Please wait - finding best movies...
The family man Abe Dale is having lunch with his wife and son in a restaurant, when a man kills them in front of Abe and shoots himself in the mouth. A couple of days later, the grieving Abe misses his family and commits suicide ingesting many pills at home, but is rescued by his friend Marty Bloom β¦and saved by the doctors. His Near Death Experience makes him see white light in some people and to hear Electronic Voice Phenomena, i.e., manifestations of voices of ghosts or spirits through static on electronic devices. Soon he discovers that the white light means that the person is going to die, and Abe saves three lives including his nurse Sherry Clarke. While watching a video recorded by his son, Abe finds that the killer had saved the lives of his wife and son three days before the murder. He investigates the incident and finds that when you save, you must kill; otherwise many innocents will die three days later. (Read More)
Subgenre: | video |
Themes: | murder of sonnear death experiencedevilgriefsupernatural powermemoryghost |
Mood: | murder suicide |
Locations: | bicyclehospital |
Characters: | suicide by cophomeless manbiblereference to godbest friendnursehusband wife relationshipfather son relationship |
Story: | cardiopulmonary resuscitationnumber 666drug overdoseroad accidentbible quotebicycle messengersequel by name onlyshooting oneself in the heademergency medical technicianelectronic voice phenomenakilled by a policemandead doctorangry spiritfalling pianoreference to the beach boys β¦music recitalbacon and eggsheart monitordoomedreference to pink floydmagnoliawhite noiseshot by the policerevelationsengravingchildren's choirnumerologytanker truckelectrocardiogramauraseeing dead peoplerepeated dialogueresuscitationprecognitionnews broadcastmetronomesaviorreference to frankensteinreference to the book of revelationstatisticslistelectronicstoy soldierhotel lobby666startledlimbodefibrillationsunlightcprknife held to throathit by a trainluciferjugglingwedding anniversarybreaking a mirrorshopping cartsuicide noteloss of familyheadachedisfigured facemurder of wifefilm starts with textinsane asylumpremonitionoverdosereference to elvis presleysaving a lifeplaying pianomurder of a childdisfigurementdead childreference to satanbilliardsfalling to deathloss of sonattempted suicidemourningback from the deadparking garagefatehome movieloss of wifewristwatchhead buttsyringeheart attacknewspaper headlinefilm within a filmgiftpianistbaseball batproduct placementaccidentsuicide attemptdinerambulancecolor in titlecar crashfalling from heightslow motion sceneshot in the chestshot to deathsequel (See All) |
Dr. Joe Darrow is a recently widowed doctor. He is grieving due to the death of his pregnant wife in a Red Cross mission in Venezuela. Although being atheist, he began to believe that his dead wife wants to communicate with him, through her young patients in the Pediatrics of a Chicago hospital.
Subgenre: | black comedysuspensesupernaturaltragedymelodramaparanormal phenomena |
Themes: | near death experiencegriefsupernatural powerghostdeathlovefriendshippregnancydrinkingfearfuneralangerparanoiaguiltfaith β¦death of wifepanicdyingafterlife (See All) |
Mood: | raintearjerker |
Locations: | hospitalbarchurchairplanebusairportelevatorvillagewheelchairpolice stationpolice carchicago illinoisjungletunnelschool bus β¦catholic schoolbus accident (See All) |
Characters: | best friendnursehusband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipfrienddoctorchildrenboybrother sister relationshipgirlsoldier β¦policemanbabypriestlawyerlittle girllittle boysecurity guardcatholicemployer employee relationshipdeath of boy (See All) |
Period: | 2000s |
Story: | drug overdoseattempted suicideback from the deadparking garageloss of wifeproduct placementsuicide attemptambulanceslow motion scenesexone word titleflashbackbare chested maleguncigarette smoking β¦photographtitle spoken by characterchasesurprise endingtelephone callcell phonedreamcorpsemachine guncar accidentmirrorcameradrinkarrestriflebeerneighborhallucinationhandcuffsrevolverriverfoot chasecandlearmymapnunbirddrawingunderwater scenegraveyardnews reportdrowninglatex glovesgravepilotcharacter repeating someone else's dialoguewidowerpay phonerace against timedeath of childlightningcrosswaterfallfreeze frameanswering machinerevelationflyingheavy rainscene during opening creditscomapatientcrucifixdesperationthunderpower outageresurrectionevacuationinsectheavenassault rifleheartrainstormtribefemale doctorparrottranslatorapparitiondoubtphysicianinsomniafemale lawyerhearing voicesparamedicstethoscopetoastcolombiaemergency roomrainbowjumping into watersleeplessnessrescue from drowningsymboltietrespassingpackagebilingualismrainforestvenezuelabirthmarkred crossmistjumping off a cliffmessengercandelabraends with freeze framedefibrillatorschoolyardbirdcageriver rapidsmemorial servicedragonflyorgan donorwaking up from a comareference to christopher columbuscat scanorgan transplantwhite water raftinglandslidepoegelatinmudslidebrain deadintensive care unitmountain roadtribesmanaid workerair stripanesthesiologistnative nuditylaw professorrockslidejungle tribeflatlininghospital cafeteriabald spotgrief counseling (See All) |
Robert and Katherine Thorn seem to have it all. They are happily married and he is the US Ambassador to Great Britain, but they want nothing more than to have children. When Katharine has a stillborn child, Robert is approached by a priest at the hospital who suggests that they take a healthy newbor β¦n whose mother has just died in childbirth. Without telling his wife he agrees. After relocating to London, strange events - and the ominous warnings of a priest - lead him to believe that the child he took from that Italian hospital is evil incarnate. (Read More)
Subgenre: | paranormal phenomenasupernatural horrorchristian horror |
Themes: | devilgriefsupernatural powermurderdeathsuicidereligionfearfuneralinvestigationadoptiondeath of wifedeath in childbirththe devil |
Mood: | gore |
Locations: | hospitalchurchcemeterylondon englandkitchencavegas stationstormcatholic churchairplane trip |
Characters: | biblehusband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipchildrenboypolicemanphotographerbabypriestchristianitylittle boyamerican abroad β¦catholic priestsuicide by hanging (See All) |
Period: | 1970s |
Story: | bible quote666luciferdisfigured facereference to satanloss of wifenewspaper headlinefalling from heightslow motion scenebloodviolencedogtwo word titlegunphotograph β¦knifesurprise endingdemonreference to jesus christdecapitationgood versus evilorphanimpalementsevered headnuncoffinchild in perilbirthday partygraveyardgravestalkerfirst of seriespossessionlightningu.s. presidentskeletonhangingamerican flagfirst partchild murderoccultfireplacebulletgothicrome italylifting someone into the airvillainessblockbustermonkanimal attackreincarnationstabbed in the throatmillionairezoobroken glassdeath of protagonistbody landing on a cardemonic possessiondead woman with eyes opendaggerexorcismnewspaper clippingmiscarriagenannygothbeheadingmysticismmonasteryjerusalemambassadorunsubtitled foreign languagemoving infamous scoredarkroomdead wifealtardog attackdiplomatburn victimantichristcasketevil childexorcistbirthmarkdeath by hangingarmageddonbible prophecygovernesstricyclerottweilerchild murdererlifting male in airdevil worshipenglish accentomentrailer narrated by percy rodriguezdeath by impalementhorror movie remadearcheological digbaboonbook of revelationpushed down stairscharacter appears on front page of a newspaperfacial disfigurementswitched at birth5 year oldends with funeralstillborn childphotograph in newspaperevil dogbaby switchjackalflatbed trucklightning rodends with a quotepaternosterreligious sacrificeamerican ambassadorphotography darkroompublic suicide (See All) |
Clear Rivers has been living life in a mental hospital after the bizarre events that lead to the deaths of her friends. One day, she is approached by a girl named Kimberly who believes she had a premonition similar to her friend Alex who died. Clear has to either risk her life helping others, or sta β¦y inside the hospital the rest of her life waiting for her death to come. What will she do? (Read More)
Themes: | deathdrugspregnancyfearbrutalitydrug usesadismhomelessnessfear of deathcheating death |
Mood: | gore |
Locations: | hospitalsmall townelevatorpolice stationroad triplakefire escapecar in water |
Characters: | policepolice officersingle mother |
Story: | precognitiondefibrillationpremonitionattempted suicideloss of sonfateproduct placementsuicide attemptambulancecar crashsequelfemale nuditybloodviolencefemale frontal nudity β¦explosionsurprise endingfirecell phoneblood splattercar accidentrescuesecond partjailrevolverdecapitationcleavagenew yorkimpalementinternetexploding carsevered headscantily clad femaledrowninglatex glovespublic nuditydrug addictdeath of childexploding bodyglassesunderwatersevered armobscene finger gesturedismembermentanswering machinepot smokingheroinehypodermic needlespiderladderbirthcrushed to deathmental institutiondentistconstruction sitestabbed in the eyebarbecuecharacters killed one by onepigeontorso cut in halffire extinguisherreturning character killed offclosetcannabiscremationtelevision newsdrunk drivingfish tankexploding truckjointcoincidencepsychiatric hospitaltwo way mirrorcut into piecesgas explosiondeja vumicrowave ovenreference to oprah winfreyprosthetic limbbodily dismembermentfictional talk showgangsta gripfreak accidentkilled in an elevatorstate trooperdrug snortinglottery winnerdeath by impalementairbagpadded cellfatalismgarbage disposalauto accidentelectrical fireimpaled by pipelumber truck (See All) |
An out-of-the-way diner becomes the unlikely battleground for the survival of the human race. When God loses faith in humankind, he sends his legion of angels to bring on the Apocalypse. Humanity's only hope lies in a group of strangers trapped in a desert diner with the Archangel Michael (Bettany).
Themes: | supernatural powermurderdeathlovesuicidechristmaspregnancydeceptiondeath of fatherdeath of motherfaithhopeapocalypseself sacrificemurder of a police officer β¦unlikely heroreligious faith (See All) |
Mood: | darkness |
Locations: | small townlos angeles californiadesertpolice cargas station |
Characters: | reference to godhusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshiptattoobrother brother relationshipteenage girlhostagewarriorwaitressinterracial relationshipself mutilationshooting a police officerpregnant girlfriend |
Story: | bible quotesaviormurder of a childback from the deadfatedinercar crashfalling from heightslow motion sceneshot in the chestshot to deathbloodviolenceone word titleflashback β¦bare chested malefightcigarette smokingexplosionknifesurprise endingpistolfirevoice over narrationcell phoneshootoutmachine guncar accidentshot in the headshotgunswordvomitingrifleheld at gunpointbeercriminalshot in the backf wordgood versus evilsurvivalflashlightdeath of friendimpalementstabbed in the chesttied to a chairexploding carno opening creditsradiochild in perilhit by a carold womanshot in the foreheadmini skirtpossessionangeldeath of childchristmas treechildbirthexploding bodydeath of husbandtrapthreatened with a knifecoupleburned alivelooking at oneself in a mirrorcookcrucifixexploding buildingsevered handcrying manend of the worldmechanicpump action shotgunveteransevered fingerfight to the deathgash in the facedeath threatm 16prophecyheavenjumping through a windowbody landing on a carsiegetrailerdaggergrenade launcheratheistman cryingshot through a windowbazookanarrated by characterbag over headpolice officer shot in the chestjukeboxstandoffacidgun held to headdisposing of a dead bodyhanging upside downbitten in the neckfinger cut offteethcar set on fireopen endedpolice officer shot in the headtear on cheekzippo lighterfratricidewingsbudweisermacemercyextinctionjumping from a rooftopice cream truckpower failurebattle axehand cut offwoman shot in the foreheadconvoychild killerextreme closeupmother daughter conflictmobile homedisobeying ordershelium balloonparadoxthrown through a windshieldsteakwalkerhit with a frying panfallen angelinsubordinationinstructionwoman with a gunno cellphone signalswing setpolice officer shot through the hearthook for handdouble impalementexploding gasoline stationclimbing up a wallhumanity in perilbroken down carblisterice cream manraw meatquitting smokingarchangelbiting someonelocustangel wingsarchangel michaeldog tagshanging from the ceilingbegins with a quoteemergency broadcast systemsurvivalismbloody hand printexterminationpatrol carpolice officer shot in the foreheadshell casinghouseflyhuman racepregnant woman smokingboilsharpened teethangel gabrielartificial handblack and white televisionpossessed boystitching own woundcan of beerswarm of insects (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | independent filmcult filmsuspensesupernaturaltragedyparanormalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror |
Themes: | supernatural powermurderdeathlovesurrealismsuiciderapechristmasfearinvestigationdeceptionpsychopathdeath of motherparanoiablackmail β¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All) |
Mood: | neo noirslasher |
Locations: | hospitalschoolchurchsnowwheelchairpolice cartrucktunnelschool teacherfire truck |
Characters: | nursehusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officerserial killerphotographerbabylittle boyvillainpsychiatrist β¦snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All) |
Period: | world war two1980s1970swinterseeing the future |
Story: | headachepremonitiondead childloss of wifeheart attacknewspaper headlineproduct placementaccidentambulancecar crashfalling from heightslow motion sceneshot in the chestshot to deathfemale nudity β¦based on novelbloodflashbackkissphotographtitle spoken by characterexplosionchasesurprise endingpistolfireshootoutdreamcorpseblood splattercar accidentrescuewatching tvbattlegunfightletterrifleheld at gunpointhandcuffsrevolvertelephonef wordreportergood versus evilflashlightmansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phonedeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychiccorrupt copbattlefieldchild murderhenchmanmaniaccold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomamutilationexploding buildingpress conferencesevered handgrindhouseambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herorainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerbad guyteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant herohead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverhouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
When the Vatican observatory priest sees the appearance of a comet, the Church is sure that it confirms the eve of the Armageddon. Meanwhile, the USA President's godson Robert Thorn is informed in the maternity in Rome by Father Spiletto that his wife Katherine has just lost her baby and she had tro β¦ubles with her uterus and would not have another pregnancy. Spiletto suggests Robert that another just born child that lost his mother could be the substituted for his son, and Robert accepts the child and gives the name of Damien. Robert is promoted to ambassador in London after a tragic accident. When Damien's nanny commits suicide in his birthday party, a substitute, Mrs. Baylock, comes to work and live with the family. Along the years, Katherine realizes that Damien is evil, while Robert is contacted by Father Brennan, who tells him that Damien is the son of devil. When the priest dies in a bizarre accident, the photographer Keith Jennings shows evidences to Robert that the boy is the Antichrist. They travel to the town of Megiddo to learn how the boy can be stopped. (Read More)
Subgenre: | paranormal phenomenachristian horror |
Themes: | devilmurderdeathsuicidereligionfearfuneralparanoiacancerevilapocalypsewritingthe devil |
Mood: | gorerainnightmarehorror movie remake |
Locations: | hospitalnew york citychurchcemeterybathtublondon englandrooftop |
Characters: | nursehusband wife relationshipfather son relationshipfamily relationshipsmother son relationshipchildrenboysoldierphotographerpriestpsychiatristterroramerican abroadcatholic priestsuicide by hanging |
Period: | 2010s |
Story: | bible quote666disfigured facemurder of a childdisfigurementreference to satanloss of sonfateloss of wifesyringenewspaper headlineaccidentfalling from heightslow motion sceneshot to death β¦blooddogtwo word titlecigarette smokingphotographexplosionknifesurprise endingpistolfirecell phonecorpseblood splatterremakesecretdemonmanhattan new york cityreporterdecapitationorphancandleimpalementexploding carsevered headnunchild in perilhit by a carbirthday partygraveyardattempted murderlimousinegraveperson on firepoisonpossessionchristmas treelightningu.s. presidentscreamskeletonhangingmanipulationamerican flagtragic eventcrossloss of mothermonkeybirthday cakefireplacekilling an animalballoonheavy rainrome italylifting someone into the aircrucifixloss of loved onetherapistswat teamjumping from heightmonkanimal attackfull moonfloodplaygroundgash in the facezooprophecyscissorsthunderstormfoghandheld camerae mailswingbody landing on a cardemonic possessiondead woman with eyes openlasersightworld trade center manhattan new york citydaggernannytombpopemonasteryfemale psychopathgorillascootersatanismtraffic jamburnt facecatholicismshoeambassadorloss of childbreaking a windowwarningnoosekicked in the headmoving inkiller childdarkroomtabloidmagnifying glasstsunamicheckpointmerry go roundpentagramsledgehammerdog attackburn victimbouquetcometantichristhide and seekhurricane katrinastrawberryred winecutting hairevil childchurch belltantrumbirthmarkarmageddonconcussionskepticismbig ben londoncardinal the priestexhumationmob of reporterstricycledead babyshaky camwoman kills womanobservatoryhelium balloondevil worshipfreak accidentomenbiblical quotehanged by the neckpleadingremake of cult filmnun's habitu.s. embassyvatican citydriftinganimal biteblowing bubblesdisbelieving adultmilitary funeralmilitary dress uniformreference to the new testamentlightning strikenikon camerablowing out a candlered balloontelephoto lensevil dogisraeli flagmanhole covergasoline truck21 gun salutejackalmark of the devilmonster in mirrorrazor scooterremake of british filmupside down crossmotorcycle escortpunch and judy (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int β¦ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
Subgenre: | supernaturaltragedymedicalparanormalteen movieteen horrorpsychological thrillerpsychological horror |
Themes: | near death experiencesupernatural powerdeathfriendshiprevengesurrealismfeardrunkennessescapeobsessionparanoiaredemptionguiltbullyingpanic β¦childhoodafterliferegret (See All) |
Mood: | nightmarehorror movie remake |
Locations: | hospitalbarswimming poolsnowmotorcyclebathtubbusnightclubwaterelevatorapartmentrooftopyacht |
Characters: | nursemother daughter relationshipafrican americandoctorsecurity guardprofessorcrying baby |
Period: | 2000s2010s |
Story: | seeing dead peopledefibrillationfalling to deathback from the deadparking garagewristwatchsyringecar crashfalling from heightslow motion sceneone word titleflashbackbare chested malekissinterracial sex β¦knifesurprise endingshowercell phonedreamcorpsecar accidentremakerescuesunglassespianohallucinationreference to jesus christsubjective cameraswimmingflashlightdeath of friendmontagebridgeapologyunderwater scenevoice overflash forwardlibrarydangerprologuefantasy sequencecharacter's point of view camera shotrace against timecover updeath of childinjectiontragic eventbasementlaptoppremarital sextwenty somethingelectronic music scorehypodermic needleloss of friendmorguecaucasianaccidental deathhaunted by the pastpower outageresurrectiondeath of sisteraerial shotalternate realitydark pastlightmoral dilemmabullet timetext messagingmale objectificationstabbed in the handscene before opening creditsold flamebroken mirrordomineering motherhearing voicesmedical studentraveloss of sisterexperiment gone wronghigh techtragic pastcamera phonetaking off clothesmedical doctorpsychotronic filmbulldozercar rolloverhedonismscience runs amokwhite coatjellyfishflickering lightmedical experimentbritish actor playing american characterrubik's cubepagerwalking stickhouseboatscientific experimentguilty consciencedefibrillatorout of body experienceyear 2017inside the mindvirtualitybrain scancompetitivenessparanormal phenomenonreference to jesusside effectcyberbullyingremake of cult favoritemedical sciencemedical scannercar falling off a bridge (See All) |
Subgenre: | suspensemelodramadystopia |
Themes: | infidelityreligionadulteryfearextramarital affairparanoiaunfaithfulnessfaithpanicapocalypse |
Locations: | hospitalnew york citychurchmotorcycleairplaneairportschool busairplane accidentairplane explosion |
Characters: | biblehusband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshippolice officerchristianchristianity |
Story: | bible quotetanker truckwristwatchbaseball batproduct placementsuicide attemptambulancecar crashslow motion scenebased on noveldogexplosionpistolshowerfire β¦cell phonecar accidentremakeshotguncameraheld at gunpointrunningbirthdayjournalistbridgenews reportnecklacepilotdrug addictsuburbcollege studentdisappearanceriotpickup truckdisasteranswering machineend of the worldpreacherstealing a carconstruction sitechaosprophecycigarette lighteraviationbookstorelipstickone daywedding ringalzheimer's diseasegasolinesouthern accentwalletabandoned housestewardessdepartment storeflight attendantpassengershrinerapturelootingjewelry storeenglishwomanbible prophecyconspiracy theoristlong island new yorkbreakdancingpurse snatchercockpitobese manemergency landinginvestigative journalistrapture aftermathcar crashing through a windowairplane passengerno cell phone signaljewelry theftmid air collisionconcert ticketfilm ends with text (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensedark fantasychristian horrorreligious horror |
Themes: | near death experiencedevilsupernatural powermurderdeathsurrealismkidnappingreligionbetrayaljealousyfearescapefuneralinvestigationdeception β¦psychopathbrutalityparanoiadepressioninsanitysadismevilhopepanicdyingapocalypsecannibalismhomelessnessmurder of a police officerghost townreligious conflict (See All) |
Mood: | neo noirarchive footagedarkness |
Locations: | hospitalschoolchurchcemeterysmall townlos angeles californiadesertapartmentpolice stationpolice carrooftopcatholic churchschool busschool teacher |
Characters: | homeless manbiblenursepoliceteacherzombiegirlsoldierpolice officerdetectivepolicemanpriesthostagechristianlittle girl β¦native americanwaitresschristianitypolice detectiveteacher student relationshipsheriffgrandmother granddaughter relationshipcatholic priestcoronerdeath wish (See All) |
Period: | 1990s |
Story: | bible quoteluciferreference to satanback from the deadnewspaper headlinesuicide attemptdinerambulancefalling from heightshot in the chestshot to deathbloodviolenceflashbackgun β¦kissfightcigarette smokingphotographtitle spoken by characterexplosionknifesurprise endingfirevoice over narrationcryingbeatingcorpseblood splatterfistfightcar accidentshot in the headrescuepunched in the facewritten by directorbrawlshowdownheld at gunpointsunglassesdead bodydemonhallucinationhandcuffsprayerrevolvershot in the backgood versus evilsurvivalorphanflashlightcaliforniaimpalementdisarming someonecoffinnarrationchild in perilhit by a carfictional wardouble crossritualpolice officer killedgraveyardshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerperson on fireliarfirst of seriesmissionpossessionangelrace against timestatuecover upevil manknocked outskeletonmanipulationexploding bodyfirst partprofanitygrandmotherkillingundeadhenchmanpizzamaniacpickup truckburned aliveelectronic music scoregothicshot in the stomachsociopathscene during opening creditsmorgueskullmind controlcolonelcrime scenevisioncynicismcannibalmercilessnessresurrectionprophecyheavenhit on the headpunched in the chestjumping through a windowthrown through a windowautopsyaerial shotarizonachoirsoulhealingeye gougingtribebody landing on a cardemonic possessionkilling spreeburned to deathexorcismnewspaper clippinglyingarrogancetelepathyclose up of eyesgothporn magazineliving deadlevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyshamanburnt bodybadgemaggotsymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingchantingtauntingchild with a gungrand canyoncourt martialinvulnerabilitysatanhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithpyrokinesiskorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintpersonification of satandark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All) |
On December 28th, 1999, the citizens of New York City are getting ready for the turn of the millennium. However, the Devil decides to crash the party by coming to the city, inhabiting a man's body, and searching for his chosen bride, a 20-year-old woman named Christine York. If he bears her child be β¦tween 11:00 PM and midnight on New Year's Eve, the world will end, and the only hope lies within an atheist ex-cop named Jericho Cane, who no longer believes in God because of the murder of his wife and daughter. (Read More)
Subgenre: | suspense |
Themes: | devilmurdertortureheroredemptionfaithhome invasionself sacrificemurder of a police officer |
Mood: | goreneo noirnightmare |
Locations: | hospitalnew york cityrestauranttrainchurchhelicoptercemeterybathtubrooftop |
Characters: | biblenursepolicepriesttough guyaction herochristianitypsychiatristcatholicdeath of hero |
Period: | 1990s1970syear 1999year 1979 |
Story: | number 666hit by a trainluciferreference to satanback from the deadloss of wifesuicide attemptfalling from heightshot to deathsexfemale nuditybloodviolencethreesomeflashback β¦kisstitle spoken by characterchasepistolfireshootoutbeatingblood splatterfistfighturinationshot in the headcatswordgunfightbrawlshowdownhand to hand combatdemonshot in the backgood versus evilambushthroat slittingimpalementsubwaysnakeexploding carnunone man armyshot in the foreheadattempted murderone against manyperson on firemissionpossessionchristmas treebodyguardchildbirthexploding bodysemiautomatic pistolsevered armshot in the armdismembermentchild murderoccultloss of friendexploding buildingnew year's eveend of the worldwoman in jeopardyvisiondeath of protagonistbulletproof vestbody landing on a carrefrigeratordemonic possessionsevered legburned to deathfemale detectivegrenade launchermain character diesatheistcrucifixionpopeex coploss of daughtertemptationglocksatanismscene of the crimesaving the worldsole black character dies clichedirector also cinematographergropinghobopool of bloodchosen onelifting person in airman with no namedeal with the devilchrysler building manhattan new york cityprotectionshoulder holsterdoomempire state building manhattan new york citysatanic ritualsevered tonguedevil worshipmorphingtrain crashmillenniumstigmatadead body in a bathtubhand through headhit squad (See All) |
Norma and Arthur Lewis, a suburban couple with a young child, receive a simple wooden box as a gift, which bears fatal and irrevocable consequences. A mysterious stranger delivers the message that the box promises to bestow upon its owner $1 million with the press of a button. However, pressing this β¦ button will simultaneously cause the death of another human being somewhere in the world, someone they don't know. With just 24 hours to have the box in their possession, Norma and Arthur find themselves in the cross-hairs of a startling moral dilemma and must face the true nature of their humanity. (Read More)
Subgenre: | suspensealien conspiracy |
Themes: | supernatural powermurderdeathsurrealismkidnappingchristmasmoneyweddinghumiliationsurveillancedeath of wifedisabilityblindnessphilosophyregret |
Mood: | rain |
Locations: | swimming poolsnowbathtubwaterpolice stationmotelschool busfire truck |
Characters: | husband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyteacherpolice officeraliendeafnessfather in law son in law relationship |
Period: | 1970s |
Story: | startleddisfigured facefilm starts with textdisfigurementback from the deadnewspaper headlinegiftambulancecar crashshot in the chestshot to deathviolencekisscigarette smokingdancing β¦photographtitle spoken by charactersurprise endingpistolcorpsemachine gunarrestletterheld at gunpointrevolverscientistmapno opening creditschild in periltheaterlimousinelibrarykeysuburblocker roombased on short storypay phonechampagnechristmas treelightningstalkingbasementcharacter says i love yousacrificeexperimentsupermarketrevelationbabysittersanta clausnosebleedpress conferencemind controlhomicideinvasiongash in the facespecial forcessafetuxedoboxbrushing teethgovernment agentwedding receptionnewspaper clippinglingerie slipmoral dilemmateleportationfirefightersouthern accentnasamoney problemsportaltemptationamputeebus stopstage playhit by a trucktestvirginiaschoolteacherprivate schoolconsciousnessmurder by gunshotlimptelevision sethuman experimentlocked in a roomburn victimhusband murders wifekicking in a doormars the planetfake accentemployeemysterious strangerenvelopedecisiondriver's licensebridesmaidhundred dollar billstruck by lightningsuitcase of moneyfilm reelcentral intelligence agencybriefcase of moneysocial experimentcorvettelicense plateadvanced technologyhuman natureshot in the heartdecemberconsequencealien life formlangley virginiamonopoly the board gametheatrical playclassified informationrichmond virginiajack danielspush buttonprosthetic body partreflection in car mirrorsnowplowphysical deformityrocket scientist24 hoursmillion dollarsreference to johnny carsontoenational security agencyresearch scientistwedding rehearsalshot through the chestgatewaymysterious packageresearch centerwind tunnelrehearsal dinner (See All) |
A biochemist and his dishy wife arrive in Berlin for a conference at which a scientist and his controversial Arab funder will announce breakthrough research. While his wife checks into the hotel, he grabs a cab to return to the airport for his briefcase, left at the curb. En route, an auto accident β¦puts him in a coma, from which he awakes four days later without identification and with gaps in his memory. He goes to the hotel: his wife refuses to recognize him and another man has claimed his identity. With help from a nurse, the cab driver, a retired Stasi agent, and an academic friend, he tries to unravel what's going on. Is the answer in the briefcase? (Read More)
Subgenre: | martial artsconspiracy |
Themes: | memorymurderdeathsuicidekidnappingmoneyescapedeceptioncorruptionterrorismsurveillancehome invasiontraumaamnesia |
Mood: | car chase |
Locations: | hospitalhotelcarnightclubtaxiairportgermanytaxi driverlaboratorysex in showersuvcar truck chaseairport barcar into waterescape from a car in water |
Characters: | nursedoctordetectivewaitresssecurity guardprofessorgermanamerican abroadex policemanmurder of friendsuicide by poison |
Story: | cardiopulmonary resuscitationresuscitationdefibrillationcprbreaking a mirrorparking garagewristwatchhead buttsyringeaccidentcar crashfalling from heightslow motion scenebased on novelviolence β¦one word titleflashbackbare chested malefightdancingphotographexplosionpartyknifesurprise endingshowercell phonebeatingfistfightcar accidentface slappunched in the facebookheld at gunpointbombriverscientistsubjective camerafoot chaseassassinterroristdeath of friendimmigrantsubwayexploding cardrivingassassinationdrawingchild in perilhit by a carunderwater scenenews reportcharacter repeating someone else's dialoguepay phonepoisoncharacter's point of view camera shotsuitcasecover upuniversityinjectionstalkingcrossexploding bodyautomobileneck breakingsecret agentsubtitled scenebralessprinceberlin germanyafricanidentityassassination attemptlooking at oneself in a mirrorscene during opening creditscomasecurity cameraexploding buildingkicked in the stomachfalse identitypassportsurveillance cameraimpostorstabbed in the neckpunched in the stomacheye gougingtuxedobriefcasedead woman with eyes openfemale in showerillegal immigrantprivate investigatorthanksgivingmale in showerlaptop computervideo surveillancetaseragriculturetimebombsubway stationloud sexclimbing through a windowlanguageyoung womanlanguage barriercoughingcrashing through a windowmercedes benzvolkswagennewscastoverturning carhitchcockianwoman slaps a manbilingualismsurveillance footagescientific researchdead woman on floorwoman's neck brokenluggageloss of memorypublic phonetime bombidentity theftpayphonestreetcarcrushed by a carpassenger trainmercedesfalse nametaxi ridesecret codeflash drivefake idfalse memorystolen identitytwo in a showerbomb explosionpublic telephonepack of moneyfake passportthrown through a wallfainting manfalse passportcyanidehotel receptionisthotel suitebomb threatglass shardoverturned cartenementsummitcar hit by a trainattacked from behindplastic explosivedriving in reversestabbed with glassprofessional assassincar falls into watermribaggagebiotechnologyspeaking germanpolitical refugeecomputer passwordposing as husband and wifesound of sexbosnianfemale taxi drivermagnetic resonance imagingairport terminallost luggageafrican immigrantdefusing bombnarrow escaperesearch scientistcombination lockhearing sex through a wallbaggage claimbomb victimformer agentwhistling kettlebaggage handlercar off a bridgeforehead cutman faintingdriving on the sidewalkpassport controldead nursetearing a page from a bookex agenthotel security guardvolkswagen carmercedes limousine (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo β¦od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
Subgenre: | ghost storyparanormal activity |
Themes: | near death experiencedevilsupernatural powerghostmurderdeathfriendshipsuicidereligionpregnancyweddinginvestigationpsychopathevilhome invasion β¦crueltytraumaself sacrificepolice investigation (See All) |
Mood: | nightdarknessmoving |
Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
Characters: | reference to godnursehusband wife relationshippoliceafrican americanfrienddoctorfemale protagonistdetectivepolicemanbabypriestchristianlittle girlkiller β¦christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
Period: | 1970syear 1969year 1970 |
Story: | film starts with textreference to satanfalling to deathgiftbaseball batsuicide attemptslow motion sceneshot in the chestshot to deathf ratedcharacter name in titlebloodviolenceone word titleflashback β¦fightphotographtitle spoken by characterknifechasebased on true storytelephone callfirecryingblood splatterpunched in the facewatching tvcamerashootingbookneighbordemonhallucinationreference to jesus christgood versus evilfoot chaseflashlightname in titlestabbingthroat slittingnonlinear timelinecultnunno opening creditsdrawingchild in perilritualnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollscreamscarbasementhaunted housesacrificegraffitiblood spattercouplerecord playeroccultspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisithometaking a pictureblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voiceslistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womanbechdel test passedsymboltraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int β¦ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
Subgenre: | cult filmblack comedysuspensetragedymedicalpsychological thrillerpsychological horror |
Themes: | near death experiencesupernatural powermemorydeathrevengesurrealismsuicidebetrayalfearescapedeath of fatherparanoiaredemptionguiltbullying β¦crueltypanicchildhoodtraumavengeancedrug addictionforgivenessafterliferegretchildhood traumasuicide of father (See All) |
Mood: | neo noirnightmare |
Locations: | hospitaltrainschoolforestsnowcemeterywoodsurban settingapartmenttruckchicago illinoismuseumlaboratory |
Characters: | nursefather daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorchildrenboygirlsoldierlittle girlbullywaitresslittle boyfiance fiancee relationshipsuicide by gunshot β¦self surgerystudent nurse (See All) |
Period: | 1990s |
Story: | defibrillationcprreference to elvis presleyfalling to deathattempted suicideback from the deadsyringebaseball batdinerfalling from heightslow motion scenesexbloodone word titlebare breasts β¦flashbackdogbare chested malekisscigarette smokinginterracial sexphotographtitle spoken by characterpartyknifechasesurprise endingpistoltelephone calltopless female nuditycryingbeatingcorpseshot in the headrescuepunched in the facewatching tvbedbathroomhallucinationsciencetelephonef wordsubjective camerahalloweenfoot chaseflashlightmountainvideo cameramansionmontageimpalementsubwayapologyman with glassesgraveyardcigar smokingmarriage proposaltreedrug addictbeaten to deathdangerscreamingpay phonecharacter's point of view camera shotrace against timestatuedeath of childcollege studentuniversityhalloween costumelong takemanipulationscaramerican flaginjectiontragic eventdeath of husbandloss of fatherpremarital sexcharacter says i love youheroinfreeze framesurgeryhugginganswering machinerevelationelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorcaketape recorderwoman with glassesgroup of friendsvideotapeaccidental deathphone boothwomanizercrushed to deathreverse footagehaunted by the pastvisionplaygroundpower outagegash in the facepunched in the stomachresurrectionconvenience storejunkietaking a picturekicked in the crotchblack and white scenepunched in the chestengagementautopsyaccidental killingaerial shotswingfemale doctorinsultlooking at self in mirrordead boyfieldloss of husbandsurgeonhalloween partymoral dilemmachildhood memorypromiscuityatheistfast motion scenehit with a baseball batclose up of eyesintestinesvietnam veteranalleyspit in the faceremorsename callingbully comeuppanceyoung version of characterclimbing through a windowbroken mirrorteasingscalpelgreenhousemedical studentbiologyfrankensteinexperiment gone wronghome videocamcorderoperationmenacehuman experimentheroin addicthoodieswingingbrain damageanimal killingscience runs amoktrenchcoatmedical professionmedical experimentrenovationanswering machine messageel trainfall to deathjumping roperepressed memorycadavermedical schoolred lightdefibrillatorvideotaped sexdying womanhit with a rockskeleton costumeremadepickaxefalling from a treescience experimentdissectionhockey stickout of body experienceneondumped by girlfriendsecret laboratorybelief in the afterlifehorror movie remadeadrenalinebullet holeconfettichildhood flashbacksplit lipswing setinside the mindvirtualitythrowing a rockmullet haircutescalationhopscotchtambourinegrade schoolnitrous oxidepathologybreaking up with boyfriendplaying godtrailer narrated by don lafontainepickup linesecret filmingwelcome home partyblue lightmedical examurban gothicbrain deadfighting with selfsweatshirtwounded dogred hoodpicture of jesusstitching one's own woundreligious imagery (See All) |
John Constantine is approached by Det. Angela Dodson who needs his help to prove that her twin sister Isabel's death was not a suicide. The dead woman was a devout Catholic and Angela refuses to accept she would have taken her own life. She's asked Constantine for help because he has a reputation fo β¦r dealing with the mystical. In fact, he is a demon hunter whose sole purpose on Earth is to send demons back to the nether regions. John himself has been to Hell and knows that he is destined to return there on his death - but hopes his good deeds may find him a place in Heaven. As he looks into Isabel's death, he realizes demons are trying to break through to the human world, and his battles lead him into a direct conflict with Satan. (Read More)
Subgenre: | cult filmsuspensesuperherosupernaturalchrist allegorychristian horror |
Themes: | near death experiencedevilsupernatural powermurderdeathsurrealismsuicidereligiondrunkennessinvestigationdeceptioncancerredemptionself sacrificeunlikely hero β¦the devilreligious faith (See All) |
Mood: | nightmaredarkness |
Locations: | hospitalbarswimming poolcarlos angeles californiabathtubbusnightclubwatertaxiapartmentmexicotaxi drivercatholic church |
Characters: | biblereference to godpolice officerdetectivepriestsister sister relationshiptough guywarriorchristianitypolice detectivecatholicself mutilation |
Period: | 2000s |
Story: | luciferfilm starts with textreference to satanback from the deadwristwatchdinerambulancefalling from heightslow motion sceneshot in the chestshot to deathbloodone word titleflashbackbare chested male β¦guncigarette smokingtitle spoken by characterknifechasesurprise endingpistolcorpsemirrorshotgunpunched in the facecatbookbased on comicshowdownheld at gunpointdead bodydemonhallucinationshot in the backgood versus evilflashlightbased on comic bookcaliforniaweaponanti heroone man armyhit by a carvandrowningconfessionsmokingcharacter repeating someone else's dialoguebeaten to deathelectrocutionpossessionangelstorytellingcrossexploding bodyautomobilebasementpolicewomanratdirectorial debuthandgunobscene finger gesturetwinbased on filmsacrificepsychicsubtitled scenestrong female characterterminal illnessprivate detectivesisteroccultgoldspearnipples visible through clothinggothiccomic booksurvivortied to a bedcrucifixmorgueclubstealing a carlandscapecrossbowfight to the deathpower outagebroken glasstitle appears in writingheavenscene after end creditsdark heroraised middle fingerdemonic possessionasylumdc comicsexorcismfemale detectiveprivate investigatorsurprise after end creditsdrugged drinkalleycartoon on tvstabbed in the handmysticismhead blown offsuit and tiedual rolebroken mirrorburnt facehearing voicesbowling alleywrist slittingburnt bodylighting a cigarettefemale police officerdumpsterblack catspitting bloodtwin sistercoughing bloodnight timepsychotronic filmbreaking through a doorelectric chairshot through a doorcut handelevator shaftholy waterzippo lightersurname as titlethrown from a carescaped mental patientbegins with textdecomposing bodycrushed by a carelectroshock therapylifted by the throatbrass knuckleshand through chesttwin sisterslung cancersevered faceboiler roomvoodoo dollwoman in a bathtubfallen angelactress playing male rolepsychiatric wardlucid dreammiddle fingernazi flagsplit lipindoor swimming poolhare krishnathrown through a wallmelting facehalf breedjumping off a roofsprinkler systemdrinking watersplit headglass shardreality vs fantasychain smokinghead held underwaterdemon huntergood deedasking for helpfire sprinklerlast ritesleg blown offstopped timeguessing gameblowing smoke in someone's faceholding one's breath underwatervertigo comicsdripping waterelectroconvulsive therapyangel wingsone actress for twin sisterscrushed carfemale police detectivelighting someone's cigarettedeserted townshock therapyfalling into a pooljumping into a pool with clothes onfalling through a glass roofjammed guninsect attackfalling glassfloating in the airinsect swarmmotor carwhistling kettlemortal sinoccult detectivewalking on the ceilingcough medicinereflection in a rearview mirrorspear of destinyarchangel gabrielface blown offin bathtub with clothes onreligious womandropping deadfalling into poolheaven vs hellmelting womansetting off a sprinkler systemfriend killedid braceletwinged demon (See All) |
59 year old Ove is the block's grumpy man who several years earlier was deposed as president of the condominium association, but he could not give a damn about being deposed and therefore keeps looking over the neighborhood with an iron fist. When pregnant Parvaneh and her family moves into the terr β¦aced house opposite and accidentally backs into Ove's mailbox it turns out to be an unexpected friendship. A drama comedy about unexpected friendship, love and the importance of surrounding yourself with the proper tools. (Read More)
Subgenre: | dark comedy |
Themes: | griefmemorydeathfriendshipmoneybetrayalpregnancydrinkingweddingfuneralinvestigationtravelangertheftdeath of father β¦death of mothercancerpoetrydeath of wifedeath of unborn child (See All) |
Mood: | rain |
Locations: | bicyclehospitalrestauranttrainchurchswimming poolhotelsnowcemeterybuskitchenwheelchairtrain stationspainsinging in a car β¦fire truckbus accidentsinging on a bus (See All) |
Characters: | reference to godnursehusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfrienddoctorboyteenage girlteenage boyteachergirl β¦policemandancerphotographerbabysister sister relationshiplittle girlteacher student relationshipfrenchpregnant womanpregnantengineerneighbor neighbor relationshipsuicide by hangingsuicide by gunshotself pitysuicide by asphyxiation (See All) |
Period: | year 2014 |
Story: | hit by a trainsaving a lifeattempted suicidefateloss of wifewristwatchheart attacksuicide attemptambulanceslow motion scenecharacter name in titlebased on novelbloodflashbackdog β¦bare chested malekissdancingphotographchasetelephone callfirevoice over narrationcryingfoodmirrorrescuecatcameradrinkletterbooklieriflerunningcafeneighborreference to jesus christcompetitiontelephonef wordnewspaperorphanjournalistwinecandleold manhousenonlinear timelineapologycoffinvoice overold womanmarriage proposalcoffeegunshotflash forwardgraveprologueclowncoming outwidowervacationflowershangingpresidentpursuitcrossthreatloss of fatherloss of mothersleepinggarageeyeglassesapplauseropelooking at oneself in a mirrorslow motionlistening to musicscene during opening creditsjoggingtoyloss of loved onehammerladderblack humorbreakfastchokingmale underwearretirementpromiseredneckseriesbackpackhungershovellaughterfrustrationswedenvoice over letterbalconysnowingcanebroken armbriefspajamascoinholding handsbarking dogloss of jobhit in the facehead woundwalletname callinglooking out a windowbitternessyoung version of characterhospital bedman in underwearsuicidaltrain tracksunsubtitled foreign languagereading a booknoosewheelchair boundwhite briefscar radiocar breakdownoverhead camera shotdead wifeeastern europenon linearhouse on firebride and groomnewspaper reporterhookburning buildingmotor scootertoy cardriver's licensebloody facewater hoserearview mirrorwashing dishestrain conductordriving lessonbouquet of flowersburning houseoxygen maskreference to mickey mousevolvowoman in a wheelchairhospital visitbuilding on fireparking ticketheavy breathinghonking a car hornsuicide thoughtsauto repairseat beltfeeding someonetrain compartmentred shoeselderly manmeet cutepast and presentleg in a castspoken inner thoughtselderly protagonistfalling off a ladderbus crashcar horncigarette buttdog urinationcradlegrumpy old mantrain yardreport cardbotched suicidedeath from cancersaabreference to christmasstepping on someone's footsuicidal thoughtvisiting wife's graveforced retirementreciting a poemreference to homerloss of homecat foodfalling to the floorrescue from firetwo daughtersfire rescuefalling onto train tracksrescued from a firebus falling off a cliffeating in a carburned out housedefecation slurgrumpy neighborparalyzed manreference to iranalmost hit by a trainlooking into a windowwomen's clothing (See All) |
A once handsome playboy, Cesar finds himself in a mental facility and he can't remember why. All he can remember is meeting the love of his life for one day, and then getting into a car accident which left his face horribly disfigured. But the pain of becoming physically undesirable may help him to β¦find the truth. (Read More)
Subgenre: | cyberpunk |
Themes: | memorymurderdeathlovefriendshipsurrealismsuicidejealousyprisondrinkingdrunkennessmonsterangerdeath of fatherdeath of mother β¦paranoiaabusewealthamnesia (See All) |
Mood: | nightmare |
Locations: | churchnightclubrooftop |
Characters: | reference to godbest friendfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationshipdoctorchildrenpolicemandancerlawyerlove triangleactresssecurity guard β¦psychiatristsecretaryhispanicself pity (See All) |
Story: | drug overdosedisfigured faceinsane asylumdisfigurementsyringeaccidentcar crashfemale nuditynuditybloodfemale frontal nudityinterviewflashbackgunsex scene β¦kissdancingnipplesphotographthree word titleshowervoice over narrationbeatingdreamcar accidentwatching tvcomputercatdrinkkissingmaskshootingvomitingrunningbirthdaysubjective cameratoiletdream sequencedrawingflash forwardparkcharacter's point of view camera shotactinghandgunsurgerycomapsychologistvirtual realitywomanizerremote controlpillssufferingresurrectionmental hospitalimmortalitymakeupinfectionprison cellsurgeonpajamasswearingsymbolismatheistcontractsuffocationcartoon on tvimperative in titleplastic surgerymen's bathroommetaphorcoca colaaccidental shootingvanitytv interviewmimeanorexiaarm wrestlingfrenchmandreamingtalking while drivingfamous lineeyessurgical operationsubconsciousreference to walt disneyreligion versus sciencedeus ex machinalynchiantranquilizerdream worldvertigosmotheringcaterercautionary talesense of sightcryonicsvanishingdream sequence within a dream sequencepsychiatricreference to jules verneprosthesismental problemracket ballatheism versus christianityreference to the phantom of the operafrench giallolife extensionspanish giallocryogenic technologyrhinoplasty (See All) |
The car of successful author Anna Rivers is found disabled next to the river, the thought being that she accidentally fell into the river while trying to change a flat tire. Her dead body is found upstream several weeks later, consistent with the accidental death theory. Based on incidents around hi β¦m, her grieving husband, architect Jonathan Rivers, decides several months later to visit with Raymond Price, who approached John prior to Anna's body being found with news that she was trying to contact him from beyond. At that time, John was skeptical of Raymond's claims of electronic voice phenomena (EVP): that he is contacted from the beyond through electronic means - radio, television - which he is able to record. Along with Sarah Tate, another of Raymond's "clients" whose fiance passed away, John becomes obsessed with EVP as he gets more and more audio and video messages, however fuzzy, from Anna from beyond. That obsession takes a slight change in focus when John believes that Anna is trying to pass along information to help others. But the nature of those messages and their connection to Raymond in combination with John learning that not all good comes through EVP leads to the possible belief that he dabbling in EVP in and of itself may be dangerous and the cause of those potentially deadly issues in which he is supposed to assist in helping. John has to decide whether or not to continue with his work in EVP, not continuing which means that he may actually prevent bad thingβ¦ (Read More)
Subgenre: | videosuspensesupernaturalparanormal phenomenasupernatural horror |
Themes: | griefsupernatural powerghostdeathpregnancytorturefuneralangerobsessionabductiondeath of wifepolice investigation |
Locations: | hospitalchurchswimming poolcemeterywheelchairpolice car |
Characters: | husband wife relationshipfather son relationshipmother son relationshipdoctorboypolice officerbabywriterpriestpolice detectiveex husband ex wife relationshipdeath of hero |
Period: | seeing the future |
Story: | electronic voice phenomenawhite noiseloss of wifesuicide attemptcolor in titlefalling from heightslow motion sceneshot to deathphotographcell phonecorpsecar accidentwatching tvcomputertears β¦rivertelevisionreporterflashlightbound and gaggedcoffinnews reportgunshotgraveauthorhotel roommicrophonesuburbwidowermoaningdisappearancepsychicoccultanswering machinespiritdesirelifting someone into the airarchitectvideotapelosstimepromiseremote controlheadphonesnovelistpierbruisebeing followedabandoned buildingapparitionblackoutpregnancy teststepmothernewspaper articlebusiness cardmediumaudio cassettehome videoinspectorlifting person in airvideo cassettevolkswagen beetlevoicebedriddenhusband wife reunionwirewaterfronttape over mouthlistening to the radiotv monitorbook publishingable to hear the deadcommunicating with the deadlogbookelectric cablenear miss (See All) |
Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t β¦rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)
Subgenre: | independent filmblack comedyconspiracysupernaturalparanormal phenomena |
Themes: | near death experiencesupernatural powermemoryghostmurderdeathrevengesurrealismkidnappingfearescapeheroinvestigationdeceptionterrorism β¦paranoiaredemptionsurveillancehome invasionpanicpolice brutalityafterlifeunlikely hero (See All) |
Mood: | neo noirnightmaredarknesspoetic justice |
Locations: | hospitalrestaurantchurchswimming poolsmall townbathtubdesertwheelchairapartmentpolice carmotelsinging in a carcar bombdesert town |
Characters: | nursehusband wife relationshippolicemother daughter relationshipboyfriend girlfriend relationshipdoctortattooprostitutepolice officerpolicemanhostagetough guywarriorsingle motherwaitress β¦security guardsheriffpolice shootoutdeath of girlfriend (See All) |
Period: | seeing the future |
Story: | seeing dead peoplestartledpremonitionfatebaseball batproduct placementdinercar crashslow motion sceneshot in the chestshot to deathcharacter name in titlebased on novelbloodviolence β¦flashbackdogtwo word titlekissfightcigarette smokingphotographtitle spoken by characterexplosionpartyknifechasesurprise endingpistolfirevoice over narrationcell phoneshootoutbeatingdreamcorpseblood splatterfistfightmachine gunhorsecar accidentshot in the headrescuepunched in the facecomputerwritten by directorarrestgunfightbrawlsecretshowdownheld at gunpointbombdemonhandcuffsrevolvershot in the backgood versus evilfoot chasebound and gaggedcaliforniaterroristmassacremontageexploding carfalse accusationsevered headcultno opening creditsbirddisarming someoneone man armychild in perilhit by a cardouble crosscreaturepolice officer killedvanattempted murderlimousinecursedangerscreamingperson on fireuniformrace against timecover upknocked outopening action sceneshot in the shouldermanipulationexploding bodymanagercharacter says i love yousevered armshot in the armlas vegas nevadasilencerpsychiccorrupt copfreeze framesingle parenttwenty somethingprivate detectiveeavesdroppingburned aliverevelationeggslow motionsociopathice creamcooksecurity cameraloss of loved onespiderskullcarnivalanimal attackpicnicmasked mancrime scenedamsel in distressstealing a carvisionexplosivesevered fingershot in the faceshopping mallm 16police officer shotescape attemptframe uptime lapse photographybutterflyassault riflewisecrack humorblood on shirtbulletproof vestrefrigeratorbarbecuedemonic possessionterrorist plotfortune tellerkilling spreedeath of loved oneburned to deathowlnewspaper clippingframed for murdershot multiple timesprivate investigatorbullet timehit with a baseball batshot through a windownarrated by characterinvisibilitymysterious manterrorist grouppickpockettimebombfountainold dark housecockroachevil spiritpolice chiefportaldisposing of a dead bodyyoung version of charactermalltrailer homescootercheering crowdhearing voiceselvis presleyflybody in a trunkhit by a truckdeputybowling alleyman kills a womanoffscreen killingpool partyshot point blankbullet woundmeteorbomberpart computer animationtragic lovehiding under a bedexploding housewoman in a bikinitragic endingcarouselanimal killingvillain not really dead clichelocketinnocent person killedclairvoyantgas explosionpoltergeistwater fountainpancaketoothmusic storetime bombice cream conefingerdecomposing bodyrunning for your liferescue attemptchild killerloss of girlfriendjumping from a carcamel toerottweilersatanic culttiredevil worshipgas chamberblowing a kissclairvoyanceable to see the deadbirdcagechased by a dogdomestic terrorismfictional townmilkshakesatanicwalking on waterdead body in a bathtubice cream parlorstorm drainpushed into a swimming poolexploding trailerhouse explosioncoitus interruptuscontemporary settingbarbecue grillsevered toesweethearthomemade explosiveseeing ghostscamera shot of a woman's legshotwiringshort order cookabandoned prisonice packwoman wearing a little black dressbody in a car trunkbreak door incar truck crashbluetoothdevil worshiperfalling into swimming poolvehicular accidentchurch towerdriver shotdriving licensevan explosionreloading a gunfortune telling machinehorse rideshot in facetruck car collisionabandoned restaurantsupernatural ability (See All) |
Subgenre: | cult filmsuspense |
Themes: | devilmurderdeathrapepregnancyfearescapedeceptionevilmurder of family |
Mood: | goreslow burn |
Locations: | hospitalcemeterykitchen knifeblood in carrunning water |
Characters: | nursehusband wife relationshipfemale protagonistterrorpregnanttalking to oneself in a mirrorself inflicted gunshot woundself cutting |
Period: | 1980syear 1982 |
Story: | startledfilm starts with textmurder of a childbilliardsattempted suicideproduct placementsuicide attemptbloodflashbackbare chested malecigarette smokingdancingphotographknifechase β¦surprise endingpantiespistolcorpseblood splatterblondeshot in the headwatching tvsecretdead bodycollegepianodemoncleavagefoot chasebound and gaggeddeath of friendthroat slittingstabbed to deathhousefishwhite pantiesscantily clad femaleritualroommatevangraveyardstabbed in the backprologuepay phoneknocked outcollege studentshot in the shoulderwigdeath of sonbasementpremarital sexhaunted housepizzagirl in pantiesocculteavesdroppinghypodermic needlebabysitterpatientstabbed in the stomachwitchcraftcovered in bloodpower outagepool tableshot in the faceanxietyheadphoneseye gougingcanetrophywilhelm screamlyingceremonyhairshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestoneritetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in feardrinking bloodrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultsatanic ritualstained glass windowstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All) |
An Easter story. Frank is a Manhattan medic, working graveyard in a two-man ambulance team. He's burned out, exhausted, seeing ghosts, especially a young woman he failed to save six months' before, and no longer able to save people: he brings in the dead. We follow him for three nights, each with a β¦different partner: Larry, who thinks about dinner, Marcus, who looks to Jesus, and Tom, who wallops people when work is slow. Frank befriends the daughter of a heart victim he brings in; she's Mary, an ex-junkie, angry at her father but now hoping he'll live. Frank tries to get fired, tries to quit, and keeps coming back, to work and to Mary, in need of his own rebirth. (Read More)
Subgenre: | black comedymedicalfish out of water |
Themes: | ghostdeathdrugspregnancydrunkenness |
Locations: | hospitalnew york city |
Characters: | prostitutealcoholiccatholic |
Period: | 1990s |
Story: | drug overdosecprattempted suicidebaseball batambulancecar crashfalling from heightshot in the chestbased on novelbloodviolencedogpistolvoice over narrationbeating β¦dreamblood splattercar accidentface slaprescueshootingprostitutionhallucinationmanhattan new york citydrug dealerimpalementshot in the foreheadkicked in the facechildbirthloss of fatherheroincomatied to a beddrug abusecovered in bloodbroken legcynicismtime lapse photographyblood on shirtfast motion scenegothdirector cameohead woundeuthanasiafish tankinsomniaparamedicecstasymercy killingwrist slittingbloody body of childsevered footemergencydead babyempire state building manhattan new york citybroken windshieldcardiac arrestfictional drugguilt complex (See All) |
Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen β¦ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)
Subgenre: | videoindependent filmsuspensetragedypsychological thrillerfamily tragedy |
Themes: | griefmemorylovefriendshipmarriageinfidelitybetrayaladulterypregnancyfearescapeinvestigationdeceptionextramarital affairanger β¦divorcebrutalityparanoiaguiltunfaithfulnessillnessmental illnesspanictraumaamnesiaforgiveness (See All) |
Mood: | neo noirnightmare |
Locations: | hospitalschoolhotelairplanelondon englandairportelevatorkitchenpolice carenglandfire truck |
Characters: | best friendhusband wife relationshipfather son relationshipmother son relationshipfrienddoctorboyteenage boyfemale protagonistteacherbabylittle boypsychiatristex husband ex wife relationshippregnant woman β¦self discoverydoctor patient relationship (See All) |
Period: | 1990s2000s2010syear 1999year 2013year 2007 |
Story: | repeated dialoguewedding anniversaryloss of sonparking garagesyringeaccidentambulanceslow motion scenesexfemale nuditybased on novelnuditybloodviolenceflashback β¦sex scenekissfemale rear nudityfightcigarette smokingphotographpartychasesurprise endingshowertelephone callcryingcell phonebeatingdreamblood splatterfoodmirrorface slappunched in the facecamerawritten by directorarrestbare buttsecretletterlierunningbedsex standing upbathroomhallucinationbritishtelephonef wordsubjective camerafoot chasebedroomstrangulationmontageeatingfalse accusationapologyno opening creditsdream sequencedrawingdouble crosssearchon the runflash forwardparkattempted murderargumenthotel roomdangerscreamingkeyattackliarcharacter's point of view camera shotknocked outdiarydomestic violencescarinjectiondeath of sonreunionsleepingtrusttherapygaragefreeze framerevelationwarehousehypodermic needleheavy rainlooking at oneself in a mirrorlistening to musicsociopathcrying womantherapistnosebleedbarefoot malepsychologistfalse identitypresumed deadreverse footagetensionbloody nosemobile phoneblood on faceintrigueimpostorbroken glasshousewifeescape attempthit on the headevidencesurprisewedding ringvoice over letternotepierbruisebenchnewspaper clippingholding handsmannequinphoto albumfast motion sceneclose up of eyesfiremanmemory lossanniversarymental patient12 year oldclosetnotebookmedical maskviolence against womenrepeated sceneschemeassumed identitydoubtfake identitytwist endingfriendship between womenhospital roomhospital bedwhisperinghearing voicesnewspaper articlehead injuryscene of the crimelocked doordomestic abuseseizurecamcorderrepeated linefacial scarmanipulative behaviorfirst person titlehiding placehitchcockiandistrustfully clothed sexwaking upwet clothesflashback within a flashbackbrain damageclose up of eyefade to blackman hits a womanman slaps a womanwrapped in a towelred herringman slaps womanloss of memorycityscapevideo diaryconcussionfire alarmlearning the truthdigital camerapretending to be someone elseman hits womanpsychological manipulationrepeated eventman fights a womanrepressed memorywine bottlehysterical outburstleft for deadbloody mouthhidden truthman punches a womanvideo recordingobservatoryreconstructionsedativefemale star appears nudepenis slurkiss on the foreheadhummingmanipulative mandead sonoutburstpeepholeprivate investigationbirth certificatedisbeliefmysterious event40 year old8 year oldmentally unstablename tagfacial bruisechloroformedmale female fightwindshield wiperamnesiacmristanding in the rainviolent manmentally unstable womanbrushing one's teethclose up of handmentally unstable protagonistwoman wrapped in a towelhusband hits wifehusband slaps wifelocking a doorwrapped in a bedsheetbreaking a glassshort term memory losswedding photographlost memorymeningitiswaking up nakedgaslightingmistaken belief that someone is deadshoeboxill wifeshort term memorycamera shot of eyessick wifeanterograde amnesiareunited with familysearching for the truthskiing accidentage regressionhit with a lampchemistry teachermedical reportsick womanlooking through a peepholetalking to a camerasinging along to music (See All) |
Elizabeth Masterson, a dedicated doctor in San Francisco, had almost no time for anything. When her sister with two kids set her up on a date, she gets into a tragic car crash and goes into a coma. Meanwhile, a landscape architect named David Abbott moves to San Francisco and, coincidentally, into E β¦lizabeth's apartment for rent. While at the apartment, Elizabeth's spirit haunts him. She doesn't remember who she is, who her family is or what she did - All that she remembered was her apartment and where everything was. To settle the arguments, David agrees to figure out who Elizabeth really is. When they get close to figuring out who she is, they eventually find love with one another and as they finally know who she really is, they learn that fate really has put them both together. (Read More)
Subgenre: | independent film |
Themes: | supernatural powerfriendshipdrinkingdrunkennesslonelinessafterlife |
Mood: | rain |
Locations: | hospitalbarrestaurantelevatorapartmenttruckrooftopsan francisco california |
Characters: | nursehusband wife relationshipmother daughter relationshipfrienddoctortattoosingerbrother sister relationshipgirlmusicianpriestsister sister relationshipsecurity guardpsychiatristaunt niece relationship β¦catholic priestdoctor patient relationship (See All) |
Story: | road accidentaurasaving a lifefateloss of wifeproduct placementambulancecar crashbased on novelnuditymale nudityflashbackmale rear nuditybare chested malekiss β¦photographsingingshowercell phonedreamunderwearcar accidentpunched in the facewatching tvdrinkthongbare buttsecretneighborguitarcandleold manmansionmontageritualcoffeeparkkeywidowerrace against timescarinjectionhairy chestgardenpsychicflirtingdestinyspirithypodermic needletitle based on songcomapatientarchitectwindbookstoredaydreamrefrigeratorfemale doctorbenchtank topexorcismreal estate agentapparitionblind dateestatex raycookiemeat cleaverguitar playerritegolden gate bridgescrewballholy waterflashingsoul mateworkaholicwomen's bathroomemergencytrolleysnowglobelife after deathfemale ghostflyerlife supportsidewalk cafetea partymouth to mouth resuscitationout of body experiencefirst aidbodily possessionghostbusterdry cleanersbed riddenwaking up from a comadry cleaninglandscapingsmoke alarmsurgical stitchestransamerica pyramidthrowing a drink on someonecerebral hemorrhagereference to little orphan anniebookstore clerkrooftop garden (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
Subgenre: | independent filmsuspense |
Themes: | supernatural powermemoryghostmurderdeathlovesuicidekidnappingpregnancydrinkingfeardrunkennessfuneralobsessionparanoia β¦drug usedysfunctional familyguiltafterlife (See All) |
Mood: | murder suiciderainnightmare |
Locations: | cemeterybathtubchicago illinois |
Characters: | husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipmother daughter relationshipchildrenboyteenage girlteenage boypolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationshipsuper hero β¦seeing a ghost (See All) |
Story: | headachepremonitionproduct placementsuicide attemptambulanceshot in the chestshot to deathsexbased on novelbloodbare chested malegunfemale rear nudityfightparty β¦knifeerectioncryingsongwoman on topcorpseblood splatterwatching tvdrinksecretshootingvomitingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backsubjective cameraflashlightbandhousenonlinear timelinecoffinsearchgraveyardtalking to the cameragravemissing personcover upattempted rapedisappearancesleepinghaunted housepsychicgamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewblood on faceunderage drinkingshoveldelusionhypnosissuperstitionfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voiceshypnotismbreaking a windowhearseloss of sisterpsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesthirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
Jules Winnfield ('Samuel L. Jackson' (qv)) and Vincent Vega ('John Travolta (I)' (qv)) are two hit men who are out to retrieve a suitcase stolen from their employer, mob boss Marsellus Wallace ('Ving Rhames' (qv)). Wallace has also asked Vincent to take his wife Mia ('Uma Thurman' (qv)) out a few da β¦ys later when Wallace himself will be out of town. Butch Coolidge ('Bruce Willis' (qv)) is an aging boxer who is paid by Wallace to lose his fight. The lives of these seemingly unrelated people are woven together comprising of a series of funny, bizarre and uncalled-for incidents. (Read More)
Subgenre: | independent filmcult filmblack comedy |
Themes: | near death experiencemurderrevengedrugsrapetorturegangsterdeceptionvoyeurismrobberycorruptionbrutalitydrug useredemptionhumiliation β¦drug addiction (See All) |
Mood: | goreneo noir |
Locations: | barrestaurantmotorcyclelos angeles californiataxielevatormotelstrip clubbrotheltwo on a motorcycle |
Characters: | nursehusband wife relationshipfather son relationshipafrican americanboyfriend girlfriend relationshipgay sexactresshitmanmilitary officertalking to oneself in a mirroractor directoractor director writerhomosexual rapegay rape |
Period: | 1990s1970s |
Story: | number 666drug overdosebible quoteoverdosewristwatchsyringebaseball batdinercar crashshot in the chestshot to deathbloodmale nudityviolence β¦flashbackbondagetwo word titlegunkisssingingpantiesshowertelephone callshootoutcorpseblood splattermachine guncar accidentmirrorblondeshot in the headshotgunrescuepunched in the facewatching tvheld at gunpointlingerieinterrogationbathroomvoyeurf wordcleavagefoot chasebound and gaggeddrug dealerwomancocaineboxingtied to a chairjokenonlinear timelinewhite pantiesanti heroscantily clad femalehit by a cardouble crosscontroversyanthologyshot in the legcoffeeshot in the foreheadracial sluron the runorganized crimeprologueuniformfantasy sequencepay phoneknocked outlong takeconvertiblebasementshot in the armsilencercult directorheroinfreeze framerecord playergirl in pantiescrime bosschainsawmachismouzigoldpot smokingloyaltynipples visible through clothinghypodermic needledruglifting someone into the airboxerassaultnosebleedblockbusterphone boothcovered in bloodrapistmexican standoffdrug dealingapartment buildingbarefootpump action shotgunbuddykatana swordblood on faceball gaggunshot woundshot in the faceplot twistensemble casthit on the headaccidental killingblood on shirttuxedobriefcasetrophybrushing teethwrestlershot multiple timesmale in showertorso cut in halfimpersonating a police officermarijuana jointmultiple storylinedirector cameokatanavietnam veteranrobberhit in the facejunkyardcar drivinghomagehead woundhead blown offsnorting cocaineblue pantiessex slavealarmmini dresswallettwo man armystolen moneyarmed robberygun held to headrestroomshoutingblood stainanal rapemale rapeaccidental shootingpiercingforeplayhamburgerbare feetmacguffinjointn wordbullet woundextreme violencepawnshopcodesome scenes in black and whitemurder by gunshotchapter headingsin medias ressurrenderwoman smokercocaine snortingtalking while drivingoff screen murdershot in the crotchfamous linefinger gunphonographintercomzippo lighterautomatic weaponmultiple perspectivesmultiple time framesdance contestpayphonetoastermoral ambiguityrunning for your lifefoot massagegun held to one's headkilled with a gunfalling asleeprestaurant ownershot through a wallsecret codetelling a jokeextreme closeupbloody mouthinterlinked storieschoppermovie referencecaged humanblowing a kisspulp fictionfake bloodimplied cunnilingusdrug snortingperson in car trunkafrobody piercingfemale bare feetplaying against typefoolcrime gone awryadrenalinebullet holemale with long hairmilkshakemulletdirected by co starpack of moneysexual referencekilled with a swordkamikazenumber in character's nameshop ownerdivine interventiongourmetheirloomtwo killerssprayed with waterpostmodernhondashot repeatedlytwist the danceclaw hammergold watchfixed fightmilitary dress uniformcelebrity impersonatorgarden hosemale wearing an earringreading booktongue piercingcup of coffeeleather maskmale sitting on a toiletcollision courseknocked out with gun buttinterruptionno background scoreblack suit clad killerpop tartriding motorcyclebiblical passageacura nsxhonda civicreel to reel tape recordertied up and gaggedacuraeeny meeny miny moemuzzleproblem solverrolling a jointslurping a drink with a strawchapterwise storytellingcult tv referenceabdomen slashedkept in a boxsprite sodaslot car racing (See All) |
Johnny Blaze, a man who made a deal with the Devil who called himself Mephistopheles at the time (now Roarke), is on the run trying to make sure no-one is harmed by his alter ego, The Ghost Rider. He is approached by a Monk named Moreau who tells him that he can help be him free of the Rider, but fi β¦rst, he needs Johnny's help to protect a boy, whom Roarke has plans for, to help him take human form. (Read More)
Subgenre: | superhero |
Themes: | devilsupernatural powerghostmurderdeathsurrealismkidnappingdrunkennessescapegangsterdeceptionsurveillanceself sacrifice |
Mood: | car chase |
Locations: | hospitalrestaurantmotorcyclenightclubtruckcavetrain stationcar motorcycle chase |
Characters: | mother son relationshiptattoopriesthostagetough guywarrioraction heroalcoholicsnipersniper rifle |
Story: | disfigurementback from the deadhead buttdinerambulancecar crashshot in the chestshot to deathsequelcharacter name in titleviolenceflashbackfighttitle spoken by characterexplosion β¦knifechasepistolfirepunctuation in titlecell phonefistfightmachine guncar accidentshot in the headshotgunrescueswordbrawlshowdownheld at gunpointhand to hand combatsecond partinterrogationdemonrevolvercombatshot in the backdecapitationgood versus evilfoot chasebased on comic bookambushbridgeexploding carno opening creditsanti heroone man armychild in perilhit by a carritualtransformationon the runbinocularsperson on fireattackfugitiverace against timeknocked outskeletonscarinjectionsplit screenexploding bodyneck breakingthreatened with a knifemercenarysilencersubtitled scenehenchmanak 47uzihand grenadeburned alivewhat happened to epiloguehypodermic needlesecurity cameraskullrocket launchermonkbikergypsystealing a caranimated sequence3 dimensionalgash in the faceresurrectionescape attemptmarvel comicsdark heroeye gougingknife throwinglonerlens flaredemonic possessiontragic herochainburned to deathwilhelm screamturkey the countryflat tiregrenade launcherfast motion scenetelepathybazookanarrated by characterdrifterpickpocketbag over headmonasteryhuman sacrificearms dealergurneysole black character dies clicheeastern europefrenchmanbulldozerchainsdeal with the deviltruck stopdecomposing bodyarsenaldocksturned to stonecranemarvel entertainmentamphitheater3d sequel to 2d filmreturning from the dead (See All) |
Following a truck hijack in New York, five conmen are arrested and brought together for questioning. As none of them are guilty, they plan a revenge operation against the police. The operation goes well, but then the influence of a legendary mastermind criminal called Keyser Soze is felt. It becomes β¦ clear that each one of them has wronged Soze at some point and must pay back now. The payback job leaves 27 men dead in a boat explosion, but the real question arises now: Who actually is Keyser Soze? (Read More)
Subgenre: | independent filmcult filmheistheist gone wrong |
Themes: | murder of sondevilmurderdeathrevengerapebetrayalprisonfearescapegangsterrobberytheftevildeath of wife β¦police corruptiondeath of daughtermurder of familymurder of daughter (See All) |
Mood: | neo noirambiguous endingmyth |
Locations: | new york citybeachcarlos angeles californiapolice stationshipcavecar fireship firemurder in elevator |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipgirllawyerhitmanvillainsnipersniper rifle |
Period: | 1980s1990syear 1981 |
Story: | loss of familymurder of wifereference to elvis presleydead childloss of sonparking garageloss of wifeslow motion sceneshot to deathbloodviolenceflashbackguncigarette smokingexplosion β¦three word titlesurprise endingfireshootoutcorpsemachine gunarrestmaskinterrogationmanhattan new york citycriminalmassacreweaponexploding carassassinationdouble crosscoffeelegendorganized crimedeath of childmanipulationbodyguardautomobiledeath of sonex convictcorrupt copsplatterchild murderuziloyaltyslow motionlawlifting someone into the airtold in flashbackhidingmasked mandrug dealingmechaniccamera shot of feetpump action shotgunironyplot twistensemble castsuspectgasolinebriefcaseworld trade center manhattan new york citydrug lordman cryingtranslatorharbordockgerman shepherdlighterloss of daughtergun held to headwatchfemale lawyermind gameunsubtitled foreign languageloss of childreference to albert einsteinhijackingburnt bodysiblinglighting a cigarettemultiple endingsdeath of familylimpin medias resdirty copburn victimpool hallfamous linehungarianzippo lightersittingcityscapecustomstime bombhundred dollar billcriminal mastermindfax machinecerebral palsygay subtexthomoeroticlifting an adult into the airworld trade centerlimpingkilled in an elevatorpolice badgerealizationmasked criminalemeraldlawyer client relationshiprecruitingcargo shipdead body in waterrelativeboeing 747lifting a male into the airunreliable narratormystery mananonymous telephone callfunny accentbad guy winsreference to lee harvey oswaldlocked in jailunreliable flashbackburying a bodyreference to loch ness monsterreference to pope john paul iislitting the throat of a childunreliable narrationmystery villainwooden cratebilliard tableblack maskshot in backbulletin boardmp5breaking a car windshieldthird degree burnsturkish mafiaurinating on a firebox of moneychecking watchcriminal fencesecret characterthieves falling outchild killed by fathermultiple actors playing same role (See All) |
Marvel's "Doctor Strange" follows the story of the talented neurosurgeon Doctor Stephen Strange who, after a tragic car accident, must put ego aside and learn the secrets of a hidden world of mysticism and alternate dimensions. Based in New York City's Greenwich Village, Doctor Strange must act as a β¦n intermediary between the real world and what lies beyond, utilising a vast array of metaphysical abilities and artifacts to protect the Marvel Cinematic Universe. (Read More)
Subgenre: | martial artssuperheroparanormal phenomena |
Themes: | near death experiencesupernatural powerghostmurderdeathsurrealismbetrayalescapedeceptionmagicapocalypsecouragephilosophyself sacrificespace travel β¦book of magic (See All) |
Mood: | raindarkness |
Locations: | hospitalnew york citychurchhelicoptersnowbusdesertlondon englandapartmentpolice carouter spacefire truck |
Characters: | nursedoctortough guywarrioraction heroteacher student relationship |
Period: | 2010s |
Story: | defibrillationback from the deadwristwatchhead buttproduct placementaccidentambulancecar crashfalling from heightslow motion scenecharacter name in titleviolenceflashbackbare chested malefight β¦title spoken by characterexplosionknifechasesurprise endingfirecell phonebeatingcorpsefistfightcar accidentmirrorrescuepunched in the facewritten by directorbattleswordbrawlhand to hand combatdemonfightingcombatdecapitationgood versus evilfoot chasebased on comic bookambushmansionbasketballdeath of friendmontageimpalementmixed martial artsstabbed in the chestsevered headno opening creditsanti heroone man armyritualtransformationlatex glovestrainingone against manylibraryspiritualityelectrocutionattackrace against timeevil mankicked in the facetough girllightningopening action scenescene during end creditsexploding bodylaptoplove interestbattlefieldpowerstylized violencestrong female characterhenchmansurgerytraitorfalling down stairsdestructionbulletrevelationheavy rainhong kongmagiciantemplebeardexploding buildingkicked in the stomachblockbustereccentrictimeend of the worldaction heroineinterracial friendshipfemale warriorshieldcameobraveryfight to the deathdual wieldresurrectionwizardimmortalitymentorscene after end creditsmarvel comicspunched in the chestbutterflyblack eyewisecrack humore mailtitle at the endhealingfemale doctorlaughingsurgeonblack magicreckless drivingteleportationarrogancesurprise after end creditsspellenergylevitationalleyfinal showdownmysticismfemale fighterabuse of powerportaltwo man armyworld dominationbrooklyn bridgelibrarianmegalomaniacskyscraperold flameno title at beginningsorcererartifactbullet woundguardianoperationamuletimmortalgodvending machinebo staffbaldalternate dimensionnew agetime looprelicattempted robberyx rayed skeletonearth viewed from spacementor protege relationshipnepalparallel worldsurprise during end creditssecret organizationorigin of herobrain surgerybritish actor playing american characterbroken handcollapsing buildingmysticbrass knucklesipodsequel mentioned during end creditsdisobeying ordersdefibrillatoranti villaincosmoshenchwomanmarvel entertainmenthand woundsupervillainout of body experiencealternate worldcloakmarvel cinematic universeevil sorcerermount everestevil godalley fightfighting in the airdying repeatedlyman wearing a tuxedomagical ringmaster apprentice relationshipoccupation in titleastral projectionzealotmagical objectlovecraftianmultiverseneurosurgeonupside downreference to beyoncereference to emineminanimate object comes to lifetime reversalparallel dimensionmentoringremoving a bulletarrogant manreference to bonoprayer wheelpsychedelic imagedimensional portalkathmandu nepalstan lee cameonew york cityscapethrown outcar falling off cliffsevered spinesuperhero origindisembodimentnerve damageenergy beamexperimental surgerysuturing a wounddisintegrating bodydoctor strangemiracle cure (See All) |
This is the story of three well-meaning but flawed people: Paul Rivers, an ailing mathematician lovelessly married to an English emigre; Christina Peck, an upper-middle-class suburban housewife, happily married homemaker with two young daughters, with hiding a secret past; and Jack Jordan, an ex-con β¦vict who has found in his Christian faith the strength to live a law-abiding life and raise a family. They will be brought together by a terrible accident that will change their lives. By the final frame, none of them will be the same as they will have learnt harsh truths about love, faith, courage, desire and guilt, and how chance can change our worlds irretrievably, forever. (Read More)
Subgenre: | independent filmsuspensetragedymelodrama |
Themes: | griefmurderdeathloverevengesuicidemarriageinfidelitydrugsreligionbetrayaladulteryprisonpregnancydrinking β¦drunkennessextramarital affairangerlonelinessdeath of motherdrug useredemptionguiltunfaithfulnessillnessfaithalcoholismhopedyingabortionvengeancedrug addictiondeath of daughter (See All) |
Mood: | rain |
Locations: | bicyclehospitalbarrestaurantchurchswimming poolsnowdesertpolice carmotelsuvcar theftnew mexico |
Characters: | biblereference to godnursehusband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipmother daughter relationshipdoctortattooboyteenage boyteacher β¦policemanlawyersister sister relationshiplittle girllittle boyprofessorsheriff (See All) |
Story: | saving a lifemourningheart attackaccidentsuicide attemptdinerambulancefemale nuditynumber in titlebloodmale nudityfemale frontal nudityflashbackmasturbationmale rear nudity β¦two word titlegunkisscigarette smokingnipplesphotographsingingpartyknifepantiespistoltelephone callvoice over narrationfondlingcryingcell phonebeatingcorpsedigit in titleunderwearfoodcar accidentface slapwatching tvcomputerdrinksex in bedshootingvomitingtearsbirthdaycafebathroomjailvoyeurreference to jesus christprayerrevolverswimmingcleavagebreast sucklingbasketballwidowcocaineprisonertoiletnonlinear timelinebirddrawinghit by a carbirthday partyunderwater scenelatex glovespaingunshotflash forwardattempted murderdrug addictmicrophoneumbrellahangingscarcrossdeath of husbandex convicthandgunobscene finger gesturetherapyprivate detectivepickup trucksurgerybirthday cakepoemgolfmedicinehypodermic needleslow motionsexual attractioncomapatientdrug abusearchitectbuttockscaucasianlosstimeguardpillsministerdespairmedical examinationevidenceheartthirty somethingmarital separationprison cellred pantiesbowlingloss of husbandrelease from prisonsirensymbolismhit and runhysteriamultiple storylinestoredinner partyplaying poolphysicianlighterloss of daughtermathematicsclinicnewspaper articlestonedinfertilityreverendbleedingmonitorgolf coursewakeallergywashing machineartificial inseminationswimmericonschizophrenicprivate eyemortalityfanaticasphyxiationliquor storenightgownmercyhamsterbedriddenfired from a jobwashingexaminationheart transplantrecovering alcoholicjoke tellingmathematicianpityorgan donationoxygen tankspeeding vehicleheart surgerychocolate barporn videoorgan donorrafflejail visitationbarbed wire fencehummingbirdorgan transplantationrefusing to eatheart failuresmall time crookketamineshot in sequenceborn againleaf blowerstepping on glasscutting selfracket ballheart donorsuicide attempt by hangingsports clubcutting armflatliningracquetskull fractureaccidentally shooting oneselfwork detailmouth sprayorgan rejection (See All) |
The acerbic, hilarious Claire Bennett becomes fascinated by the suicide of a woman in her chronic pain support group. As she uncovers the details of Nina's suicide and develops a poignant relationship with Nina's husband, she also grapples with her own, very raw personal tragedy.
Themes: | griefghostdeathfriendshipsuicidemoneydrinkinglonelinessdepressiondrug usedeath of wifetraumadrug addiction |
Mood: | nightmare |
Locations: | barrestaurantswimming poolhotelcemeterylos angeles californiamexicosuvself help groupdeath in a car accident |
Characters: | nursehusband wife relationshipmother son relationshipmother daughter relationshipfriendfemale protagonistlawyermaidemployer employee relationshipsuicide by jumping |
Story: | dead childloss of sonmourningloss of wifegiftsuicide attemptdinersexf ratedone word titlebare chested malesex scenetitle spoken by characterfoodcar accident β¦drinksex in bedbirthdaylow budget filmwinelatex glovespaindrug addicthotel roomsuburbwidowerscartragic eventdeath of sontherapybirthday cakecakelistening to musiccrying womantherapistpillscynicismconfrontationfemale leadhousekeeperdivorceevodkastolen carmexican americanwoman cryingmotel roomborder crossinggardenershoutinggroup therapyhospital bedpharmacytrain tracksfacial scarfemale cinematographersorrowbechdel test passedsleeplessnesssupport groupu.s. mexico borderfemale editorpersonal assistantdrive ingrievingman undressingvisiting a gravetijuana mexicoborder guardphysical therapymedical clinicagonywind chimeindoor swimming poolhitch hikerdrive in theaterpain killerdrive in moviephysical therapistswimming with clothes onawkward sexbad moodpainkillerchronic painriverside california (See All) |
While undergoing open heart surgery, a man's failed anesthetic leaves him completely alert, but paralyzed and unable to tell his doctors
Subgenre: | independent filmconspiracy |
Themes: | memorymurderdeathrevengesuicidemarriageinfidelitydrugschristmasmoneybetrayaldrinkingdrunkennessweddinginvestigation β¦death of fatherwealthself sacrifice (See All) |
Mood: | rainmurder plot |
Locations: | hospitalnew york citybeachchurchbathtubsex in a bathtubtwo in a bathtub |
Characters: | nursehusband wife relationshipfather son relationshipmother son relationshipdoctorteacherpolicemanemployer employee relationshipfiance fiancee relationshipdoctor patient relationshipcheating girlfriendmother in law daughter in law relationshipalcoholic doctor |
Story: | startleddefibrillationoverdosesyringeheart attackambulancefalling from heightsexnudityflashbackgunkisscigarette smokingphotographtitle spoken by character β¦partyvoice over narrationcryingcell phonedreammirrorcomputercameradrinkarrestundressingkissingsecretlietearsclassroommanhattan new york cityshot in the backsubjective camerahalloweenwidowcocainesubwaynonlinear timelineman with glassesfishingbathlatex glovespainlimousinebusinessmanliarumbrelladomestic violencehalloween costumeloss of fathersleepingsurgeryshavingfalling down stairsfireplacepokerhypodermic needletold in flashbackdysfunctional marriageinterracial friendshippillsministermedicationcard playingheartrainstormabusive fatherpassionate kisssurgeonbrushing teethabusive husbandhalloween partyengagement ringnarrated by characterwedding ceremonyparalysisbillionairelawsuitpartial female nudityscalpelforeplaymailmailboxgurneymarriage engagementwet t shirtconsciousnessnewlywedvending machinewet clothesnew york skylinebow tietycoonmedical professionsurgical operationbegins with textpersonal assistantvoice over inner thoughtssanta claus suitpagerheart transplantwife abusepreparatory schooloperating roomvampire costumeheart conditionwife murders husbandside boobout of body experienceheart surgerynun costumecheating fianceeanestheticoedipal complexfinancierhospital waiting roomheart surgeonholding breathanesthesiamilitary dress uniformmedical malpracticehearing characters thoughtsjapanese businessmanwearing clothes in a bathtubtwo in a bathoperating tableanesthesiologistblack doctorpartial male nuditysuppressed memoryopen heart surgeryprescription bottlemariticide (See All) |
The middle-class couple Linda Hanson and Jim Hanson live a wasted and routine relationship with their two daughters in their comfortable house in the suburbs. On a Thursday morning, the local sheriff visits Linda and tells her that her husband died in a car accident on the previous day. On the next β¦morning, when Linda awakes, she finds Jim safe and sound at home. When she awakes on the next morning, she realizes that her days are out of order, but her family and friends believe she is insane. (Read More)
Subgenre: | melodrama |
Themes: | griefsupernatural powermemorymarriageinfidelitypregnancyfuneralextramarital affairaffair |
Mood: | rainnightmare |
Locations: | hospitalschoolchurchcarcemeterysmall townkitchenlaketruckofficestormsuv |
Characters: | best friendhusband wife relationshipfather daughter relationshipmother daughter relationshipchildrenpriestpsychiatristsheriffinsurance agent |
Story: | premonitionmourningsyringeaccidentcar crashbloodone word titleinterviewflashbackexplosionsurprise endingshowertelephone callcell phonecar accident β¦mirrortelevisiontelephonedecapitationcandlewomantied to a chairnonlinear timelineexploding carsevered headcoffinsuburblightningscardeath of husbandtied upgrandmotheranswering machinejeepheavy rainloss of loved onebarefootreconciliationbroken glasshousewifemedicationthunderstormrainstormalternate realityloss of husbandmarital problemcrowunfaithful husbandmessageflyexploding truckglassinsurancepsychiatric hospitalford mustangcadillactied up while barefootdead birdcalendarcasketcandlelightnightgowndeja vunew housesleeping pillchevroletmarital crisisclothes linedead husbandheadstarting overphone bookbusiness tripdoor belltoyotafalling through a windowlife insurancedying repeatedlymustanghondanissanfacial injurystop signother womaninjured childlightning strikeford motor companywindow smashinglithiumlincoln automobilelincoln town carmazdainvoluntary commitmentford tauruscutsford explorerhonda accordwaste basketcadillac escaladeloose endsmazda miatachevrolet tahoedistracted driverford f150 pickup truckford fusionfroot loops cerealjeep grand cherokeekellogg's frosted flakes (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | cult filmblack comedyconspiracysupernatural |
Themes: | near death experiencesupernatural powermurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyfearescapewedding β¦deceptionseductionrobberypsychopathbrutalityparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionregret (See All) |
Mood: | gorecar chaseslasherpoetic justice |
Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
Characters: | homosexualpoliceteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerserial killerdetectivepriesthostagethiefpolice detective β¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
Period: | 1990s |
Story: | reference to frankensteindisfigured facedisfigurementback from the deadhead buttnewspaper headlinefilm within a filmbaseball batcar crashslow motion sceneshot in the chestshot to deathsequelsexcharacter name in title β¦bloodviolencebare chested malegunkissfightcigarette smokingphotographknifechasesurprise endingpistolfirecryingcell phonebeatingcorpseblood splattercar accidentmirrorrescuewatching tvbare buttlettershowdownheld at gunpointrock musicdead bodymarijuanahandcuffsrevolvertelephonef wordorphanflashlightambushstrangulationmansionmontagethroat slittingbridgeimpalementstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timedollknocked outlightningskeletonringscarfishnet stockingsstalkingchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacegothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killermale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapelhit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlechange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
Evan Treborn grows up in a small town with his single, working mother and his friends. He suffers from memory blackouts where he suddenly finds himself somewhere else, confused. Evan's friends and mother hardly believe him, thinking he makes it up just to get out of trouble. As Evan grows up he has β¦fewer of these blackouts until he seems to have recovered. Since the age of seven he has written a diary of his blackout moments so he can remember what happens. One day at college he starts to read one of his old diaries, and suddenly a flashback hits him like a brick! (Read More)
Subgenre: | cult filmpunkparanormal phenomena |
Themes: | memorymurderdeathloverevengesurrealismsuiciderapereligionjealousyprisonescapefuneraltravelpsychopath β¦death of fatherparanoiatime travelcancerinsanityillnessabuseunrequited lovechildhoodtraumaamnesiainheritanceself sacrificepsychological trauma (See All) |
Mood: | rainnightmaremoving |
Locations: | bicyclehospitalbarrestaurantschoolforesthotelcemeterywoodswheelchairslumsuvprison rape |
Characters: | reference to godnursefather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipboybrother sister relationshipteenage girlprostituteteenage boyteachergirlstudentbaby β¦bullywaitresspsychiatristprofessorself mutilationchildhood friendfather in prison (See All) |
Period: | future |
Story: | film starts with textmurder of a childbilliardsfatehome moviebaseball batsuicide attemptambulancefemale nuditybloodviolencefemale frontal nudityflashbackdog β¦bare chested malegunsex scenekissfightfemale full frontal nuditycigarette smokingexplosionknifesurprise endingpantiesshowertelephone callfirecryingbeatingdreamunderwearsex in bedvomitingbeertearsanimal in titlelingeriecafecollegereference to jesus christmale pubic hairtelevisioncleavagegay slurstrangulationvideo camerastabbingbasketballimpalementstabbed in the chestfemale pubic hairnonlinear timelinechild abusescantily clad femalecoffindrawingchild in perilunderwater sceneroommategraveyardmarriage proposalracial slurflash forwardattempted murderdrug addictcursebeaten to deathstabbed in the backmini skirtpay phonedollknocked outreadinguniversityscarcrossbasementsevered armtherapyhatepornographydestinymedicinekilling an animalsociopathcaptivevandalismwatching a moviemovie theaternosebleedpsychologymind controlcompassions&mtowelchokingmental institutionhaunted by the pastbraverycynicismhypnosishit on the headbutterflydynamitepedophileaccidental killingdungeonconvictalternate realitycastrationfemale in showerbraindead dogmemory lossmale objectificationstabbed in the handnotebookpedophiliajunkyardplaying poolkilling a dogblue pantiesjournallost loveblackoutrepressionmale in underwearasthmaself defensefraternitysororitywormhazingmailboxtestexamessaycrotch grabpsychotherapystresschild molesteryoung mangoth girlfirecrackerburning911kneelingpepper sprayrepressed memoryprosthetic limbmodel airplanechild herograve side ceremonyconvulsiontime travelerchild murders a childlung cancerchild pornographyalternate universealtering historyreference to robin hoodinhalerchildhood memoriescigarette burnsharddisturbed childhoodcat scanfatalismsedationfraternity househuman brainmemory lapsesleeping shirtlesschaos theorytoesdeath of a dogbutterfly effectaryan brotherhoodlighter fluidmk ultraunintended consequenceshypnotic regressionmace the repellentmale time travellerpsychotic childsleeping in underweartalking during a movieu haul truckartificial handbrain hemorrhagenumbnessmail bombchange historymorpho butterflybuilding model airplanechanging past event (See All) |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel β¦ Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
Subgenre: | suspensegothic horror |
Themes: | griefsupernatural powerghostmurderdeathfriendshiprevengesuicidebetrayaldrinkingfearadoptiondeath of wifevengeanceforgiveness β¦madnessdeath of daughterafterlifedeath in childbirth (See All) |
Mood: | rainnightmarehorror movie remake |
Locations: | beachtrainforestcarbathtublondon englandvillagewoodsrural settingengland |
Characters: | reference to godhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboygirlsister sister relationshiplittle girllittle boysingle fathersuicide by hangingbaby boy β¦ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All) |
Period: | 1910s |
Story: | engravinghit by a trainmurder of a childdead childloss of sonloss of wifeaccidentcolor in titleslow motion scenebased on novelbloodviolenceflashbackdogphotograph β¦firecryingcorpsefoodmirrorrescuedrinksecretletterpaintingtearsrunningdead bodytelephonenewspapercandleaxemansioneatingwidowhousedrivingchildbirdcoffindrawingsearchjourneygraveyarddrowningflash forwardgravecurseprologuescreamingkeywidowerperson on firedolldeath of childskeletonhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of mothersleepinghaunted housesingle parentfireplacelooking at oneself in a mirrorcrucifixtoyeccentriclossrailway stationclockthunderwizardlostthunderstormsuperstitionatticfogvoice over letterlanternbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionold dark housemental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorhearing voicespocket watchloss of childlocked doorbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudhorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All) |
Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing, β¦to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)
Subgenre: | independent filmmartial artscult filmblack comedytragedymelodramabuddy comedy |
Themes: | near death experiencemurderdeathfriendshiprevengekidnappingmoneybetrayaldrunkennessescapefuneralgangsterheroinvestigationdeception β¦robberypsychopathdeath of fatherredemptionguiltinsanitysadismsurveillancealcoholismcourageself sacrificepolice brutalitymurder of a police officer (See All) |
Mood: | neo noircar chase |
Locations: | bicyclehospitalbarhelicopterbustaxielevatorurban settingapartmentpolice stationpolice carrooftopfire truckmotorcycle chaseabandoned factory |
Characters: | suicide by copnursehusband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boypolice officerdetective β¦hostagelawyerthieftough guywarrioraction heroalcoholicpolice detectivesniperpolice shootoutsniper riflepolice chaseself mutilationdeath of girlfriendself inflicted gunshot woundpolice funeral (See All) |
Period: | 2000s |
Story: | wristwatchhead buttbaseball batproduct placementambulancecar crashfalling from heightslow motion sceneshot in the chestshot to deathsequelbloodviolenceflashbackbare chested male β¦fightphotographexplosionpartychasesurprise endingpistolfirecell phoneshootoutbeatingcorpseblood splatterfistfightmachine guncar accidentshot in the headshotgunrescuepunched in the facecameraarrestgunfightbrawlvomitingshowdownheld at gunpointhand to hand combatsunglassesbombbirthdayinterrogationhandcuffsrevolvercriminalkung fushot in the backsubjective cameragood versus evilfoot chaseflashlightgangambushstrangulationmassacredisguisedeath of friendmontagemixed martial artsinternetnonlinear timelineexploding caranti herodisarming someoneone man armydouble crosspolice officer killednews reportshot in the legmarriage proposalshot in the foreheadtrainingone against manyorganized crimebinocularscharacter repeating someone else's dialoguebeaten to deathkaratecharacter's point of view camera shotrace against timeknocked outkicked in the faceopening action scenebankstreet shootoutshot in the shoulderscardeath of brothersplit screendeath of sonpolicewomandie hard scenariobank robberyshot in the armwhippingbare chested male bondagecorrupt copstylized violencehenchmanak 47birthday cakeropeuzifalling down stairshand grenadeteen angstrevelationelectronic music scoremass murdercomahong kongsecurity camerajail cellwalkie talkiekicked in the stomachswat teamphone boothpress conferencejumping from heightskateboardfollowing someonemexican standoffchop sockyfemale killerbar fightbroken legmasked manthugwhiskeydamsel in distressreverse footagehaunted by the pasttarget practicetelescopeexplosivesurveillance camerabraveryhatredpartnermercilessnessevacuationshopping mallpunched in the chestdark herojumping through a windowthrown through a windowassault riflebooby trapaerial shotbulletproof vesttough copbetkarate choppolice raiddark pastabusive fathertragic herojuvenile delinquentfifth partlasersightpolice inspectorkilling spreesports carmannequinchallengemedia coverageengagement ringfirefighterkarate kickhit with a baseball batimpersonating a police officernews reportershot through a windowbag of moneyface maskalleyfighterbloopers during creditsex coppickpocketrobbershot in the necktimebombvomitparkourpolice chiefcomputer crackerarmed robberycomic reliefskyscraperbank robberscootercameramanbuddy cophanging upside downtriaddepartment storehit by a truckreluctant heromercy killingman kills a womanpunching bagroller skatingwoman kills a manbody bagmaverick copfilmed killingshot in the throatcop killerfemale police officeroverturning carrepeated linetragic pastfemale criminalpsychological torturecamera phonejailbreaklegosole survivorheroic bloodshedhappy birthday to yougang memberbagpipesgambling debtburn victimshot through a doorgang leaderspaghettimurder spreeabandoned warehousedreadlocksinnocent person killedsurveillance footageextreme close uphostage situationcrime spreepolice commissionerex marinefalling through the floortime bombmoney falling through the airbank vaultbank heistshoot outrich kidjazz clubbank managerdouble decker buspurse snatchergas grenadefragments of glasshit by a businvestorgame of deathfemale thiefburnt handoutrunning explosionbomb squadstrapped to a bombrappellingslide locked backdeath traptroubled pastwoman murders a manonline gamingtrip wirenoodlesrubber duckwaking up from a comabus crashreboot of seriesyouth gangclown maskhong kong policesecret hideoutwhiskymanhole coverfemale robberteenage rebelcop impersonationdisgraced coparmed robbersurvivor's guilt (See All) |
This urban nightmare chronicles several days in the life of Caine Lawson, following his high-school graduation, as he attempts to escape his violent existence in the projects of Watts, CA.
Subgenre: | independent filmcult filmcoming of ageblack comedyteen movie |
Themes: | near death experiencemurderdeathlovefriendshiprevengedrugsmoneybetrayalprisonpregnancyfeardrunkennessescapegangster β¦robberyangerpsychopathdeath of fatherbrutalitydeath of motherparanoiahumiliationexecutionhopedyingvengeancepolice brutality (See All) |
Mood: | goreneo noirhigh schoolarchive footageaffection |
Locations: | hospitalcarlos angeles californiaurban settingpolice stationgas stationinner city |
Characters: | husband wife relationshipfamily relationshipspolicemother son relationshipteenagerafrican americanfriendboyfriend girlfriend relationshipbrother brother relationshippolice officerdetectivesingle motherpolice detectivemuslimcousin cousin relationship β¦grandfather grandson relationshipgrandmother grandson relationshippolice chasepolice dog (See All) |
Period: | 1990s1970s |
Story: | drug overdosebible quoteoverdoseparking garageproduct placementslow motion sceneshot in the chestshot to deathnumber in titlebloodviolenceflashbackdogbare chested malegun β¦fightcigarette smokingpartyknifechasethree word titlesurprise endingpistolvoice over narrationshootoutbeatingblood splatterfistfightmachine gunshot in the headshotgunpunched in the facewatching tvarrestgunfightbrawlshootingvomitingheld at gunpointbeersunglassesinterrogationhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurorphanflashlightgangcaliforniadeath of frienddrug dealercocaineprisonerhouseno opening creditsanti herochild in perilcontroversyracial slurflash forwarddrug addictorganized crimecharacter repeating someone else's dialoguebeaten to deathlightningstreet shootoutshot in the shoulderlong takehigh school studentloss of fatherpremarital sexthreatened with a knifedirectorial debutloss of motherprofanityshot in the armheroinhatesingle parentcrime bossmachismouzicard gamepokerstreetheavy rainslow motiontold in flashbackjail cellroman numeral in titlekicked in the stomachvideotapecovered in bloodhonorstreet lifehomicidedrug dealingthugswitchbladestealing a carunderage drinkingdual wieldhatredconvenience storeescape attemptblack and white sceneghettoblood on shirtrainstormbarbecuerelease from prisonjuvenile delinquentethnic slurhustlerdesert eaglemarijuana jointgraduationstorehigh school teachercar drivingpistol whipfemale teacherkoreanvulgarityurban decaypolice interrogationn wordshot in the handsubmachine gundrive by shootingcarjackingblaxploitationtragic endingshrinefade to blackdreadlockssocial decayattempted robberygangstaslow motion action scenechild swearingchild with a gungangsta griphoodlumlatin americanchop shopdominoesdrive thrudeath of cousinconvenience store robberyurban violencemuslim convertice cream vanblack slangwatts riotschevrolet impala convertible (See All) |
When his only friend and co-worker dies, a young man born with dwarfism moves to an abandoned train depot in rural New Jersey. Though he tried to maintain a life of solitude, he is soon entangled with an artist who is struggling with a personal tragedy and an overly friendly Cuban hot-dog vendor.
Subgenre: | independent film |
Themes: | near death experiencegriefdeathfriendshippregnancydrinkingfeardrunkennessangerdivorcelonelinessdeath of fatherdepressiondrug useguilt β¦humiliationprejudiceinheritanceunlikely friendshipdancing on a bar (See All) |
Mood: | rainmoving |
Locations: | hospitalbarrestauranttrainschoolsmall townrural settinglakecanadarooftoptunneltrain stationsuvfood trucknew in town β¦train car (See All) |
Characters: | reference to godfather son relationshipmother son relationshipafrican americanchildrenteacherartistex husband ex wife relationshippregnant womannew friend |
Story: | drug overdoseloss of sonattempted suicidehome moviegiftdinerkissfightcigarette smokingphotographtitle spoken by characterthree word titlepantiestelephone callcell phone β¦underwearhorsecamerawritten by directordrinkpaintingbookbeercafemarijuanaclassroomprayermanhattan new york citysoccerbravideo cameradeath of friendbridgepaintercoffeelibrarysuitcasereadingdeath of sonclasspickup trucksupermarketsurvivoraginghitchhikingretirementdwarfgrocery storenew jerseyconfrontationconvenience storelonerdivorceereckless drivingharassmentoutcastdrunken manlibrariantavernpocket watchstonedkiss on the lipsmailkindnesswalkingpondheirvideo footagehair salonwaitingsaying gracestreet vendorunwed pregnancycuriosityrailroad trackmovie projectorrailroad crossingfrench frieshobbydrug rehabilitationfreight trainabandonedketchupmillgracepublic speakingpassed out drunkblimpreference to snow whitemodel trainbourboncuban americanshorelinehot dog vendortoy makersleep overfitting inalmost hit by a carcharacter says go to hellsleeping in a bathtubovercoming fearwalking on train tracksdeath of a co workerhoboken new jerseyrailroad yardshot glassbeneficiarypill bottlerailroad trestletrestleamtrakmonkey barsbeef jerkydepotreference to sancho panzaalmost hit by a trainreference to tom thumb (See All) |
Light Turner, a bright student, stumbles across a mystical notebook that has the power to kill any person whose name he writes in it. Light decides to launch a secret crusade to rid the streets of criminals. Soon, the student-turned-vigilante finds himself pursued by a famous detective known only by β¦ the alias L. (Read More)
Subgenre: | independent filmblack comedyconspiracy theoryteen horrorsupernatural horror |
Themes: | near death experiencesupernatural powermurderdeathrevengesurrealismsuicidekidnappingbetrayalbullyingpolice investigation |
Mood: | goreanimehigh schoolcar chasepoetic justice |
Locations: | hospitalrestaurantpolice stationpolice carfire truck |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerdetectivepolice detectiveself mutilationsingle father |
Story: | parking garageheart attacknewspaper headlineproduct placementcar crashfalling from heightslow motion scenebloodviolencetwo word titlebare chested malegunkissfightphotograph β¦title spoken by characterexplosionchasesurprise endingpistolfirecell phoneblood splattermachine guncar accidentpunched in the faceheld at gunpointf wordsubjective camerafoot chasesevered headanti herodisarming someonehit by a carunderwater scenefemme fatalenews reportlimousinehotel roombased on tv seriesfbibased on mangamini skirtrace against timeamerican flagexploding bodycharacter says i love youobscene finger gesturelove interestsubtitled scenesingle parentfalling down stairshand grenadeelectronic music scoreheavy rainice creamfbi agentexploding buildingcaucasianswat teampress conferencejumping from heightladdermind controlfollowing someonecameotokyo japanstealing a carconstruction sitestabbed in the throatpower outageplot twistexploding headundercover agentbulletproof vestcellphoneraised middle fingersecret identitynewspaper clippingmoral dilemmaprivate investigatorseattle washingtonmedia coveragetext messagingblood on camera lensvillain played by lead actormysterious manbloopers during creditsnotebookpistol whipold dark houseteenage lovespiral staircasebully comeuppancepocket watchvigilante justiceferris wheeloffscreen killingbased on animefilmed killingrepeated linerighteous ragechild molesterlive actionprivate jetpsychotronic filmabsent motherhostage situationadaptationdutch anglesurprise during end creditsskypecheerleadinghigh school footballgym classteenage angstsex offenderhidden identitynew york statemass deathmass suicideevil laughterevil godstolen police carwoman murders a manstabbed with a forkwaking up from a comadeath in titleblack lives matterfemale sociopathplaying godprom nightvow of silenceseattle space needlechased by policejumping to deathopening creditscomputer roomlive action remake of animeshinigamiten years (See All) |
Protagonist Alex DeLarge is an "ultraviolent" youth in futuristic Britain. As with all luck, his eventually runs out and he's arrested and convicted of murder and rape. While in prison, Alex learns of an experimental program in which convicts are programmed to detest violence. If he goes through the β¦ program, his sentence will be reduced and he will be back on the streets sooner than expected. But Alex's ordeals are far from over once he hits the mean streets of Britain that he had a hand in creating. (Read More)
Subgenre: | cult filmcoming of ageblack comedydystopiapolitical satire |
Themes: | near death experiencemurderfriendshiprevengesurrealismsuicidedrugsrapebetrayalpoliticsprisontorturedrunkennessdeceptionrobbery β¦psychopathbrutalityredemptioninsanitysexualityillnessmental illnesssadismhome invasiondeath of wifehomelessnesswritingpolice brutality (See All) |
Mood: | satireneo noiravant gardeambiguous ending |
Locations: | hospitalbarrestaurantchurchsnowmotorcyclebathtubnightclublondon englandwheelchairapartmentpolice stationwater torturesex in the snow |
Characters: | homeless manbiblenursehusband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipteenagerdoctorpolice officeractorwriterpriest β¦lustpsychiatristpolice sergeantsex with a nurse (See All) |
Period: | world war two1990sfuturenear future |
Story: | reference to pink floydbilliardswristwatchnewspaper headlinebaseball batsuicide attemptcolor in titlecar crashfalling from heightslow motion scenefemale nuditybased on novelbloodmale nudityviolence β¦threesomeinterviewmale frontal nuditymasturbationmale rear nuditybare chested malefemale rear nudityfightfemale full frontal nudityphotographsingingknifeleg spreadingthree word titlesurprise endingvoice over narrationfondlingbeatingdreamfistfightcar accidentpunched in the facecatarrestundressingbrawlsex in bedbare buttmaskrifleinterrogationhandcuffsbritishvoyeurreference to jesus christmale pubic haircriminalreportersubjective cameracleavagejournalistbound and gaggedwinegangdisguisemansionmontagethroat slittingbridgeprisonerpoliticianfemale pubic hairtied to a chairsnakewhite pantiesno opening creditsanti heroscantily clad femaledouble crosscontroversypublic nuditylibraryauthorblack pantiesbeaten to deathstabbed in the backlocker roomwidowerattackfantasy sequencecharacter's point of view camera shotstatueevil manknocked outkicked in the facelightningscreamattempted rapepranklong takemanipulationconvertiblebodyguardinjectionfemale removes her clothesneck breakingpremarital sexthreatened with a knifecult directortypewritersexual fantasyexperimentelectronic music scorereference to adolf hitlerhypodermic needleheavy raintape recordersociopathcomared dressloss of loved onesex on floorkicked in the stomachmovie theaterblockbustereccentricclassical musicclubirishrape victimmind controlrapistmilkstreet lifesocial commentarythugyogawoman in jeopardyreverse footageprison guardstealing a carministerhatredpool tabletitle appears in writingsculptureblack and white scenetime lapse photographypunched in the chestrivalgang rapeaccidental killingfascismrainstormalternate realityhomoeroticismfemale doctorcanesocial workerpublic humiliationgrowing uprelease from prisonsexual assaultjuvenile delinquentalienationpolice inspectorsports carmoral dilemmairreverencefast motion scenedrugged drinkhit with a baseball batclose up of eyespervertchocolatevillain played by lead actorface maskcrucifixionbrainwashingforced to stripspit in the facemisogynisteyebeggarmini dressreference to the beatlesgovernorweightliftinganarchynihilismstrait jacketcrashing through a windowimmaturityvolunteerrehabilitationaudio cassettebritainwhite briefsfight the systemanarchistexperiment gone wrongfamous scorewet t shirtfisticuffsancient romecureharempsychological torturegang membercockney accentimprovised weapongang leaderspaghettimurder of a nude womanprison wardenfamous linejerkbreaking a bottle over someone's headclimbing out a windowsocial decayattempted robberycrime spreerecord storefemale journalistred wineslow motion action scenereference to ludwig van beethovenlibertymarinacult figureflirtationfamily abandonmenthuman experimentationman fights a womandebaucheryvicarspiked drinkconcert hallsex crimedehumanizationabsurd violenceanti socialpopsiclesubliminal messagebreakfast in bedhoodlumslangreference to draculafemale psychiatristpixelationgrand theft autobeethovenmultiple loverspsychological tormentphalluscountry homebowler hatlasciviousnessfilm with ambiguous titlegovernment officialenglish countrysideinvented languagered pubic hairwaking up from a comapolitical manipulationhanged childextreme filmflick knifechild executioneye dropsyouth ganglong underwearclothes torn offshock therapywilliam tell overturecenturionjoyridegraphic nuditypet snakecat ladymanservantdriving in the wrong directionforced to watch rapeholding someone's head underwaterludwig van beethovenmilk bottleunprovoked violencehidden weaponsexual imagerynose bandagecensored rape scenetesticles squeezedwife raped in front of husbandclothes cut offerotic 70struncheonultraviolenceaversion therapybottle smashed over someone's headgang brawltorn pantieslistening to classical musicmoral reformationobjectified womanmen beating defenseless manreformed (See All) |
The first part of Kieslowski's trilogy on France's national motto: Liberty, Equality, and Fraternity. 'Blue' is the story of Julie who loses her husband, an acclaimed composer and her young daughter in a car accident. The film's theme of liberty is manifested in Julie's attempt to start life anew, f β¦ree of personal commitments, belongings, grief or love. She intends to numb herself by withdrawing from the world and living completely independently, anonymously and in solitude in the Parisian metropolis. Despite her intentions, people from her former and present life intrude with their own needs. However, the reality created by the people who need and care about her, a surprising discovery and the music around which the film revolves heal Julie and draws her back to the land of the living. (Read More)
Themes: | griefmemorylovesurrealisminfidelitymoneybetrayaladulterypregnancyfearfuneralextramarital affairangerunfaithfulnessphotography β¦traumadeath of daughter (See All) |
Mood: | rain |
Locations: | hospitalrestaurantswimming poolparis francerural settingapartmentcourtroomfrancestrip clubtunnel |
Characters: | nursehusband wife relationshipfather daughter relationshipmother daughter relationshipfrienddoctorprostitutefemale protagonistmusicianlawyerlittle girldaughterold friend |
Period: | 1990s |
Story: | attempted suicidemourningfatepianistaccidentsuicide attemptcolor in titlecar crashsexfemale nudityf ratednumber in titlefemale frontal nuditymasturbationdog β¦kisscigarette smokingphotographtelephone callcryingunderwearcar accidentmirrorwatching tvcatundressingsecretlietearsrunningcafeneighborpianotelevisionstripperreportersubjective cameraswimmingwinewidowjokejudgetrialcoffinold womannecklacecoffeepainspiritualityliarfirst of seriescharacter's point of view camera shotflowerscourtcrossdeath of husbandratgardencookmouseloss of loved oneaccidental deathlosscomposerservantclassical musicone night standpart of trilogyskateboardfollowing someonehitchhikerrealitypillskickingbroken glassmedical examinationfogthirty somethingalzheimer's diseasedressing roombeing followedflutestairwayestatepiano playinggardenertv reporterindependenceretirement homeknocking on a doorcoughingstreet fightlollipopbreaking a windownursing homesex clubillegitimate childtraffic accidentgarbage truckcircular staircasespoonneck bracemattressfetussecret loverecyclingcat and mousesheet musicwomen's bathroomlibertymusesecret lifetelling a jokehand on crotchpeep showsex showautomobile accidentold people's hometranscendencemobilesonogramwatchingflutistreflection in eyebungee jumpingtightrope walkerbeach ballyoung widowpole the personsugar cubesurgical stitchesthe color bluemusic conservatorystone wallhanging mobilemusical compositionmontparnassepigallemontpellier francecivil courthedge trimmerreunificationcar crash into treelocked out of apartmentreflection in an eye (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy |
Themes: | supernatural powerghostmurderdeathfriendshiprapepregnancyfearmonsterinvestigationpsychopathbrutalitydepressioninsanitysadism β¦eviltrauma (See All) |
Mood: | gorenightmareslasher |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | reference to godnursefather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killer β¦babyartistlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | seeing dead peoplemurder of a childdisfigurementback from the deadaccidentdinerambulancecar crashfalling from heightslow motion scenesequelsexfemale nudityf ratednudity β¦bloodviolencebare breastsflashbackbare chested malegunfemale rear nudityphotographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentwatching tvbare buttshootingplace name in titlebeddemonhallucinationgood versus evilfoot chaseflashlightdisguisestabbingdeath of friendimpalementweaponapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicniccelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubslaughterdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandagefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends β¦up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensesupernaturalparanormal phenomena |
Themes: | murderdeathsurrealismsuicidefearescapemonsterinvestigationdeceptionparanoiainsanityapocalypseself sacrificepolice brutalityghost town β¦end of mankind (See All) |
Mood: | neo noirnightmare |
Locations: | bicyclenew york citybarchurchhotelcarsmall townbuselevatormoteltunneltownnew england |
Characters: | homeless manpolicedoctorpolice officerwriterlawyerpsychiatristsecretaryself referentialinsurance agentevil monster |
Period: | 1990s |
Story: | disfigured faceinsane asylumdisfigurementfilm within a filmdinerambulancecar crashshot in the chestshot to deathbloodviolenceflashbackdogguncigarette smoking β¦title spoken by characterchasesurprise endingbeatingcorpseblood splattercar accidentshot in the headshotgunarrestpaintingbookriflebathroomdemonhallucinationhandcuffsreference to jesus christrevolvermanhattan new york citysubjective cameragood versus evilfoot chaseaxebridgeweaponnonlinear timelineanti herodrawinghit by a carcreaturenews reportattempted murdersmokingauthorcharacter repeating someone else's dialoguebeaten to deathpay phonecharacter's point of view camera shotmissing personlightningcrossbasementsuspicionmurderercinemasevered armcult directortypewriterdismembermentkillingriotpickup truckfireplacerevelationelectronic music scoregothicheavy rainlooking at oneself in a mirrormutantragetold in flashbackcrucifixmovie theaternosebleedfraudtorchend of the worldanimal attackschizophreniascamhitchhikingmental institutionmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormh.p. lovecraftaxe murdermutationasylumriding a bicycleshot multiple timesmedia coverageposteralleytributenovelhomagepublisherportaleditorconfessionaldouble barreled shotguncornfieldreceptionistfantasy worldstrait jacketsleeping in a carmanuscriptchapelpitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesmanic laughterblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgegoing in circleshorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
Themes: | supernatural powerghostmurderdeathfuneralmonsterpsychopathinsanitysadismevil |
Mood: | gorenightmareslasher |
Locations: | hospitalbarchurchcemeteryschool boy |
Characters: | nursefather daughter relationshipteenagermother daughter relationshipdoctorserial killertough guylittle girlsingle motherkillervillainterrorself mutilationslasher killeralcoholic father β¦serial murdererevil nurse (See All) |
Period: | 1980s |
Story: | drug overdosebreaking a mirrordisfigurementdead childfalling to deathback from the deadsuicide attemptfalling from heightslow motion scenesequelfemale nuditynumber in titleviolencebondagebare chested male β¦cigarette smokingsurprise endingfiredreamcorpsedigit in titleblood splatterthongbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperstabbingdeath of friendimpalementstabbed to deathstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youkillingundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimclockrampageswitchbladetrappedwindmutebutcherhypnosisstairsstabbed in the legschool uniformjumping through a windowknife fightfogstabbed in the eyebody countcharacters killed one by onekilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
Kevin Lomax, a ruthless young Florida attorney that never lost a case, is recruited by the most powerful law firm in the world. In spite of his mother's disagreement, which compares New York City to Babylon, he accepts the offer and the money that comes along. But soon, his wife starts feeling homes β¦ick as she witnesses devilish apparitions. However, Kevin is sinking in his new cases and pays less and less attention to his wife. His boss and mentor, John Milton, seems to always know how to overcome every problem and that just freaks Kevin right off. (Read More)
Subgenre: | cult filmallegory |
Themes: | devilgriefsupernatural powermurderdeathsuicidemarriagerapereligionmoneyfearartincestseductionanger β¦corruptionobsessionguiltinsanitymental illnessgreedpanicmythologymurder of familythe devil (See All) |
Mood: | goresatirebreaking the fourth wallambiguous ending |
Locations: | hospitalnew york citybarchurchsnownightclubelevatorwheelchairapartmentcitycourtroomusaslum |
Characters: | homeless manbiblereference to godnursehusband wife relationshipfather son relationshippolicemother son relationshipafrican americansingerteenage girlteacherstudentdancerphotographer β¦babypriestlawyerchristianjewishsingle motherchristianitylustteacher student relationshipcatholicchinese (See All) |
Period: | 1990swinter |
Story: | luciferreference to satanloss of wifenewspaper headlineslow motion scenefemale nuditybased on novelbloodmale nuditybare breastsfemale frontal nuditydoggun β¦sex scenefemale rear nudityfemale full frontal nuditycigarette smokingdancingphotographsingingpartyknifethree word titlesurprise endingpantiespistolcryingbeatingdreamcar accidentmirrorshot in the headwatching tvcomputerarrestsex in bedbare buttpaintingbookheld at gunpointtearsrunningbathroomdemonhallucinationvoyeurmanhattan new york cityalcoholreporternewspaperbracandlevideo camerathroat slittingboxingfemale pubic hairsubwaywhite pantiesjudgetrialscantily clad femaleanimalhit by a cartongueritualbartendergunshotpublic nudityblack pantiesmicrophonebeaten to deathbusinessmanringfemale removes her clotheswitnesspoweritalianoccultundergroundfireplacewoundstreetlawjoggingragecrying womanfloridalosstimeaudiencerape victimcrying mangoathomiciderealityambitionmoralitysexual desireremote controlattorneytoe suckingintriguespanishgunshot woundtime lapse photographysenatorpedophilepanties pulled downprideevidencebalconypassionate kissvoodooblack magicmarital problemmusic bandsindead dogpervertvillain played by lead actorethicstestimonymental breakdownmetaphorstreet markettemptationbrooklyn bridgekoreansouthern u.s.abandonmentsatanismjurylawsuitarenaglassquarrelbusiness cardboxing matchpressmuggingmurder suspectdocumentvanityacoustic guitargropingboxing ringchild molesterritesex with a minordoormantycoonantichristdeal with the devilholy waterblasphemysinistersex on the floorchurch servicepanic attackstreet vendorsubcultureglobebloody body of a childcourthousecity parkmuraltroubled marriageflamencometropolisoathspectatorlaw firmsatanalibicamel toegalaperjuryjudicial systemholy biblesex offendersatanistmorphingmuggerjudicialjudiciarywashroomit was all a dreamtouching someone's breastsimplied incestcasedemon rapefurybrother sister sexvirtualitychinatown manhattan new york citychequeseven deadly sinsprime suspectcoachingeliteelitismnotepadshredderkosherjury trialmale cryingdecoratingrecesscommitting suicidejinnpersonification of satanjustice departmentovarybilocationdagainesville floridalegal trialglandmuderwoman squeezing another woman's breast (See All) |
Dying of brain cancer, a dangerous international spy is determined to give up his high stakes life to finally build a closer relationship with his estranged wife and daughter, whom he's previously kept at arm's length to keep out of danger; but first, he must complete one last mission - even if it m β¦eans juggling the two toughest assignments yet: hunt down the world's most ruthless terrorist and look after his teenage daughter for the first time in ten years while his wife is out of town. (Read More)
Subgenre: | videomartial artsblack comedy |
Themes: | murderdeathkidnappingchristmaslesbianismtorturedeceptioncancerredemptionregret |
Mood: | neo noirhigh schoolcar chase |
Locations: | bicyclehospitalbarbeachhotelsnowparis francebusnightclubelevatorapartmentpolice stationstrip clubsinging in a car |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoohostagetough guyaction heroamerican abroadyounger version of charactertattoo artistfather daughter dance |
Story: | hit by a trainjugglingbreaking a mirrorsyringecar crashfalling from heightslow motion sceneshot in the chestshot to deathnumber in titlebloodviolenceflashbackfemale rear nudityfight β¦photographtitle spoken by characterexplosionpartyknifechasesurprise endingpistolcell phoneshootoutbeatingcorpsefistfightmachine guncar accidentshot in the headshotgunpunched in the facegunfightbrawlbare buttshowdownheld at gunpointhand to hand combatbombinterrogationcafehallucinationhandcuffsstrippershot in the backspyfoot chaseassassinbound and gaggedterroristdisguisemontagemixed martial artssubwayexploding caranti heroone man armyhit by a carfemme fataleshot in the legshot in the foreheadone against manybinocularsbeaten to deathelectrocutionpay phoneundercoverrace against timesuitcasekicked in the facechristmas treetough girlbodyguardinjectionwighigh school studentsplit screenchildbirthcharacter says i love yousecret agentsilencerespionageciasubtitled sceneterminal illnessuzisupermarketassassination attempthypodermic needlescene during opening creditsnosebleedvideotapedesperationfaked deathbirthrocket launcherfemale killergas maskduct tape over mouthstealing a carexplosiveaquariumamusement parkblood on shirtundercover agentbulletproof vestbody landing on a carlens flareriding a bicyclevodkafemale assassinshot through a windowcia agentaccountantpistol whipeiffel tower parislast will and testamentsubway stationarms dealerwatchfemale spyfacebookbody in a trunkteenage daughterbeach housepromshot in the foothappy birthday to youmerry go rounddance lessonsquatterone last jobstabbed in the footdrinking from the bottlecoming out of retirementsnorricamfather daughter estrangementtattoo parlorhigh school principalelectric torturealbinolimousine driverlimpingrape attemptcentral intelligence agencyhusband wife estrangementterminal cancerestranged wifebound with duct tapesmoke grenadeestranged daughterexperimental drugfirefightfight in the restroomlangley virginiadance partylocked in a car trunkopen air marketelevator crashbrain cancerout of ammunitionfalling on a carbelgrade serbiarun over by a traincar falling off a bridgeleather dressattempted gang rape (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to β¦ survive the night in Los Angeles. (Read More)
Subgenre: | suspensedystopiasurvival horror |
Themes: | near death experiencemurderdeathrevengekidnappingdeceptionpsychopathdeath of fatherbrutalitysurveillancehome invasionhomelessnessself sacrificehunting |
Mood: | goreslasherone night |
Locations: | hospitalmotorcyclelos angeles californiabusapartment |
Characters: | homeless manfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoohostagetough guywaitresssniperex husband ex wife relationshipsniper rifle |
Period: | 2020s |
Story: | film starts with textparking garageambulancecar crashslow motion sceneshot in the chestshot to deathsequelbloodviolencebare chested malephotographexplosionknifesurprise ending β¦pistolfirecell phoneshootoutcorpseblood splattermachine gunshot in the headshotgunrescuewritten by directorheld at gunpointsecond partrevolvershot in the backf wordsurvivalfoot chasegangambushaxemansionstabbed to deathstabbed in the chesttied to a chairsubwayexploding carno opening creditsanti herohit by a carnews reportshot in the legshot in the foreheadon the runlimousinecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotrace against timeshot in the shoulderdeath of sonlaptopneck breakingtrapdie hard scenariomercenaryshot in the armclass differencesak 47chainsawhand grenadesabotageburned alivemass murdermacheteshot in the stomachmasked manapartment buildinggas maskstealing a carresistanceshot in the faceassault rifleghettobooby trapone daybulletproof vestlens flareflamethrowersirengatling gunmedia coverageauctiontracking devicehit with a baseball batmolotov cocktailbag over headhiding in a closetarmored cararms dealerteenage daughterman punching a womanhanged mandeath of boyfriendcar set on fireshot in the throatresistance fighternight vision gogglesman with no namerunning out of gaspainted facemilitantgas grenademass deathlatin americansemi truckdune buggysororicidepirate broadcastingemergency broadcast systembody in a dumpsteryear 2023 (See All) |
After Iggy's long-time girlfriend is murdered and the whole town agrees he is the killer, he awakens one morning with horns and the townspeople soon confess their sins. Once knowing the sins of the people, he is facing the true killer of his beloved girlfriend.
Subgenre: | supernaturalmurder mysteryurban fantasy |
Themes: | near death experiencedevilsupernatural powermurderdeathlovefriendshiprevengeinfidelityrapereligionjealousydrunkennessinvestigationanger β¦death of mothercancerillnessevilalcoholismcrueltytraumapolice investigationmurder of a police officerdeath of daughterrape and murder (See All) |
Locations: | hospitalbarchurchforestcemeterysmall townwoodspolice carsex outsidesex in a carsex in chaircar on firesex outdoorssex in woods |
Characters: | reference to godbest friendnursefather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipdoctorbrother brother relationship β¦teenage girlteenage boygirlpolice officerpolicemanmusicianpriestlawyerlove trianglechristianlittle girlgay kisswaitressinterracial relationshipchristianityalcoholicchildhood friendyounger version of charactercheating girlfriendreligious fanaticdeath of girlfriendbetrayal by friend (See All) |
Story: | drug overdoseplaying pianodinerslow motion sceneshot in the chestshot to deathfemale nuditybased on novelbloodmale nudityviolenceone word titlebare breastsfemale frontal nudityflashback β¦male frontal nuditybare chested malesex scenefemale rear nudityfightcigarette smokinginterracial sexphotographtitle spoken by charactermale full frontal nudityexplosionfiretopless female nudityvoice over narrationcryingurinationblondeface slapshot in the headshotgunpunched in the facewatching tvundressingbrawlsecretletterliedead bodyhallucinationhandcuffsreference to jesus christprayerreportergay slurnewspaperjournalistcandlestabbingimpalementcocainestabbed in the chestsnakenonlinear timelineno opening creditsscantily clad femaleunderwater sceneshot in the legnecklacetransformationbartendergunshotconfessionattempted murderpublic nuditydrug addictcursevirginbeaten to deathprotestperson on firedollstatueringscarhairy chestcrosswitnesscharacter says i love youloss of motherredheadcheating wifearsonterminal illnesstopless womancloseted homosexualrockanswering machineburned aliveaddictionheavy raingay characterdrugfriendship between menlistening to musicgroup of friendstold in flashbackcaught having sexdemonstrationmagazinecrying womanvisitteddy bearfollowing someonecrying manpresumed deadpump action shotgunsevered fingerbreakupblood on faceconfrontationunfaithful wiferejectionbroken glassjunkietaking a picturepolice officer shotfirst kissdeath of protagonistaccidental killingfriendship between boyswedding ringsuspectgasolinemale male kissbarefoot femaleinjusticechainriding a bicycleframed for murderseattle washingtonengagement ringsinbeing followedmale objectificationblood on camera lensbarking dogtaking a photographporn magazinecartoon on tvoutcastmolotov cocktailstuffed animalplaying poolrepeated scenehead blown offdoubtdrunken manpiano playingloss of daughtertemptationmale in underwearoutsiderdouble barreled shotgunhospital roommasturbation reference13 year oldexhibitionistgramophonereceptionistbare chested boywormstreet fightbitten in the neckman punching a womantaking off shirthandcuffedtopless girlconscienceurinatingtrumpetmurder suspectsleeping in a carevil womancar set on firewatermelonmurder attemptmurder by gunshottreehousedance scenehiding placeriding a bikepitchforkseductive behaviormemorialrescue from drowningtaking off clothesundressing someonetraumatic experienceangstturkeydeath by gunshotburn victimsnake bitehouse on firepunch in faceimmolationdonutfinding a dead bodysex from behindcloseted gaymale male hugpointing a gun at someoneblasphemycrime of passionseductive womanwingsdrug triptitle spoken by narratorvinylman slaps womandaredrunken womanspoiled bratcrying malemoving outhysterical womandiscovering a dead bodyselfish womanhornlearning the truthburnreference to the rolling stoneshand injuryman hits womancharacter says i'm sorryvicarloss of girlfriendtalismanhysterical outburstdeath by shootingantiherotv crewbitten on the armbiblical referencesocial outcastblood on handscherrybreaking upspoiled childhomophobic slurmelonunfaithful girlfriendreference to david bowietrumpet playerpassed out drunkmorse codeoutburstsex at workfalse accusation of murderchildhood flashbackscreaming girlmurder disguised as suicideprivate investigationhit on the head with a rockmurder by shootingbitten in the facesleeping on the floorbrother brother conflictestranged motherupside down camera shotheavy smokerreference to nirvanahornstree houseasthma inhalerbanging head against wallsetting a fireterminally illgay coptalking about masturbationplush toymale female fightreference to jim morrisonangel wingssearch for truthgrieving fatherplaying trumpetspoiled girlbitten by a snakeadvocatepunch in stomachreference to the doorswingcrying for helpbrother brother fightgoodbye letterstabbed with a pitchforkdeath during sexfight between friendschristian fanaticgolf instructorattention seekerdelirium tremensoutdoors sexselfish motheramc gremlinchainletcherry bomb (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r β¦eason too. (Read More)
Subgenre: | cult filmtragedy |
Themes: | griefsupernatural powerghostmurderdeathsuicidefuneralmagicangerdeath of motherdeath of wife |
Mood: | gorenightmarenightdarkness |
Locations: | hospitalschoolchurchcarcemeteryairplanebathtubairportwoodsrural settingtrucknew england |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipzombiepriestlittle girllittle boysuicide by hangingfather in law son in law relationshipdeath of boy |
Period: | 1980s |
Story: | suicide notemurder of wifedead childloss of sonback from the deadloss of wifebased on novelbloodviolenceflashbackdogphotographexplosionsurprise endingfire β¦title directed by femaledreamcorpserescuepunched in the facewatching tvcatsecrettearsbedbathroomneighbortelephoneflashlightold mandeath of friendwomanweaponchildcoffinpantyhosepainconfessiongraveperson on firehangingdeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonmoonfemale stockinged legsburned alivegothicinjurylifting someone into the airhatloss of friendtoyhidingdead womanhitchhikingcamera shot of feetpromisepet dogresurrectionshovelpsychotronicdeath of sisterdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeupscalpelhit by a truckhead injuryloss of childkitenooseloss of sisterkiller childorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmaineswinginghouse firepet catdeath of loverglowing eyesevil childairlinerscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead songrave robbingkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |