoral dilemmaclimate changeblood on camera lensporn magazinefinal showdownfemale fighterepidemicstrandedblood stainflaresicknesshead bashed incoughingman kills a womanoffscreen killingmeat cleaverleaderski maskmonitorstabbed in the shouldersole black character dies clichequarantinetragic pastintergenerational friendshippsychotronic filmbreaking through a doorcolonybutcherygogglestrenchcoatattempted robberygas explosionpower strugglehands tiedaxe fightcar wreckcloudsfrozen bodycollapsing buildingclimatebonesdark futuredisobeying ordersboiler roombeehivewater bottlecold the temperatureenvironmental disasterice agespear throwingoutpostbridge collapsehuman preyhead cut in halfair ventcorpse with eyes openhandcuffed to a bedshot in the eardismembered bodyfleshsearch and rescueweather manipulationunderground bunkersignalaxe in the chestsurviveabandoned cityexploding bridgetransmissionclimbing a ladderdistress signalhit with a metal pipecanadian science fictionseedscannibal cultpower generatoraxe in the backcollapsing bridgefrozen corpsegas tankopening creditscontrol towerice planetbarricading doordestroyed bridgefemale security guardliving undergroundsharpened teethventweather controldowned helicoptergenetic research (See All)

Kiki's Delivery Service (1989) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kiki's Delivery Service (1989)

This is the story of a young witch, named Kiki who is now thirteen years old. But she is still a little green and plenty headstrong, but also resourceful, imaginative, and determined. With her trusty wisp of a talking cat named Jiji by her side she's ready to take on the world, or at least the quain β€¦tly European seaside village she's chosen as her new home. (Read More)

Subgenre:
cult filmcoming of age2d animation
Themes:
friendshipsurrealismpregnancymagic
Mood:
anime
Locations:
forestbusbicycleurban settingseacitystormbicycle accidentairship
Characters:
mother daughter relationshipteenage girlfemale protagonistpolicemanartistmaidwitchself discovery
Story:
bird attackhometalking animalbirdcatdogcharacter name in titlethree word titlesurprise endingtelephone callbased on bookrescuefalling from heightrunningaccident β€¦white pantiesradioold womanscene during end creditsgiftcabineuropeflyingwitchcraftcommunityhitchhikingfull moonthunderstormscene after end creditsairplane crashrainstormstuffed animalinspirationinventionfemale friendshipfriendship between girlsbakerycabin in the woodsdisappointmentpiekindnessfeversick childblack catbakingbroompancakecourierrainy nightsmall businessmultiple english dubsfreight trainstar died before releasetalking catclock towerzeppelinseaside townmother figureparty invitationbad weatherteenage witchhereditary gift of witchcraftdirigibledelivery servicefamous themeartist modelseduction between girlsultralight aircraftgood witchcourier servicegoodwill (See All)

The Hobbit: The Battle Of The Five Armies (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: The Battle Of The Five Armies (2014)

After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.

Subgenre:
martial artssword and sorceryepicsword and fantasyhigh fantasy
Themes:
deathlovemurderrevengebetrayalghostescapedeceptionobsessioninsanitygreedself sacrifice
Mood:
poetic justice
Locations:
boatforestsnowdesertcastlecavewalled city
Characters:
brother brother relationshipfather son relationshipfather daughter relationshipbrother sister relationshipsoldiertough guywarrioraction heromayor
Story:
balladeerfriends who live togetheranimal attackblockbusterthreatrabbitambushslow motion scenebased on novelviolencedogfightsequelflashbackexplosion β€¦knifesurprise endingfirecorpseshot to deathhorseshot in the chestshot in the headrescuepunched in the facebattleswordfalling from heightshowdownhand to hand combatdead bodydemonhallucinationcombatshot in the backdecapitationgood versus evilsurvivalsword fightaxemountaindeath of friendthroat slittingbridgearmystabbed to deathstabbed in the chestmapsevered headno opening creditschild in perilfictional warkingcreaturethird partnecklacedrowningstabbed in the backperson on firefantasy sequencedragonstatuetentknocked outtough girlopening action sceneringdeath of brotherpigmercenarysevered armbearrefugeesubtitled scenebattlefieldstylized violencecivil wariceropegolddestinydestructionbow and arrowhead buttspearcagehelmetloss of friendloss of loved onetreasurehammercrying womangiantjumping from heightpart of trilogyfaked deathknightforbidden lovehonorburialaction heroinegoatcrushed to deathpresumed deadfemale warriorbarefootdwarfshielddual wieldstabbed in the throat3 dimensionalchaosevacuationfalling to deathwizardstabbed in the headstabbed in the legsexy womandeath of loved oneloss of brothermoral dilemmaprequelpipe smokingauctionbatelfinvisibilityanti warreturning character killed offruinsapparitionwoman cryingfemale fightertoweramputeearcherycrownstabbed in the armeaglewoman kills a mangoblinstabbed in the shoulderfinal battlecowardarcherraveneight word titleshape shifterstabbed in the facecorrupt officialexploding housewoman fights a manshapeshiftinghit with a hammersorceressinfantryjewelcockney accentanimal killingarmorytear on cheekcity hallepic battlescottish accentadaptationbanishmentgold coinjail breaksuit of armorfranchisestabbed in the footcousinarsenalliterary adaptationsecret passagewayhidden doorgiant creaturecatapultanti villainman dressed as a womanmultiple cameosoutnumberedfalling through icebridge collapsebell towerelkorchobbitmiddle earthacorngiant wormtunicgemstonescepterprequel and sequelgiant birdhogsinger offscreenminstrelrock throwinglive action remakebare foot womansmoking a pipecollapsing bridgefemale archergiant batpeace negotiationgold ringstone bridgewhite magicblack bloodpile of goldarmy on the march (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Aristocats (1970)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Aristocats (1970)

Retired madame Adelaide Bonfamille enjoys the good life in her Paris villa with even classier cat Duchess and three kittens: pianist Berlioz, painter Toulouse and sanctimonious Marie. When loyal butler Edgar overhears her will leaves everything to the cats until their death, he drugs and kidnaps the β€¦m. However retired army dogs make his sidecar capsize on the country. Crafty stray cat Thomas O'Malley takes them under his wing back to Paris. Edgar tries to cover his tracks and catch them at return, but more animals turn on him, from the cart horse Frou-Frou to the tame mouse Roquefort and O'Malley's jazz friends. (Read More)

Subgenre:
2d animationdisney
Themes:
deathsurrealismkidnappingjealousydancegreed
Mood:
night
Locations:
trainmotorcycleparis francefrancetruck
Characters:
singerdancerartistsingle mother
Period:
1910s
Story:
balladeerfriends who live togetherlifetalking animalbirdrivercatfightdogdancingtitle spoken by charactersingingsonghorserescue β€¦pianogood versus evilnewspaperwomandinnerumbrellapianistdisappearancerecord playerjazzeavesdroppinghatmousefrogmilkanthropomorphismanthropomorphic animalfather figurebutlerthunderstormfallhorse and carriagedrumseiffel tower parispaintaccordionfalling into watergramophonerailroadtrumpetwindmillacoustic guitarpitchforksymboltrunktalking dogmotorcycle with a sidecarcarriagegoosesleeping pillchopstickshayharptalking catskylinecastle thunderanimal protagonistbassistbowler hatmilkmantalking birdfishing polelead singertalking horsecroonertrumpetersinging animalanthropomorphic catdouble bassharpistexpression taken literallytalking mouseaccordionistbass voicebaritone voicespiraling eyesalto voicelead guitarist (See All)

The Golden Compass (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Golden Compass (2007)

It was no ordinary life for a young girl: living among scholars in the hallowed halls of Jordan College and tearing unsupervised through Oxford's motley streets on mad quests for adventure. But Lyra's greatest adventure would begin closer to home, the day she heard hushed talk of an extraordinary pa β€¦rticle. Microscopic in size, the magical dust--discovered in the vast Arctic expanse of the North--was rumored to possess profound properties that could unite whole universes. But there were those who feared the particle and would stop at nothing to destroy it. Catapulted into the heart of a terrible struggle, Lyra was forced to seek aid from clans, 'gyptians, and formidable armored bears. And as she journeyed into unbelievable danger, she had not the faintest clue that she alone was destined to win, or to lose, this more-than-mortal battle... (Read More)

Subgenre:
epic
Themes:
friendshipsurrealismkidnappingdrinkingdrunkennessescapeabductioncourageenvironmentmissing child
Locations:
boatforestlondon englandseashiprooftoplaboratoryairship
Characters:
mother son relationshipfather daughter relationshipmother daughter relationshipfriendchildrentattooboyfemale protagonistgirlwitchuncle niece relationship
Story:
homeblockbusterlifetalking animalquestrabbitbirdcatvoice over narrationbased on novelviolencedogexplosionknifechase β€¦pistolfirehorserescuedrinkbattleswordlettershootingriflerunningcollegerobotdemoncolor in titleorphanwinecandlestrangulationmountainbridgemapsnakeno opening creditsanimalchild in perilfictional warcontroversykingsearchnecklacetransformationcursebinocularspoisonmissionstorytellingringpursuitneck breakingfirst partcabinbearsubtitled scenemonkeystrong female charactersurgeryexperimenticeeavesdroppingwolffireplacebow and arrowflyingspearcagemouseskullstrong female leadstreet lifeclockfull moonwhiskeyadventurerchild's point of viewcrossbowfight to the deathintriguechild protagonistprophecysoulalternate realityarmorglobal warmingowlclosethiding in a closetgateschemealarmarcticshot with an arrowarcheryclimbing through a windowfantasy worldmetamorphosisfemale herohot air balloondeskshape shifterparallel universepolar bearmagnifying glassglacierbarrelchosen oneimmolationlifting person in airhawkvoyagecompassthronesurgical operationnorth poledustsledlordleopardoverheard conversationegyptianmother son reunionhourglassicebergvillainess played by lead actressfalconcaught in a netdog sledtalking catwatchtowerzeppelinheresyoxford universityaviatorfly the insectfalling over a cliffdisobediencebrushing hairchasmpraying mantishiding under a tablesteamshipsea voyagechain mailraptoranimal skullgobletfjordchild thiefcollapsing bridgesighttalking bearpaddlewheel boatfate of the universefalling down a mountainice axesnow leopardbased on cult bookshoulder bagflying witchice bearspirit animal (See All)

Fantastic Mr. Fox (2009) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fantastic Mr. Fox (2009)

It is the story of one Mr. Fox and his wild-ways of hen heckling, turkey taking and cider sipping, nocturnal, instinctive adventures. He has to put his wild days behind him and do what fathers do best: be responsible. He is too rebellious. He is too wild. He is going to try "just one more raid" on t β€¦he three nastiest, meanest farmers that are Boggis, Bunce and Bean. It is a tale of crossing the line of family responsibilities and midnight adventure and the friendships and awakenings of this country life that is inhabited by Fantastic Mr. Fox and his friends. (Read More)

Subgenre:
martial artsstop motionstop motion animationpuppet animationcaper comedy
Themes:
kidnappingpregnancytheftredemption
Locations:
farmtrainschoolhelicopterairplanerural settingsewer
Characters:
husband wife relationshipfather son relationshipmother son relationshipsingerstudentmusicianwriterlawyerthiefartistsecurity guardcousin cousin relationshipuncle nephew relationshipaunt nephew relationship
Story:
raidlifetalking animalundergroundfarmertreeambushbased on novelcharacter name in titledancingtitle spoken by characterexplosionsingingknifefire β€¦based on bookrescuewatching tvbattlemaskpaintingbombkung fureporterbound and gaggedprisonermappaintergunshotbinocularsmicrophonepianisttrapratcoachsupermarketwolfathletebreaking and enteringtape recordercaptiveanthropomorphismtrappedanthropomorphic animalheadphonesmeditationtitle at the endvegetariantrophyfiremanfoxalarmtrailer homewhistletape recordingcredit cardnewspaper articlebased on children's bookx rayed skeletonbanjoturkey the birdtaleanimal protagonistbadgerelectric fencefoaming at the mouthmanholebeagle dogchicken coopacornfarm lifevixenwhimsicalciderchemistry classtrain setrabid dogstorybook in opening shotroald dahlsteam shovelbased on cult bookstealing a chicken (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Bambi (1942)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bambi (1942)

The animated story of Bambi, a young deer hailed as the 'Prince of the Forest' at his birth. As Bambi grows, he makes friends with the other animals of the forest, learns the skills needed to survive, and even finds love. One day, however, the hunters come, and Bambi must learn to be as brave as his β€¦ father if he is to lead the other deer to safety. (Read More)

Subgenre:
2d animationdisney
Themes:
lovedeathfriendshipbetrayalnaturedeath of motherself sacrificehunting
Mood:
rain
Locations:
forestsnowcanadaforest fire
Characters:
father son relationshipmother son relationship
Period:
1940swinter
Story:
dog attackblockbustertalking animalrabbitbirdbased on novelfightdogcharacter name in titleone word titletitle spoken by characterfirerescuelieanimal β€¦fantasy sequencefirst of serieslightningflowerloss of mothertwinprincehunterfroganthropomorphic animalgunshot woundthunderstormbutterflyice skatingrainstormdeerduckgrowing upowlanimal name in titleshynesssquirrelaltered version of studio logospringlogstudio logo segues into filmfrozen lakeskunkcastle thunderaudio flashbackunseen charactermaturationfawnriverbankno narrationbambiopossumtalking rabbit (See All)

Dracula Untold (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula Untold (2014)

At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk β€¦s at a terrible cost. (Read More)

Subgenre:
tragedychrist allegory
Themes:
deathsurrealismlovemurderrevengesuicidekidnappingbetrayalfeardeceptionbrutalitysupernatural powerdeath of motherhopedeath of wife β€¦self sacrificemythologynear death experience (See All)
Locations:
forestchurchlondon englandwoodscastlecave
Characters:
husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampirewarrioraction heroself mutilationex soldierself healingblood lust
Period:
15th century
Story:
capesiegeanimal attacklifedirectorial debutambushriverslow motion scenevoice over narrationbloodviolencecharacter name in titleflashbackbare chested maleexplosion β€¦knifechasesurprise endingfirebeatingcorpseblood splatterhorserescuepunched in the facebattleswordfalling from heightshowdownhand to hand combatrunningdemoncombatsubjective cameragood versus evilcandlesword fightaxemassacremountainthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in periltransformationon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingperson on firecharacter's point of view camera shottentevil manlightningskeletonshot in the shoulderscarcrossthreatened with a knifesevered armgeneralbare chested male bondagerefugeesubtitled scenebattlefieldfreeze frameprincestylized violencemaniacdestinywolfbow and arrowburned alivehead buttspeargothicheavy rainhelmetcrucifixloss of wifespiderskulltorchmonkburialback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingkingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeasterrighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All)

Gladiator (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gladiator (2000)

Maximus is a powerful Roman general, loved by the people and the aging Emperor, Marcus Aurelius. Before his death, the Emperor chooses Maximus to be his heir over his own son, Commodus, and a power struggle leaves Maximus and his family condemned to death. The powerful general is unable to save his  β€¦family, and his loss of will allows him to get captured and put into the Gladiator games until he dies. The only desire that fuels him now is the chance to rise to the top so that he will be able to look into the eyes of the man who will feel his revenge. (Read More)

Subgenre:
cult filmmartial artsstop motionepic
Themes:
deathsurrealismmurderrevengerapebetrayaljealousypoliticsescapeincestcorruptionbrutalityredemptiongamblingmental illness β€¦crueltydeath of wifedyingvengeancefreedomjusticecheatingcourageself sacrificeafterlifemurder of familymurder of son (See All)
Mood:
goresurreal scene
Locations:
forestdesertitalygermanyspain
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother sister relationshipsoldierwarriorsingle motherdaughteruncle nephew relationshipdeath of hero
Story:
capesuffocationvisionanimal attackhomeblockbusterfarmershot in the legjourneyriverviolencefightdogbloodone word title β€¦bare chested malekisstitle spoken by charactersingingfireblood splatterhorseshot in the chestface slapbattleswordarresthallucinationprayercombatdecapitationsurvivalsword fightstabbingarmyimpalementwidowstabbed to deathprisonerstabbed in the chestmapsnakesevered headno opening creditschilddream sequencetrainingstabbed in the backperson on firefantasy sequencepoisonrace against timestatuetentevil manringhangingcourtspeechwigdeath of sonloss of fathertied upcharacter says i love yougeneraldismembermenttrustbattlefieldhatepowerchild murderafricanapplausegoldentertainmentgameloyaltydestructionbow and arrowburned aliveflyingspearwoundcageinjuryfamehelmetsurvivorrome italyslaverymutilationelephantcaptivehunterenemyloss of wifesevered handparadehonorcrying mantorchambitionslaveshieldcrossbowfight to the deathloss of sonstabbed in the throatwhippet dogsonpeacebutchertime lapse photographysenatorstabbed in the legdeath of protagonistlionsundungeonslaughterarmortigerstadiumtragic heroarrowbloodbathholding handscrowdmain character diesimprisonmenttorso cut in halfcamelcontractflagwifecrucifixionbandageskirtstreet marketsexual tensionplaguearcherycrownstabbed in the armemperormedalcheering crowdhugwetting pantscampaignarenapatricidepopularitytyrantaltered version of studio logosword and sandaldocumentempirefailurefamous scorebarbarianmurder of wifecrotch grabarcherscarfbladefur coatcaravanancient romegladiatorbloodshedbowdeath of title charactercaresshorse and wagoninfantryvictoryretributionphilosopherslapincestuous desiregiraffestrengthveilcarriagechantingdepravityrewardmacefurdeserterscrollleadershipbattle axecobraroman empiresliced in twospaniardstabbed in the footwisdomdevotionflaming arrowsenatemessengernephewdebaucherystabbed in the sideromanprocessionromabody armorcatapulthomesicknessnorth africagodstriumphbustbannerstar died before releasefamous songpracticesaluteantiquityslave tradeconquestchariotlancewatching someone sleeplegioncolosseumencampmentserviceroman soldiertridentanimal bitegrapessavagerywheat fieldrepubliclast man standingreference to julius caesarfighting moviesobbinggloryplacardregicidewooden swordscene based on paintingrememberingdeath of cast memberspectaclevalorhailheadless horsemanimageryburnt corpseriding accidentfrostnativesrobinroman legionsuccessorfamily betrayalgerman languagepikesalt minecaesarforced perspectivevindicationflying debriscropsidearefusalsanitationtent city2nd centuryapplescruel fatherenvoymortal woundgladiatorial combatjasminereference to hannibalroman senatethumbs upbotched executionfamous speechinsigniaoverkillroman centurionchainmailcommanddream imageryformer slavegladiatorial sportlying in statetiredcall to armscoliseumlaurel wreathroman salutetemperanceancestorsartistic imagerydigitizationskip motionthumbs down (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

War For The Planet Of The Apes (2017) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

War For The Planet Of The Apes (2017)

Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and β€¦ the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)

Subgenre:
suspensetragedypost apocalypsedystopiaepicchrist allegory
Themes:
friendshipdeathmurderrevengesuicidekidnappingbetrayalfeartortureescapedeceptionmilitarytravelangerbrutality β€¦obsessiondeath of motherparanoiaredemptionhopedeath of wifepanicdyingself sacrificenear death experiencemurder of familyprison escapestarvationfuture war (See All)
Mood:
raindarkness
Locations:
forestbeachhelicoptersnowdesertwatervillagewoodscavejunglecampfiretunnelmilitary truck
Characters:
brother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshiptattoosoldierbabyhostagelittle girlsnipersniper rifledeath of a friend
Period:
near future
Story:
animal attackblockbustertalking animalquesttreejourneyambushslow motion sceneviolencefightbloodsequelflashbackbare chested malephotograph β€¦explosionknifechasesurprise endingpistolfireshootoutbeatingdreamcorpseshot to deathfistfightfoodmachine gunhorseshot in the chestshot in the headshotgunrescuebattlegunfightbrawlfalling from heightshootingshowdownrifleheld at gunpointsunglassesinterrogationhallucinationalcoholcombatshot in the backsubjective camerasurvivalorphanflashlightstrangulationaxemassacremountaindeath of friendmontagebridgearmyimpalementprisonerweaponmapno opening creditspart of serieschild in perilfictional wardouble crossthird partattempted murderbinocularsbeaten to deathdangerattackcharacter's point of view camera shotmissionrace against timedollknocked outtankopening action scenedeath of brotheramerican flagtragic eventexploding bodydeath of sonwaterfallflowerloss of motherhandgunwhippingsubtitled scenemonkeybattlefieldak 47missileropetraitorshavinghand grenadesabotagegrenadedestructionbow and arrowspearwarehouseheavy rainmachetecagehelmetviruscaptivewalkie talkiecrucifixstealingloss of loved onebeardhammerexploding buildingloss of wifedesperationlaserrocket launchertorchburialcolonelsocial commentaryprison guardfloodinvasionu.s. armycrossbowloss of sonwhiphatredmercilessnessmutespecial forcesdeath of protagonistassault rifleinfectionaerial shotprisoner of warshadowcommandocapturebulletproof vestcliffbordertribesnowingrescue missionlasersightarrowbonfiredeath of loved onerpgexploding helicopterloss of brothersign languagesmokemoral dilemmashaved headgatling gungrenade launchermain character diesimprisonmentfemale soldierabandoned buildingflagfinal showdownreturning character killed offarmored caralarmabandoned houseshot with an arrowgorillawallshoutinghugclimbingkidhelicopter crashfilm starts with textfallingbehind enemy linesmercy killingblizzardrazorleaderbody bagaltered version of studio logofinal battleskychainedchimpanzeepart computer animationcommando raidmurder attemptaperighteous ragedeath of familybowtragic endingholepsychological tortureavalancheheroic bloodshedloss of familyhermitanimal killingarmy baseassisted suicidevalleyknocked out with a gun buttberetfleeingloggas explosiontrilogyphotoepic battlehorse chasemercypunchingkeysleadershipbarricadeguerilla warfaremilitantleft for deadorangutanshot in the sidewhite horsenational anthemsaddlestar spangled bannersurprise attackexoduspickaxeoutrunning explosionmissile launcherplatoonslave laborspear throwingforced laborprisoner of war campsecret tunneldarwinismtexthead shavingmute childunderground tunnelescape planprovocationoasissimian fictionfeedingmilitary campexploding bridgelast wordsprequel and sequellockupcoveranimal fightman versus naturemilitary jeeptalkingcaesarfernplanet of the apes50. caliber machine gunsequel to a rebootthrowingturncoattalking animalsfall downapesrolling (See All)

The Little Mermaid (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Little Mermaid (1989)

In Disney's beguiling animated romp, rebellious 16-year-old mermaid Ariel is fascinated with life on land. On one of her visits to the surface, which are forbidden by her controlling father, King Triton, she falls for a human prince. Determined to be with her new love, Ariel makes a dangerous deal w β€¦ith the sea witch Ursula to become human for three days. But when plans go awry for the star-crossed lovers, the king must make the ultimate sacrifice for his daughter. (Read More)

Subgenre:
fairy tale2d animationfish out of waterdisneybased on fairy tale
Themes:
lovesurrealismfriendshiprevengebetrayalfeardanceweddingmagicangerfalling in loveself sacrifice
Locations:
boatbeachkitchenseashipcastleoceanstormcaribbeanstorm at seasea foodsea stormship firesea witch
Characters:
family relationshipsfather daughter relationshipteenagerteenage girlfemale protagonistmusicianpriestsister sister relationshipbest friendmaidwitchmermaidevil witchmysterious girllittle mermaid
Period:
19th century1830s
Story:
bird attackfriends who live togetherseagullanimal attackblockbusterlifetalking animalsadnessfightdognuditykisstitle spoken by characterexplosionsinging β€¦knifethree word titlefiremirrorrescuebattlebirthdaybedgood versus evilcookingconcertdisguisefishdinnerforeign language adaptationbathkingprincessdrowningtransformationdangerbased on short storymistaken identitystatuelightningexploding bodyfirst partunderwaterfireworkssacrificeprincerockropepirateteen angstdestructiondressheroinescene during opening creditslifting someone into the airroyaltywitchcraftvillainessgiantcheffrogsharkbrideteenage protagonistanthropomorphismtelescopeanthropomorphic animalmuterowboathypnosismusical numberspyingyoung loveturtlesailorduckkingdomwishsmokespellcontracthappy endingsidekicksunsetlaundrydockscene before opening creditsflutelegs16 year olddolphinnude girlunconsciousnessbubble bathfemale heroswimming underwatermeat cleaverpipepotionfinal battlecrabstar crossed loversrainbowalter egooctopusexploding shiprescue from drowningsnailconductornakedbarrelwavemagic spellshark attackx rayed skeletoncanceled weddingwedding cakefat womancarriagehumanbirdsdefeatvoicedealcuriosityseal the animalforkpuppet showfalse namedanishstruck by lightningjamaicanharpoonblowing out candledisobeying orderslifting a female into the airfireflycollectinganchorcastle thunderclotheslinecinderella storysuper villainesslagoonseashellblue eyesjack in the boxmalletevil laughtershrimpsunken shiphans christian andersenseasicknessred eyesflamingolairfake namemaster of disguisestarfishpelicantridenttalking birdsea turtletrue identity revealedsailwolf whistlewhirlpoolgrottowhite hairmermanblowing smoke in someone's faceredheaded girltalking fishinterspecies romanceseafoodseahorseangry fathersinging animalbedtimeloss of voicedisney princessbluebirdpinching nosecombing someone's hairbitten on the buttflower in hairgiantessseashell bikinidisguised as humanmoray eelappearing from watercrow's nestlily padobjectanimal licking someonespiraling eyestalking crabwashing oneselfbroken teethfiery redheadwasher womanblowing a raspberryflattenedfrench chefold english sheepdogbecoming humandestroying a statuefish tailpolypundersea kingdom (See All)

Robin Hood (1973)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Robin Hood (1973)

An imaginative Disney version of the Robin Hood legend. Fun and romance abound as the swashbuckling hero of Sherwood Forest and his valiant sidekick plot one daring adventure after another to outwit the greedy prince and his partner as they put the tax squeeze on the poor.

Subgenre:
2d animationdisneyswashbuckler
Themes:
friendshipmoneytortureweddingherorobberytheftexecutiongreed
Mood:
rain
Locations:
englandforestchurchcastle
Characters:
villainpriestthiefwarrioraction herosheriffthief hero
Story:
friends who live togetherblockbustertalking animalrabbitcatdogcharacter name in titlekisstitle spoken by characterchasefireunderwearswordjailcombat β€¦good versus evilfoot chasesword fightaxedisguisefootballsnakedisarming someonevoice overmissionpigchickenbearsleepingcross dressingarsonprincewolfbow and arrowballoonelephantmouserebelfaked deathtournamentfalse identityanthropomorphismguardimaginationanthropomorphic animalhypnosislionmedieval timesoutlawdungeonturtlearrowowlstick fightanimal name in titlevillain played by lead actorsidekickswordsmanpeasantrobberfoxcorporal punishmentcrocodilearcherysquirreladventure herosleeptyrantroosterarcherbowmiddle agesblacksmithanachronismraccoonvillain arrestedgender disguisevultureburning buildingcarriagechildhood sweetheartjail breakaxe fightrhinocerospuppet showcollisionreference to walt disneyhippopotamusexecutionerfurrycastle thunderanimal protagonistbadgerbased on legendtaxorphan boyplay fightanthropomorphic mousebadmintonbased on folk talewolf whistlelong sword12th centurystorkwooden swordends with a weddingthumb suckingminstrelfriartax collectoraleanthropomorphic dogends with weddinganthropomorphic catluteanthropomorphic birdnarrow escapeanthropomorphic bearanthropomorphic rabbitstorybook in opening shotregentswordsmanshipanimal villainspiraling eyesanthropomorphic turtlesherwood forestanthropomorphic elephantanthropomorphic foxanthropomorphic pigprince john (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Children Of Men (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Children Of Men (2006)

The world's youngest citizen has just died at 18, and humankind is facing the likelihood of its own extinction. Set in and around a dystopian London fractious with violence and warring nationalistic sects, Children of Men follows the unexpected discovery of a lone pregnant woman and the desperate jo β€¦urney to deliver her to safety and restore faith for a future beyond those presently on Earth. (Read More)

Subgenre:
allegorycult filmdystopiachrist allegoryfuture noir
Themes:
lovedeathmurderkidnappingmoneybetrayalpregnancydrinkingtorturedrunkennessescaperacismlonelinessterrorismdepression β€¦drug useredemptiongriefcelebritysexualityfaithsurveillanceexecutionalcoholismhopedyingapocalypsedisabilityself sacrificemurder of a police officer (See All)
Mood:
rainneo noirambiguous ending
Locations:
englandfarmboatforestbartrainmotorcycleairplanebuslondon englandwoodswheelchairurban settingpolice cartunnel β€¦car on fire (See All)
Characters:
husband wife relationshipfather son relationshippolicemother son relationshiptattoosingersoldierpolicemanbabysingle motherterrorcousin cousin relationshipex husband ex wife relationshipself referentialmother love
Period:
2020s
Story:
fablekilling an animaljourneyambushcatbased on novelviolencedogbloodfemale nuditygunkisscigarette smokingphotographexplosion β€¦singingchasecryingshootoutbeatingcorpseshot to deathunderwearblood splatterfoodmachine gunshot in the chestface slapshot in the headwatching tvcomputerdrinkbattleshootingpaintingbeertearsbombbirthdaydead bodymarijuanacollegesciencereportersurvivalnewspaperwinebandterroristmassacredeath of friendwomanbridgeeatingprisonerimmigrantman with glassesanti herochild in perilparklimousineprotestpoisonmissiondeath of childtanklong takepursuitgovernmentchildbirthdeath of sonreunionratblindfoldsevered armrefugeepubcowufocorrupt copexperimenteavesdroppingtv newspot smokingballoonwoundmass murdereggcagelistening to musicpropagandasurvivorvirusagingbarnislamvandalismdemonstrationexploding buildingrebelflatulencerebellionbirthvirginitycompassionfatecrushed to deathsocial commentarypassportwhiskeydwarfbombingshoeshippiechaosmiraclerowboatblood on shirtfascismhandheld camerapollutiondeceittitle at the enddeerpolandborderlens flaretragic herovoodooillegal immigrantmiscarriagemelancholyseattle washingtonpillcoffee shopblood on camera lensgiving birthface maskmolotov cocktailcremationshot in the neckspit in the facedead animalepidemicalarmrepressiongun held to headhangoveridealismfascisturban decayanarchyreluctant heroinfertilitymacguffinkindnesscrushed headbiologyshot in the handnewborn babybleeding to deathjetcar set on fireshot in the throatbettinggeneticsfart jokeex lovercheckpointhopelessnessuprisinghusband murders wifeexpectant motherprotectionsnoringguard dogtotalitarianismchantingstrawberryrefugee campprotestormessiahlambmoral ambiguityoverheard conversationmidwifeannouncerdouble decker bussafe houseshaky cammotorcycle crashpandemicwoman in laborchancephotojournalistbraided hairsanctuaryborder guardfertilityinfluenzaprotectorinternment camppregnant woman nudecivil servantanti depressantcanarydestruction of propertyswing setsaviorfootbridgesterilitytinnitusyin and yangafrican anglorebel leaderwhat ifdairy farmburying a dead bodysquattingumbilical cordair guitarbuoydog racecatatonic statebritish governmentabandoned schoolorange the fruithit by a doorgenetic experimentazoresmilitary regimeprocreationdevastated landscapesoaking feetpushing a vehiclesearch dogsweatshirtflip flops the shoesriot shieldgamma rayyear 2027anglo african (See All)

Homefront (2013) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Homefront (2013)

Phil Broker is a former DEA agent who has gone through a crisis after his actions against a biker gang went horribly wrong and it cost the life of his bosses son. He is recently widowed and is left with a 9 year old daughter, Maddy. He decides to quit the turbulent and demanding life of thrill for M β€¦addy's sake and retires to a small town. His daughter fights off a boy who is bullying her at school, and this sets in motion a round of events that end in his direct confrontation with the local Meth drug lord. His past history with the biker gang also enters the arena, making matters more complex. But he has a mission in his mind to protect his daughter and he is ready to pay any cost that it demands. (Read More)

Subgenre:
martial arts
Themes:
deathmurderrevengekidnappingdrugsprisontortureescapedeceptionbrutalitydysfunctional familyredemptionbullyinghome invasionmurder of a police officer
Mood:
goreneo noircar chase
Locations:
boatforestbartrainschoolhelicoptermotorcyclesmall townwoodsstrip clubgas stationschool teachertownfire truckwater torture β€¦sex in a garagesex on car (See All)
Characters:
husband wife relationshippolicemother son relationshipfather daughter relationshiptattooboybrother sister relationshiphostagelawyertough guywarrioraction herobullyhitmansniper β€¦sheriffdaughtersniper riflesingle fatherparent child relationshipsuicide by coprevenge motive (See All)
Story:
death threatraidlifethreatshot in the legambushcatslow motion scenebased on novelfightdogviolencebloodone word titleflashback β€¦cigarette smokingexplosionknifechasesurprise endingpistolfirecell phoneshootoutbeatingshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshot in the headshotgunrescuepunched in the facearrestgunfightbrawlshowdownheld at gunpointhand to hand combatbirthdaycar crashinterrogationrevolvershot in the backf wordfoot chasegangstrangulationaxedisguiseambulancedrug dealerbridgeimpalementwidowstabbed to deathmixed martial artsdinerprisonerstabbed in the chesttied to a chairexploding caranti heroone man armychild in perilbirthday partypolice officer killedshot in the foreheadone against manydrug addictcharacter repeating someone else's dialoguebeaten to deathwidowerpay phonemissionundercoverknocked outkicked in the facedeath of sonhorse ridingdie hard scenariosingle parentak 47machismohead buttassassination attemptdrugshot in the stomachscene during opening creditsagentexploding buildingnosebleedswat teampsychologistculture clashbroken legbikerdrug dealinggas maskredneckrear entry sexstealing a carbloody noseconfrontationhit in the crotchsonnew orleans louisianapunched in the stomachjunkiefeudswampbooby traptitle at the endundercover agentundercover copgasolinepolice raidlens flaredrug lordflat tiresouthern accenthit with a baseball batintimidationmarijuana jointblood on camera lensstabbed in the handex copstuffed animallouisianabully comeuppancetween girlelementary schoolflaskwhite trashstablealligatorprison visitcar set on firemotorcycle gangspeedboatmugshotpitchfork10 year oldhandymanhappy birthday to youbiker ganggang leaderabandoned warehousenight vision gogglesmodern westernmethamphetaminerunning for your lifebayoukicked in the chestdrug bustexploding motorcyclekidnapped girldeadea agentkidnapped childhuman shieldtwo against oneflipping carstolen police carmeth labcrystal methprovocationbuilding explosiondrawbridgetattoo on armsosdrug mulewidowed fatherairboatholding someone's head underwaterboat yardslashed tirestealing a police cardrug labdrug raidschool playgroundstabbed with a pitchforkone percenterhit teamerlenmeyer flaskgirl hits a boysteakhouseoverkillangry parentmonkey barsrebar (See All)

The Huntsman: Winter's War (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Huntsman: Winter's War (2016)

Subgenre:
martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale
Themes:
surrealismdeathlovemurderrevengekidnappingmarriagebetrayalfearescapemonsterherodeceptionmagicanger β€¦obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All)
Locations:
forestchurchsnowvillagewoodscastlecampfire
Characters:
soldierbabyhostagesister sister relationshipthieftough guywarrioraction herolittle girllittle boy
Story:
visionanimal attackquestdirectorial debutbirdambushriverslow motion scenevoice over narrationbloodfightviolencecharacter name in titlesequelflashback β€¦bare chested malekissexplosionknifechasesurprise endingbeatingcorpsefistfighthorsemirrorshot in the chestface slapshot in the headrescuepunched in the facebattleswordbrawlshowdownhand to hand combatsecond parthallucinationcombatsubjective cameragood versus evilorphancandlesword fightaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herodisarming someoneone man armychild in perilfictional wardouble crosskingcreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifewaterfallflowerprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechessiceeavesdroppingtraitorgoldwolffireplacebow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondtarget practicebraverycrossbowfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomblack magicburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Tomorrow, When The War Began (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tomorrow, When The War Began (2010)

Seven Australian teenage friends from a small town go on a camping trip to be with nature. During their trip, they see military aircraft fly overhead. What they didn't know was their country was being invaded by another country. Returning home, they discover that they are at war. With no training, t β€¦hey band together to fight the enemy. (Read More)

Subgenre:
b movieaustralian science fictionaustralian horror
Themes:
friendshipdeathmurderescapemilitarydeath of fathercampingnear death experienceunlikely heroghost town
Locations:
farmforestrestaurantchurchhelicoptermotorcyclesmall townaustraliapolice stationcampfirecar truck chase
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipsoldierchristiansniperfarm girl
Story:
bullet woundhomeshot in the legambushslow motion scenevoice over narrationbased on novelfightdogbloodviolencebare chested malecigarette smokingexplosionchase β€¦pistolcell phoneshootoutcorpseshot to deathblood splattermachine gunhorsecar accidentshot in the chestshot in the headrescuevomitingrifleheld at gunpointsunglassescar crashpianocombatshot in the backsurvivalflashlightmontagebridgearmysnakeexploding carno opening creditsanti heroradiofictional warsearchshot in the foreheadattempted murderbinocularsperson on fireattackfirst of seriestentknocked outtough girltankhigh school studentsplit screenlaptopratfirst partmercenarywaterfallcowak 47chainsawmissileropehand grenadehelmettold in flashbackbarnwalkie talkiehidingpart of trilogyrocket launchertorchinterracial friendshipcrushed to deathbroken legmechanicdentisttarget practicechild's point of viewinvasionresistancecigarette lighterconcentration campbulletproof vestgasolinejuvenile delinquenttext messagingshot through a windowmarijuana jointfemale soldierbarbed wirefemale fighterstonercornfieldhit by a truckfighter jetexploding truckwoman in bra and pantiesreluctant heroman in swimsuitcamcorderopen endedexploding housedeath of familygarbage truckcarouselcamera phoneradio newsloss of familyimprovised weaponresistance fighterfairteenage herofairgroundguerilla warfareloggingexploding planepacifistshot in the sidefirst of trilogybridge collapseno cellphone signalsearch and rescuedune buggyair battleclosing credits sequencetanker truckexploding bridgemuscle shirtknocked out with gun buttgas lampsignal flarewire cutters (See All)

The Witch (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witch (2015)

New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a β€¦ family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)

Subgenre:
independent filmsuspenseconspiracyamerican horrorbritish horrorfolk horror
Themes:
deathmurderkidnappingreligionghostfearmagicdeath of fathersupernatural powerdeath of motherredemptionguiltinsanityillnessevil β€¦dyingdevilmadnesswildernessfather love (See All)
Mood:
goreraindarkness
Locations:
englandfarmforestchurchvillagewoodsrural settingcampfirenew englandbackwoods
Characters:
villainbrother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrensingerboybrother sister relationshipteenage girlbabysister sister relationship β€¦christianreference to godlittle girllittle boybiblewitchterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All)
Period:
winter17th century1600s
Story:
animal attacklifedirectorial debutrabbitdogviolencebloodfemale nuditynuditymale nudityfemale frontal nuditymale rear nuditybare chested malekisssinging β€¦knifecryingsongblood splatterfoodhorseundressingsecretlierifledemonhallucinationreference to jesus christprayersubjective cameracandlestrangulationaxestabbingwomaneatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessiondeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickensleepingtwinwolfmass murdergothiceggwitchcraftcrying womancrying manburialgoatapplepromisetensionhypocrisysonhungerbutchershovelpridemurder of a childslaughterlanterndead boydemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismslashingwhisperingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All)

Thor: Ragnarok (2017) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thor: Ragnarok (2017)

Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.

Subgenre:
martial artssuperheroabsurdismepicslapstick comedydark fantasyscience fantasylive action and animation
Themes:
surrealismdeathmurderrevengekidnappingbetrayalfeardrunkennessescapemonsterdeceptionbrutalitysupernatural powerredemptioncelebrity β€¦sadismalcoholismpanicapocalypsedisabilitycouragerevolutionself sacrificespace travelprison escapenorse mythology (See All)
Locations:
forestnew york citybarchurchelevatorvillagewoodsouter space
Characters:
villainbrother brother relationshipfather son relationshiptattoobrother sister relationshipzombiesoldieralienhostagetough guywarrioraction heroalcoholiccousin cousin relationshipfather β€¦alien monster (See All)
Story:
death threatvisionhomeblockbusterthreatambushriverslow motion scenetwo word titlefightviolencecharacter name in titlesequelflashbackbare chested male β€¦title spoken by characterexplosionknifechasesurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescuepunched in the facebattleswordgunfightbrawlfalling from heightbookbased on comicshowdownheld at gunpointbeerhand to hand combatdemonfightingcombatdecapitationgood versus evilsurvivalfoot chasesword fightbased on comic bookname in titleaxemassacremountainbasketballbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestweapontied to a chairsevered headdisarming someoneone man armyfictional wardouble crossspaceshipunderwater scenecreaturefemme fatalethird parttransformationtalking to the cameraon the runduelattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facetough girllightningopening action sceneskeletonbraceletscene during end creditsmanipulationspeechexploding bodybrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadbattlefieldprincestylized violencestrong female characterhenchmanapplausedestinywolfdestructionbow and arrowflyingracehead buttspearelectronic music scoresociopathhelmetbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplaneteccentriccamprebeljumping from heightclubskullrebellionknightlaseraction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footageshieldcameohaunted by the pastbootsbraveryfight to the deathdual wieldimpostorsonmercilessnesschaosresurrectionevacuationprophecyescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault rifleknife fightwisecrack humorhologrambounty huntereye gougingcapturearmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemfinal battlecrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwoman murders a manwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Revenant (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Revenant (2015)

While exploring g uncharted wilderness in 1823, legendary fronjitiersman Hugh Glass sustains injuries from a brutal bear attack. When his hunting team leaves him for dead, Glass must utilize his survival skills to find a way back home while avoiding natives on their own hunt. Grief-stricken and fuel β€¦ed by vengeance, Glass treks through the wintry terrain to track down John Fitzgerald, the former confidant who betrayed and abandoned him. (Read More)

Subgenre:
martial artssuspenserevisionist western
Themes:
friendshipdeathmurderrevengekidnappingrapemoneybetrayalfeardrunkennessescapedeceptionnaturebrutalityparanoia β€¦guiltdeath of wifepanicvengeancecouragehuntingwildernessnear death experienceregretmurder of sonmother nature (See All)
Mood:
gorerainbreaking the fourth wall
Locations:
boatforestbarsnowwoodscampfireusa
Characters:
father son relationshiphostagetough guywarrioraction heronative americaninterracial relationshipsniperfrenchself mutilationdeath of a friendhunting party
Period:
winter19th century1820s
Story:
suffocationanimal attackhomekilling an animalshot in the legbirdambushriverbased on noveltwo word titleviolencefightbloodnudityflashback β€¦male frontal nuditymale rear nuditybare chested malepartyknifechasesurprise endingpistolbased on true storyfirebased on bookshootoutcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescuebattleswordgunfightbrawlshowdownlierifleheld at gunpointhand to hand combatsex standing uphallucinationcombatshot in the backsubjective camerasurvivalfoot chasestrangulationaxemassacrestabbingthroat slittingstabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequenceanti herodisarming someoneone man armydouble crossunderwater scenesearchlooking at the camerashot in the foreheadracial sluron the runone against manydangerstabbed in the backspiritualitywidowercharacter's point of view camera shotlightningopening action scenehangingshot in the shoulderlong takepursuitdeath of sonpigneck breakingwaterfallshot in the armbearsubtitled scenearsonbattlefieldcaptainwolfbow and arrowspearwoundheavy raininjuryloss of friendstabbed in the stomachmale bondinghunterbeardloss of wifecovered in bloodrape victimgenocidetorchrapistinterracial friendshipbroken legpresumed deadhaunted by the pasttensionlandscapesevered fingerbraveryblood on facefight to the deathloss of sonmanhuntstabbed in the headstabbed in the legsafedark herobathingdisembowelmentknife fighthealingrainstormdeertribelonercastrationdark pastlens flaresexual assaulttragic herosevered legethnic slursymbolismmoral dilemmasouthern accenthorseback ridingman cryingblood on camera lensfinal showdownstabbed in the handburied aliveshot in the neckpistol whipamerican indiantexanarms dealervery little dialogueintolerancegun held to headshot with an arrowyoung version of characterarcherystabbed in the armshot in the eyetavernstretchermercy killingblizzardswimming underwaterfinger cut offshot in the handhanged manshot in the throatshot in the footarcherinterracial couplefur coatmusketrighteous ragesorrowtragic pastdead wifeavalanchefrenchmandigging a gravearmy basedeterminationbilingualismforthatchetmissing daughterflintlock riflebuffalohorse chasefurflintlock pistolsnowstormthroat rippingcanteenfalling off a cliffbritish actor playing american charactertradecreekguerilla warfarecold weatherleft for deadtrackerblood on handscrawlinggunpowdershooting starscalpingtomahawkminimal dialoguebroken backgrizzly bearhit with a rifle buttbear attackelkdead horsemountain manseeing dead peopleteenage sondrinking waterclosurewolf packmaulingstomachanimal bitealtruismbisonkilling a horsenude man murderedraw meatsnowy landscapestarting a firehorse jumpingnative american attackgangrenetrapperbear cubrapidsinjured legcoitus interruptusanimal skullvisceralhands upnursing back to healthregaining consciousnesseating raw meatman versus naturewidowed fatherleft to diemale star appears nudeanimal carcasscrow indianinterracial rapemanifest destinysneak attackblackfoot indianwillpoweranimal companionhelping othersback scarcauterizing a woundguttingcopingpillagingtremblingreflection on lifefur trapperman carrying a mansweat lodgetraumatic pastsafe robberystolen horsebearskinbuilding a shelterinjured handsleeping in the nudecomanche tribeeating raw fishfrontiersmanlacerationloosely based on a true storypawnee indian (See All)

Aguirre, The Wrath Of God (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Aguirre, The Wrath Of God (1972)

A few decades after the destruction of the Inca empire, a Spanish expedition leaves the mountains of Peru and goes down the Amazon river in search of gold and wealth. Soon, they come across great difficulties and Don Aguirres, a ruthless man who cares only about riches, becomes their leader. But wil β€¦l his quest lead them to "the golden city", or to certain destruction? (Read More)

Subgenre:
cult filmconspiracytragedyepic
Themes:
deathsurrealismmurderchristmasobsessionpovertyinsanityillnessexecutionmadnessdeath of daughterstarvation
Mood:
rainsavage
Locations:
villagecityjunglespain
Characters:
villainhusband wife relationshipfather daughter relationshipchristianreference to godnative americanbiblecatholic
Period:
16th century1500s
Story:
raftvisionquestjourneyriverviolencefemale nuditycharacter name in titletitle spoken by characterexplosionbased on true storyfirefoodhorseshooting β€¦rifledead bodyhallucinationreference to jesus christprayerdecapitationmountainarmysevered headtrialsearchlegendskeletonhangingthird worldpigtrapmonkeypowergolddestructionbow and arrowmedicinespearmachetecagefamehelmetslaverymousevisitmonkslavecannonspanishcannibalhungerlostswampbutterflybananaarmorchainarrowmudexplorationbeheadingillusionexpeditioncanoefluteblack manhikingtreasonstreet marketcorporal punishmentmegalomaniacamazonconventemperorheld captivepipemale protagonistfeverexplorersouth americaempireperurevoltmassfloggingmountain climbingblasphemydeath by hangingdeserterblond manmutinyunhappy endingtalking headculture shockinkmarchingcolonizationconquestnew german cinematravellinggold rushamazon riverandes mountainsrodentbasquemegalomaniallamadynastyheadhunterwhirlpoolenslavementlost cityamazon rainforesttropical settingconquistadorfloatsedan chairsentenceperuvianmachu picchufever dreamconquerorwrath of godwilderness survivalcannon firedeserted villageel doradopoisoned arrowlast survivorspanish armychristianizationclemencyyaqui indian1560sartistic creationdeath of emperorinvisible enemy (See All)

Home Alone 2: Lost In New York (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Home Alone 2: Lost In New York (1992)

Kevin McCallister is back. But this time he's in New York City with enough cash and credit cards to turn the Big Apple into his very own playground. But Kevin won't be alone for long. The notorious Wet Bandits, Harry and Marv, still smarting from their last encounter with Kevin, are bound for New Yo β€¦rk too, plotting a huge holiday heist! Kevin's ready to welcome them with more battery of booby traps the bumbling bandits will never forget! (Read More)

Subgenre:
cult filmslapstick comedy
Themes:
surrealismfriendshiprevengechristmasfearescapememoryrobberyhome invasionhomelessnessmissing child
Mood:
rainnightbreaking the fourth wall
Locations:
hospitalnew york cityswimming poolhotelairplanetaxiairportelevatorurban settingpolice stationpolice carcityrooftoptaxi driver
Characters:
brother brother relationshipfamily relationshipshusband wife relationshippolicemother son relationshipboybrother sister relationshippolice officerlittle boymaidboy hero
Period:
1990swinter
Story:
bird attackvisionhomeblockbustertreebirdplace name in titleslow motion scenenumber in titlesequelgunphotographchaseshowertelephone call β€¦firedigit in titlerescuearrestfalling from heightsecond partnumbered sequelmanhattan new york citytelevisioncriminaltelephonesubjective cameranew yorkconcertcolon in titlefishapologyparklimousinehotel roomperson on fireelectrocutionpay phoneproduct placementvacationchristmas treescreamskeletoncity name in titlegiftpigtrapfireworkspizzaholidayropehuggingflyingtape recorderlifting someone into the airtoyfloridaladderorchestraremote controlburglarseven word titleburglarychild protagonistpower outagemiami floridachristmas evebooby trapatticbody landing on a carroomsequel to cult favoriteworld trade center manhattan new york citypigeonuncleabandoned buildingcartoon on tvcentral park manhattan new york citysecond in seriessenior citizenbrooklyn bridgevacuum cleanercoca colacredit cardreference to donald trumpunsubtitled foreign languagemale protagonistchewing gumtimes square manhattan new york cityjumping into waterroof10 year oldstaffdoveprecocious childrevolving doorice rinkphysical comedydeja vuchristmas giftchristmas movienail gunwish fulfillmentwoman punches a mannumber 2 in titlehotel managerhome alonehomeless womanlost childtoy storechild heromother son reuniontwin towersroom serviceluxury hotelchristmas decorationlifting a male into the airchildren's choirjumping into a swimming poolmovie reality crossovercredit card fraudhead in a toiletcarnegie hall manhattan new york citymemory lapsekid outsmarts adultblurry visioncartoon reality crossovergreen slimehit with a brickmischievous childrockefeller center manhattan new york cityreference to donald duckmale antagonisttownhousebrick thrown through a windowhitting one's headplaza hotel manhattan new york cityvoice recorderwoman punches manchristmas with familycriminal duohotel guestwoman slaps man in the facehit on the head with a bricki cross my heart and hope to dieschool concertskeleton visible during electrocutionfalling brickforgetting namehotel bellmanscreaming boy (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Lone Survivor (2013) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lone Survivor (2013)

Marcus Luttrell, a Navy Seal, and his team set out on a mission to capture or kill notorious Taliban leader Ahmad Shah, in late June 2005. After running into mountain herders and capturing them, they were left with no choice but to follow their rules of engagement or be imprisoned. Now Marcus and hi β€¦s team are left to fight for their lives in one of the most valiant efforts of modern warfare. (Read More)

Themes:
friendshipdeathmurderrevengedeceptionmilitaryterrorismcourageself sacrificenear death experience
Mood:
gore
Locations:
foresthelicopterairplanewatervillagewoods
Characters:
soldierhostagetough guywarriorsniperamerican abroadself mutilation
Period:
2000syear 2005
Story:
bullet woundfarmershot in the legambushriverslow motion scenevoice over narrationtwo word titleviolencefightbloodmale nudityflashbackbare chested maledancing β€¦photographexplosionknifechasesurprise endingpistolbased on true storybased on bookcell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headrescuecamerawritten by directorbattlegunfightbrawlfalling from heightheld at gunpointsunglassesinterrogationcombatshot in the backf wordsubjective cameradecapitationsurvivalfoot chaseterroristmassacremountaindeath of friendarmystabbed to deathstabbed in the chestmapsnakenonlinear timelineexploding carchild in perilunderwater sceneshot in the foreheadracial slurattempted murderargumentbinocularscharacter repeating someone else's dialoguecharacter's point of view camera shotmissionknocked outshot in the shoulderlong takescaramerican flagshot in the armsilencersubtitled scenebattlefieldak 47hand grenadegrenadewoundmachetefriendship between menshot in the stomachscene during opening creditsmale bondingbeardsergeanthonorrocket launchergoatbroken legcannoncamera shot of feetsevered fingerblood on facegash in the faceshot in the faceafghanistanescape attemptspecial forcesassault riflecommandolens flarelieutenantexploding helicoptermoral dilemmagatling gunshot multiple timesgrenade launcherdesert eagleall male castnarrated by characterdirector cameonight visioncommandercommando unitflarehelicopter crashcommando missionu.s. navyshot in the throatshot in the foottextingnight vision gogglesrookietalibantrail of bloodwar on terrorismdog tagcovert operationcamaraderiegas grenademusculardefibrillationdefibrillatorlimpingoutnumberedair force basenavy sea air and land forcenavy sealfalling down a hilluh 60 blackhawk helicopterfirefightcardiac arrestguerrilla warfarech 47 chinook helicopterfoot racerocket propelled grenadeanchormanc 130 herculesah 64 apache helicopterrolling down a hillshrapnelmission briefingscenic beautysatellite phoneends with dedicationbottle of watermedivacreference to rick james (See All)

The Seventh Seal (1957)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Seventh Seal (1957)

A Knight and his squire are home from the crusades. Black Death is sweeping their country. As they approach home, Death appears to the knight and tells him it is his time. The knight challenges Death to a chess game for his life. The Knight and Death play as the cultural turmoil envelopes the people β€¦ around them as they try, in different ways, to deal with the upheaval the plague has caused. (Read More)

Subgenre:
allegoryblack comedyperiod piece
Themes:
surrealismdeathmarriagereligionadulteryfaithcrueltyapocalypsefear of deathreligious faith
Locations:
forestbeachchurchvillagerural settingcatholic church
Characters:
soldieractorartistchristianreference to godchristianitywitchcatholicself flagellation
Story:
visionhomelifecountrysidejourneyvoice over narrationnumber in titletitle spoken by characterknifethree word titlebased on playcorpsemaskdead bodydemon β€¦reference to jesus christprayerprisonerdinnerbraceletscargifthorse ridingcharacter says i love youchesscrucifixknightforbidden lovepreachermoralityreverse footagedespairbible quotesuperstitionmedieval timesswedenexistentialismmeetingsymbolismdoubtconfessionalplaguesquirreltavernsunrisebeliefsawcaravanmiddle agesblacksmitheastern europereference to the virgin marygrim reaperknife held to throattitle spoken by narratorjugglingdiscovering a dead bodyhusband wife reunionjugglertitle based on the bibleprocessionplaying chesshuman skullwitch huntburned at the stakesledge hammerfake suicidecrisis of faith14th centuryagnosticcrusadercovered wagoncrusadenumber 7 in titlepenance1300sskull masktheatrical troupetree cuttingwall paintingflagellationchessboardcutting down a treeblack deathchess gamesuspended by armssquiredancing on a tablepestwitch burningpillorycorporeal mortificationdeath personifiedpersonification of death10 years laterchess matchdeath incarnatecheckmatesuspected witchbegging for helptrading insultsblack plaguesense of lifeholy visionminstrel showprison wagon (See All)

Broken Arrow (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Broken Arrow (1996)

"Broken Arrow" is the term used to describe a nuclear device that has been lost. In this movie, two nuclear missiles are stolen by rogue US pilot Deakins, but hot on his trail is his co-pilot Hale and a Park Ranger, Terry. The action takes place in Utah's canyon country; a high stakes game of cat an β€¦d mouse. (Read More)

Subgenre:
martial artsblack comedyconspiracy
Themes:
lovedeathmurderbetrayalherodeceptionmilitarybrutalityterrorismblackmail
Mood:
car chasepoetic justice
Locations:
boattrainhelicopterdesertcavecampfireairplane accidentcanyonhumveetrain explosion
Characters:
soldierbetrayal by friend
Period:
1990s
Story:
blockbusterundergroundshot in the legambushrivercatslow motion sceneviolencefightbloodbare chested maleguncigarette smokingtitle spoken by characterexplosion β€¦chasepistolfireshootoutcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshotgunpunched in the facegunfightbrawlfalling from heightrifleheld at gunpointhand to hand combatrevolvercombatf wordterroristimpalementmixed martial artsboxingweaponmapexploding cardisarming someonehit by a carscreaminglocker roomperson on fireopening action sceneshot in the shoulderexploding bodydie hard scenariomercenaryshot in the armmachismocaptainhand grenadekicked in the stomachhonormexican standoffcolonelgun fugun battledivingbraverykickinggash in the facepunched in the stomachdark humorfalling to deathwisecrack humortitle at the endmineterrorist plotexploding helicoptergatling gunbullet timeheroismvillain played by lead actorfire extinguishertimebombspiral staircasearms dealerstandoffmajorplane crashbullet balletflarehelicopter crashfighter jetfallingfighter pilotgun duelcarnageutahnuclear bombshot in the throatcountdownboxing ringbloodshedbrotherhoodhit with a hammernuclear explosionu.s. air forcenuclear weaponsthrown from a carnuclear threatpunchinggun katafax machinejumping from a cargun sauexploding planeabandoned minereference to muhammad alipark rangersparringtrain crashnavy sea air and land forcedollar billairforceelectro magnetic pulsefalling off a bridgemusic score features pianolast man standingd box motion codejumping from a helicopterblowing smoke in someone's facebulletproof glassthrown from a trainexploding trainejector seatgoof in titlehit with a crowbardriving a car without a doorstealth bomberhowie screamtriggerrun over by a trainreference to george foremanreference to the rumble in the junglecrushed throat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Braveheart (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Braveheart (1995)

William Wallace is a Scottish rebel who leads an uprising against the cruel English ruler Edward the Longshanks, who wishes to inherit the crown of Scotland for himself. When he was a young boy, William Wallace's father and brother, along with many others, lost their lives trying to free Scotland. O β€¦nce he loses another of his loved ones, William Wallace begins his long quest to make Scotland free once and for all, along with the assistance of Robert the Bruce. (Read More)

Subgenre:
epicchrist allegory
Themes:
lovefriendshipdeathmurderrevengerapebetrayalpoliticsadulteryprisonpregnancytortureweddingfuneralexecution β€¦death of wifefreedomcouragedeath of daughter (See All)
Mood:
gorenightmarewedding night
Locations:
englandforestlondon englandcastle
Characters:
father son relationshiptough guywarriorhomosexualitycatholicfrenchchildhood friend
Story:
siegeblockbusterquestfarmerambushvoice over narrationfightbloodviolencefemale nuditymale nudityone word titlefemale frontal nuditymale frontal nuditybare chested male β€¦sex scenebased on true storyfiredreamcorpseblood splatterhorsebattleswordfalling from heighthand to hand combatprayermale pubic haircombatdecapitationsword fightmassacredisguisethroat slittingimpalementsevered headno opening creditscontroversyprincessmarriage proposallegendprologuehangingspeechdirected by startragic eventloss of fatherkissing while having sexdismembermentsubtitled scenebattlefieldburned alivespearassassination attemptbarnloss of wifeirishhonorburialdead womanbraveryarranged marriagescotlandenglishthrown through a windowmedieval timesdisembowelmentgay sonrainstorminsultgay stereotypetragic heroloss of brotherwedding receptionunclemain character dieshorseback ridingunderdogwar violencedead childrenloss of daughterarcheryidealismmooningcrushed headsword and sandalfamous scoremartyrbrotherhoodrevoltmiddle agesnationalismbagpipescavalryscottish accentchildhood sweetheartscotbattle axetortured to deathflaming arrownobilityhandkerchieftyrannykilthanged boybattering ramedinburgh scotlandpublic executiondeer huntinglanceleprosydefenestrationsecret marriagesword and shield14th centuryscottish highlandsaxe in the chesthanged child1300sknighthoodprince of wales13th centurysword throwingmass hangingjoustdrawn and quarteredbow huntingplantagenethorse killedfamous speechhalberdwar crythistlewoman's throat slitcautery (See All)

The Grapes Of Wrath (1940) is one of the best movies like Watership Down (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Grapes Of Wrath (1940)

Tom Joad returns to his home after a jail sentence to find his family kicked off their farm due to foreclosure. He catches up with them on his uncle's farm and joins them the next day as they head for California and a new life - Hopefully.

Themes:
deathmurderpregnancydancefuneralpovertyprejudicestarvation
Locations:
farmrural settingroad triptruckroad movie
Characters:
brother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother sister relationshipdancersister sister relationshipwaitressgrandfather grandson relationshipgrandmother grandson relationshippregnant woman β€¦grandmother granddaughter relationshippregnantgrandfather granddaughter relationshiptruck driverpregnant wife (See All)
Period:
1930s
Story:
homelifefarmerjourneybased on noveldancingshot in the chestjailcaliforniawomanfugitiveon the roadscarcabinex convict β€¦pickup truckcampburialpreachersocial commentaryinjusticejobsocialismtractorstrikeabandoned housefruitfarmhouseearringframeddeputygreat depressiondeath of grandmotherlabor uniondemolitionlaborcross countryroadtriptalking while drivingdeath of grandfatheroklahomaplant in titlesocialistdroughtexpectant motherexpectant fatherfruit in titlegun shotfamily abandonmenteulogytitle based on the biblerailroad crossingpulitzer prize sourcefarm workerprodigal soncross country triproute 66elderly peopleparoleenew dealeverymantransientfederal governmentditchamerican literaturecalifornia historyfruit pickerpregnant sistersocial consciencesharecropperdust bowlhome sweet homebearing witnesswagedeep focusabandoned farm (See All)

Assault On Precinct 13 (1976)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Assault On Precinct 13 (1976)

Police ambush and kill several gang members in Los Angeles. Gang members make a pact of blood to strike back at police, and conduct a siege on the police station which is almost abandoned and due to be closed. Staff of the closing precinct and the criminals being held there while in transit must wor β€¦k together to fight off the attacking gang members. (Read More)

Subgenre:
cult filmindependent filmblack comedysuspensetragedyb movie
Themes:
deathmurderrevengeprisonfearescapedeceptionbrutalitysadismpolice brutalitydeath of daughter
Mood:
goreneo noircar chasenightone night
Locations:
los angeles californiabusurban settingpolice stationpolice carsewerbus driverinner cityprison fightprison bus
Characters:
policefather daughter relationshippolice officertough guywarriorsecretarypolice shootoutsniper rifleself mutilationdeath of girl
Period:
1970s
Story:
bullet woundsiegetreeambushviolencefightbloodnumber in titlecigarette smokingexplosionknifechasepistolfireshootout β€¦beatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestremakeshot in the headshotgunrescuepunched in the facegunfightbrawlrifleheld at gunpointlow budget filmjailhandcuffsrevolvershot in the backgood versus evilsurvivalfoot chasegangmassacrewomanprisonerweaponanti heropolice officer killedattempted murderbinocularscharacter repeating someone else's dialoguebeaten to deathcover updeath of childtough girlopening action scenestreet shootoutpursuitstalkingbasementdie hard scenarioshot in the armsilencercult directorchild murderelectronic music scoreice creamjail cellphone boothgrindhousefemale warriorthugswitchbladeprison guardtensionexplosivemercilessnesspower outagemuteshot in the facepolice officer shotescape attemptghettoone dayconvictbulletproof vesttough copbody countgunfiresmokesouthern accentdead girlshot through a windowmolotov cocktailgun in mouthstreet gangpistol whipblackoutclimbing through a windowflarepolice captaincoughingdeath rowwhistlingbloody body of childshot point blankfemale copmusic boxrepeated linecellradio newsvending machineimprovised weapontommy gunshot through a doorblack copprison wardensocial decaywrenchchild killedrookie copice cream truckdamagebarricademusic score composed by directorremadehiding in a cartelephone operatorchild shottelescopic rifleprisoner transportpolice precinctclaustrophobicchild shot in the chestmauserchild shot through the chestmauser c96 pistolmauser pistolentering through window (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Watership Down?
<< FIND THEM HERE! >>