Best popular movies like Wolf Creek 2:

Do you need specific genre & keyword selection to find films similar to Wolf Creek 2?
<< FIND THEM HERE! >>

Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek 2 (2013)

Subgenre:
psycho thrillerslasher flicksadistic horroraustralian horror
Themes:
murder of a police officerevilsadismbrutalitypsychopathtorturemurderdeath
Mood:
blood and goreslashercar chasegore
Locations:
australian outbackaustralia
Characters:
slasher killerserial murderergerman abroadsniper riflevillainserial killerboyfriend girlfriend relationship
Story:
female hitchhikerpsycho terrorpsycho killerhomicidal maniackilling spreekilling an animalevil manmarijuana jointsadistic torturesevered spineupside down camera shotreference to muhammad alicratersickoman punches a woman β€¦severed penismurder spreenational parkextreme violencecrime spreebutcheryhit with a hammercut into pieceskangaroobriton abroadcar set on firereference to albert einsteinsawfilm starts with texthit by a truckserial murderharmonicahuman monsterhead blown offpsychopathic killerblood on camera lensbad guymadmanbeheadingpervertcharacters killed one by onepsychoticsevered leglens flarebody countracistperversionpunched in the stomachshot in the facebutchersevered fingerrampagebroken leghitchhikerpsychowhat happened to epiloguetouristburned alivehead buttmaniacsubtitled scenekillingdismembermentsevered armhorse ridingcountrysideattempted rapeskeletontentperson on firecharacter repeating someone else's dialoguestabbed in the backhit by a carsevered headexploding cartied to a chairthroat slittingimpalementgay slurdecapitationshot in the backmarijuanadead bodycar crashwritten by directorpunched in the faceshot in the headblood splattershot to deathcorpseknifepartysingingbare chested malesequelviolencedog (See All)

Wolf Creek (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β€¦are after the backpackers find a way to escape. (Read More)

Subgenre:
slasher flicksadistic horroraustralian horrorindependent filmcult filmsuspense
Themes:
evilsadismbrutalitypsychopathtorturemurderdeathkidnappingrapedrinkingfeardrunkennessescapeinsanityabduction β€¦exploitationcruelty (See All)
Mood:
blood and goreslashercar chasegorenightdarkness
Locations:
australian outbackaustraliabarbeachrestaurantswimming poolcarhelicopterairplanedesertroad triptruckcavegas stationcampfire β€¦road moviecar on fireshed (See All)
Characters:
slasher killerserial murderervillainserial killerhusband wife relationshipdoctorsingerhostagekilleraustralianterrorself mutilationmysterious villainmysterious killer
Period:
year 1999
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil mansevered spinecratersickomurder spreeextreme violencebutcherykangaroobriton abroadcar set on firefilm starts with text β€¦serial murderhuman monsterpsychopathic killerbad guymadmanpervertcharacters killed one by onebody countperversionbutchersevered fingerrampagepsychotouristmaniackillingdismembermentcountrysideattempted rapetentstabbed in the backimpalementgay slurshot in the backdead bodyshot in the headblood splattershot to deathcorpseknifepartysingingviolencedogbloodtwo word titlegunkisscigarette smokingphotographtitle spoken by characterexplosionchasebased on true storysongcar accidentmirrorshot in the chesturinationshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglasseslow budget filmcafebathroomvoyeurguitarf wordswimmingflashlightbound and gaggedmassacrevideo camerastabbingstabbed to deathfalse accusationcontroversyvanpainflash forwardattempted murderdangerprologueumbrellaon the roadstorytellingpursuittragic eventautomobileisolationpigmurdererfirst partobscene finger gestureufogaragepickup truckwolfwoundscene during opening creditsmutilationloss of friendcaptivedesperationflatulencestrangervictimhome movierapisthomiciderednecksufferingmercilessnessgunshot woundbroken glassfallblood on shirtrainstormslaughtercapturecliffminetied feetopening a doorsexual assaultbloodbathdrugged drinkreflectionbarking dogcar troublemysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceslashingplaying guitarmind gamenihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagonmeteorcamcorderfilling stationgraphic violenceoverturning carcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathcar rollovermass murdererdriving at nightvillain not really dead clichedisturbed individualgrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpvolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outspree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Henry: Portrait Of A Serial Killer (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β€¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
psycho thrillerindependent filmcult filmamerican horrorindependent horror
Themes:
evilbrutalitypsychopathtorturemurderdeathdrugsrapeincestinsanityexploitationmurder of family
Mood:
slashergore
Locations:
chicago illinois
Characters:
slasher killerserial murderervillainserial killerbrother sister relationshipprostitutekillerterrormysterious villainmurder of a prostitute
Period:
1980s
Story:
female hitchhikerpsycho terrorpsycho killerhomicidal maniackilling spreeevil mansickomurder spreeextreme violencecrime spreebutcherycut into piecesserial murderhuman monsterpsychopathic killer β€¦bad guymadmanpervertbody countperversionbutcherrampagepsychomaniackillingdismembermentattempted rapesevered headdecapitationmarijuanablood splattershot to deathviolencefemale nuditycharacter name in titlenuditybloodbare breastsgunsurprise endingshot in the chestlow budget filmcriminalbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusecontroversypantyhosestalkerstalkingneck breakingsplatterfemale stockinged legsragemutilationstabbed in the stomachrapistlow budgetdark humorpsychotronicmurder of a childslaughterstabbed in the eyeabusive fathervillain played by lead actormysterious mankillsexual violenceslashingnaked dead womanvideo footagematricideknife murdersadistic psychopathoff screen murderchild rapemurder of a nude womanbroken neckdisturbed individualgrindhouse filmexploitation filmcreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticmurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
psycho thrillersadistic horrorcult filmbody horroramerican horrorindependent horror
Themes:
evilsadismbrutalitypsychopathtorturedeathmurdersupernatural powerinsanity
Mood:
blood and goreslashergorebreaking the fourth wall
Locations:
hospitalsex in showersex in a bathroom
Characters:
slasher killerserial murderervillainserial killerbrother sister relationshipteenage girlteenage boykillerterrormysterious villainmysterious killer
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manmurder spreeextreme violencecrime spreebutcheryserial murderhuman monsterpsychopathic killerbad guymadmancharacters killed one by one β€¦body countbutcherrampagepsychomaniackillingstabbed in the backsevered headimpalementdecapitationblood splattercorpsesequelviolencesexfemale nuditynumber in titlebloodmale nuditybare breastsfemale frontal nuditymasturbationmale rear nudityfemale rear nuditysurprise endingpantiesunderwearmasklow budget filmsubjective camerastrangulationstabbed to deathchild in perillooking at the cameraskinny dippingcharacter's point of view camera shotstalkingpremarital sexmurderercabinloss of motherobscene finger gesturesexual attractionlifting someone into the airragemutilationmorguefourth partgrindhousetowelback from the deadmasked manrednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carmasked killercar troublemysterious manstabbed in the handkillsummer campslashingshot in the eyehillbillymeat cleavernaked dead womangraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanvillain not really dead clichedisturbed individualgrindhouse filmdeeply disturbed persondisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All)

Jason Lives: Friday The 13th Part Vi (1986) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
psycho thrillerslasher flickcult filmsupernaturalparanormal phenomenateen horroramerican horror
Themes:
murder of a police officerevilpsychopathdeathmurderprisonmonstersupernatural powerinsanity
Mood:
slashercar chasegoredarknessbreaking the fourth wall
Locations:
forestcemeterysmall townboatwoodslakeamerica
Characters:
slasher killerserial murderervillainserial killerpoliceteenagerzombiekillersheriffterror
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manmurder spreebutcherycut into piecesserial murderpsychopathic killerbad guymadmanbeheadingsevered legbody count β€¦butcherrampagepsychomaniackillingdismembermentsevered armsevered headdecapitationblood splatterviolencesequelsexcharacter name in titlenumber in titleflashbacksurprise endingmasknumbered sequeldemonflashlightmassacreambulancestabbingstabbed to deathchildlooking at the cameradrowningelectrocutionstalkingneck breakingmurdererunderwaterundeadblood spattersplattermass murdergothicmachetelifting someone into the airmutilationvictimback from the deadmasked mannew jerseyshovelstabbed in the headslaughtersequel to cult favoritebloodbathmasked killerkillsummer campslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclebloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdervillain not really dead clicheghoulpaintballhead ripped offreturning character with different actorreanimationstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
psycho thrillerslasher flicktragedyamerican horror
Themes:
murder of a police officerevilsadismbrutalitypsychopathtorturedeathmurdersuicidekidnappingrapedysfunctional familyinsanityhome invasionpolice investigation β€¦mysterious death (See All)
Mood:
blood and goreslashergoredarkness
Locations:
small townstrip club
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipteenagerafrican americanboyhostagekillerpsychiatristsheriffterror
Period:
1970s
Story:
psycho terrorpsycho killerkilling spreekilling an animalevil mansickomurder spreeextreme violencecrime spreebutcheryserial murderhuman monsterpsychopathic killerbad guymadman β€¦pervertcharacters killed one by onepsychoticbody countperversionshot in the facebutcherrampagebroken legpsychomaniackillingstabbed in the backthroat slittingimpalementshot in the backdead bodyshot in the headblood splattercorpseknifeviolencesexfemale nuditybloodmale nudityfemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterchasepistolwoman on topbeatingremakefalling from heightmasktelevisionstripperf wordsubjective camerastrangulationmassacrestabbingstabbed to deathstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathattackuniformcharacter's point of view camera shotbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanityteenage sexblood spattersplatterelectronic music scoremass murderlifting someone into the airrageloss of friendpsychologistvictimhome moviemasked mancrime scenetensionmanhuntmental hospitalheadphonesmurder of a childdark pastbroken armduct tapepumpkinbloodbathswearingmasked killerhit with a baseball batmexican americanporn magazinedead animaltrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitaldisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathdying during sexanimal killingmass murderervillain not really dead clichejack o'lanterndying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidemidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesataniccontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
sadistic horrorindependent filmsuspenseb movieb horrorindependent horrorpsychological horrorfrench horrorhorror b movie
Themes:
evilsadismbrutalitypsychopathtorturedeathmurderfriendshipsurrealismkidnappingrapefeardeath of fatherdeath of motherinsanity β€¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
blood and goreslashercar chasegorenightmarenightdarkness
Locations:
hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
slasher killerserial murderervillainserial killerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girl β€¦female protagoniststudentbest friendkillerterrorfrenchbest friendsmysterious villainmysterious killerdeath of boy (See All)
Story:
psycho killerhomicidal maniackilling spreekilling an animalevil mansickomurder spreeextreme violencecrime spreebutcherycut into piecesserial murderhuman monsterpsychopathic killerblood on camera lens β€¦bad guymadmanpervertcharacters killed one by onebody countperversionbutcherrampagepsychomaniackillingsevered headthroat slittingimpalementdecapitationshot in the backdead bodycar crashshot in the headblood splattercorpseknifedogviolencefemale nudityf ratedbloodbare breastsfemale frontal nudityflashbackmasturbationguncigarette smokingphotographlesbian kisschasesurprise endingshowertelephone calldreamcar accidentmirrorurinationshotgunslow motion sceneshootingriflesunglassesbedlow budget filmbathroomneighborvoyeurtelephonesubjective camerasurvivalflashlightbound and gaggedaxemassacrestabbingstabbed in the chesthousescantily clad femalevanon the rundolldeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropeblood spattersplatterchild murderchainsawfireplacemass murderlistening to musicsurvivormutilationstabbed in the stomachsevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistmurder of a childslaughterswingclassmateaxe murdersexual assaultparrotdead dogbeing followedsuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a dogfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanmurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetlesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathvineyardchainsdriving at nightdisturbed individualgrindhouse filmbludgeoningwalkmanexploitation filmstraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violenceaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
psycho thrillerslasher flickindependent filmcult filmsuspensesupernaturalparanormal phenomenaamerican horrorcanadian horror
Themes:
evilbrutalitypsychopathtorturedeathmurderrevengesuicidekidnappingghostfeardrunkennessdeath of fathersupernatural powerdeath of mother β€¦insanityabductiontraumafear of water (See All)
Mood:
blood and goreslashergorerainhigh schoolnightmarebreaking the fourth wall
Locations:
forestcemeterysmall townpolice stationlakeschool nurse
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenage girlteenage boyzombielittle girlkillersheriffterror β€¦mysterious villain (See All)
Period:
2000s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manmurder spreebutcheryserial murderpsychopathic killerblood on camera lensbad guymadmanbeheadingcharacters killed one by onebody count β€¦butchersevered fingerrampagepsychoburned alivemaniackillingdismembermentsevered armperson on firecharacter repeating someone else's dialoguesevered headimpalementdecapitationcar crashblood splattercorpsepartyviolencesequelcharacter name in titlebloodflashbackphotographexplosionsurprise endingpistolshowerfirevoice over narrationdreamslow motion scenebrawlfalling from heightmaskdemonfoot chasestabbingdream sequencechild in perilunderwater scenevandrowningskinny dippinglibraryvirginprologueelectrocutioncharacter's point of view camera shotcover updeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinundeadsplatterchild murderheroinemass murdermachetelifting someone into the aircomaragemutilationsevered handvictimgoatcrushed to deathmasked mannew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterdemonic possessiongeekburned to deathmasked killernewspaper clippingtorso cut in halfmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencestonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormass murderervillain not really dead clicheghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partmidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hills Have Eyes (2006) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes (2006)

While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β€¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)

Subgenre:
psycho thrillertragedy
Themes:
evilsadismbrutalitypsychopathtorturedeathmurderrevengesuicidekidnappingrapedeath of fatherdeath of motherdeath of wifecannibalism β€¦self sacrificemadnessmurder of familyghost town (See All)
Mood:
slashergorehorror movie remake
Locations:
desertcavegas stationsuv
Characters:
villainserial killerfamily relationshipsbrother sister relationshipteenage girlteenage boybabykillerterror
Period:
year 2006
Story:
homicidal maniackilling spreekilling an animalevil mansevered spineextreme violencecut into piecesserial murderhuman monsterhead blown offpsychopathic killerbad guymadmansevered legbody count β€¦severed fingerrampageburned alivemaniackillingdismembermentsevered armperson on firestabbed in the backsevered headexploding carimpalementcar crashshot in the headblood splatterdogviolencebloodsurprise endingpistolcar accidentshot in the chestshotgunfalling from heightrevolverfoot chaseaxestabbed in the chestcontroversyshot in the foreheadvacationbaseball batamerican flagglassesmurdererfirst partsplatterclaim in titlemutantragemutilationwalkie talkievictimrapisthomicidestabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailermineaxe murdermutationdeath of loved onemannequinhysteriacrucifixionex copkilldead animalkilling a doggerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyminersiblinggraphic violencestabbed in the facebloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallradioactive fallout (See All)

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β€¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
psycho thrillercult filmsuspenseb horroramerican horrorindependent horror
Themes:
evilbrutalitypsychopathmurderdeathfearinsanityexploitation
Mood:
slashergoredarkness
Locations:
woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipteenagerkillerterrormysterious villainmysterious killer
Period:
1980ssummeryear 1984
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil mansickomurder spreecrime spreebutcheryserial murderhuman monsterpsychopathic killerbad guymadmancharacters killed one by one β€¦psychoticbody countlens flarebutcherrampagepsychomaniackillingsevered headthroat slittingimpalementdecapitationdead bodyblood splattercorpseviolencesequelsexfemale nuditynumber in titlebloodfemale frontal nudityflashbackkissfightnipplessurprise endingpantiestelephone calldigit in titleblondeslow motion scenecatbikinimasksecond partnumbered sequelsubjective cameraswimmingbrastrangulationmassacrejokecontroversyskinny dippingstalkerprologuecharacter's point of view camera shotopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexsplatterchesschainsawfireplacespearnipples visible through clothingmass murdergothicmachetelifting someone into the airragemutilationvillainessphone boothgrindhousevictimmasked manredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headslaughterbetrefrigeratormasked killernude swimmingcar troublemysterious manreturning character killed offsummer campfreakskirtsexual violenceslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womandying during sexvillain not really dead clichegrindhouse filmcreepkilled during sexmystery killershackmultiple homicideweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadelost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β€¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
psycho thrillerindependent filmcult filmamerican horror
Themes:
evilsadismbrutalitypsychopathmurderdeathrevengefearinsanityexploitationpolice investigation
Mood:
slashergorerainnightmarenightdarkness
Locations:
cemeterysmall townwoodsamericabackwoods
Characters:
slasher killerserial murderervillainserial killerpolicemother son relationshipteenagerbrother brother relationshipkillersheriffterrormysterious villainmysterious killercountry boy
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manmurder spreeextreme violencecrime spreebutcherycut into piecesserial murderhuman monsterpsychopathic killerbad guymadman β€¦characters killed one by onepsychoticbody countbutcherrampagepsychomaniackillingthroat slittingimpalementdecapitationdead bodyblood splattersequelviolencesexfemale nuditynumber in titlebloodbare breastsfemale frontal nuditykissdancingchasesurprise endingpantiesdigit in titlelow budget filmnumbered sequelsubjective camerasword fightaxemassacrechild in perilgravestalkercharacter's point of view camera shotdeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachgrindhousevictimmasked manmental institutionrednecknew jerseyitalian americanpsychotroniceye gougingslaughterstabbed in the eyeaxe murderfifth partsequel to cult favoritemasked killercar troublemysterious manlaundrydefecationsummer campcomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headgraphic violenceorchestral music scorestabbed in the facemasked villainknife murderbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womandisturbed individualgrindhouse filmdeath of grandfatherreturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicideweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β€¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
psycho thrillerindependent filmcult filmblack comedysupernaturaldark comedyparanormalamerican horrorindependent horror
Themes:
evilsadismpsychopathtorturemurderdeathsurrealismdrugsghostsupernatural powerdeath of motherinsanityamnesia
Mood:
slashergorerainhigh schoolnightmaredarkness
Locations:
small townairplaneroad trip
Characters:
slasher killerserial murderervillainserial killerfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherkillerterrorself mutilationyounger version of characterdeafnessgerman american β€¦evil father (See All)
Period:
1990s1970s1960s1940s1950s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreekilling an animalevil manmarijuana jointman punches a womanmurder spreebutcheryserial murderhuman monsterpsychopathic killerbad guymadman β€¦psychoticbody countbutchersevered fingerrampagepsychohead buttburned alivemaniackillingcharacter repeating someone else's dialogueimpalementblood splatterknifebare chested maleviolencesequelf ratedcharacter name in titlebloodflashbacktitle spoken by characterfirepunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legbeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodymurdererundeadchild murderfalling down stairsgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothvictimorphanagerapistback from the deadcameocrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fathernewspaper clippingposterhit with a baseball batvillain played by lead actorstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathanimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedmidwestbroken handchild killerrepressed memorycreepywater towerchild murdereradopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

The Hills Have Eyes 2 (2007) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes 2 (2007)

A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β€¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)

Themes:
evilpsychopathtorturemurderdeathrevengesuiciderapeinsanitycannibalismrape and revenge
Mood:
slashergore
Locations:
desertwaternew mexico
Characters:
slasher killervillainserial killerterror
Period:
year 2007
Story:
psycho killerhomicidal maniackilling spreeevil mansadistic torturesickoextreme violenceserial murderhuman monsterpsychopathic killerblood on camera lensbad guymadmanbody countsevered finger β€¦rampagebroken legpsychomaniacdismembermentsevered armstabbed in the backimpalementgay slurshot in the headblood splattershot to deathcorpsesequelfemale nuditynuditybare breastsfightexplosionsurprise endingpistolfirelickingshot in the chestremakefalling from heightriflenumbered sequelf wordgood versus evilsurvivalstabbingarmystabbed to deathstabbed in the chesttrainingbeaten to deathkicked in the faceshot in the shouldertragic eventexploding bodysplatterropeclaim in titlemutantrageassaultaccidental deathguardhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingmineaxe murdernude woman murderedtorso cut in halffemale soldierintestinesgiving birthstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathgraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysadistic psychopathpsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakelong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
psycho thrillerslasher flickindependent filmcult filmparanormal phenomenateen horroramerican horror
Themes:
murder of a police officerevilpsychopathdeathmurderrevengemonstersupernatural powerdrug addiction
Mood:
slashergorerainhigh school
Locations:
new york cityboatwoodsseacityamericasewer
Characters:
slasher killerserial murderervillainserial killerteenage girlteenage boyzombiepolice officerkillerteacher student relationshipterrormysterious villain
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniacevil manmurder spreebutcheryserial murderpsychopathic killerbad guymadmanbeheadingcharacters killed one by onebody countbutcherrampage β€¦psychomaniacattempted rapeexploding carthroat slittingimpalementdecapitationblood splatterbare chested malesequelviolencefemale nuditycharacter name in titlenumber in titlebloodexplosionpantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york cityflashlightgangnew yorkstrangulationaxevideo camerastabbingstabbed to deathsubwaywhite pantiesnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotunderwaterundeadhypodermic needlelifting someone into the airmutilationback from the deadmasked manmale underwearnew jerseyblack bradead childdisembowelmentslaughterstabbed in the eyesequel to cult favoritemasked killersummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Devil's Rejects (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β€¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
psycho thrillersadistic horrorindependent filmcult filmblack comedy
Themes:
murder of a police officerevilsadismbrutalitypsychopathtorturedeathmurderfriendshiprevengesuicidekidnappingrapebetrayalfear β€¦escapedeceptionseductionangerdeath of fatherdeath of motherparanoiainsanityhumiliationexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessnear death experiencemurder of family (See All)
Mood:
gorenightmareambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
villainserial killerboyfriend girlfriend relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officer β€¦nursehostagetough guymaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
homicidal maniackilling spreeevil manmarijuana jointman punches a womanmurder spreecrime spreebutcheryfilm starts with texthit by a truckserial murderhuman monsterpsychopathic killerbad guymadman β€¦pervertsevered legbody countbutcherrampagehead buttmaniacattempted rapestabbed in the backtied to a chairthroat slittingimpalementgay slurshot in the backmarijuanadead bodywritten by directorpunched in the faceshot in the headblood splattershot to deathcorpseknifebare chested maledogviolencesequelbloodflashbackmale rear nuditysex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionchasepantiespistolshowerfireshootoutwoman on topbeatingdreammachine gunhorseshot in the chestface slapshotgunrescueslow motion scenearrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partlow budget filminterrogationjailhandcuffsrevolvercriminalf wordsurvivalfoot chasebound and gaggedambushstrangulationaxedeath of frienddrug dealercocainestabbed to deathstabbed in the chestfemale pubic hairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathscreamingclownelectrocutionpay phonefugitiveknocked outopening action scenefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultdeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynistsexual violencestandoffvulgarityfemale psychopathtrailer homedeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemass murderergrindhouse filmevil clownbilingualisminnocent person killedreturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armortrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
psycho thrillerslasher flickindependent filmcult filmsuspenseteen moviemurder mysteryteen horroramerican horror
Themes:
evilsadismbrutalitypsychopathmurderdeathrevengefearvoyeurismcorruptioninsanityhumiliationcrueltytraumamysterious death
Mood:
blood and goreslashergorenightdarkness
Locations:
carmotorcycleboatwaterwoodsrural settingpolice carlaketruck
Characters:
slasher killerserial murderervillainserial killerpoliceteenagerfriendteenage boypolice officerpolicemanartistkillermothersheriffterror β€¦truck drivermysterious villain (See All)
Period:
1970s1950ssummer
Story:
psycho terrorpsycho killerhomicidal maniackilling spreemurder spreeextreme violencecrime spreebutcheryserial murderhuman monsterpsychopathic killerbeheadingcharacters killed one by onepsychoticlens flare β€¦body countperversionbutcherrampagepsychomaniackillingthroat slittingdecapitationmarijuanadead bodyblood splattercorpsebare chested maleviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditykissfemale rear nuditynipplesthree word titlesurprise endingpantiesbeatingdigit in titlefistfightblondeslow motion scenebikinithongbeerrunninglow budget filmhallucinationvoyeurguitarsubjective camerabedroombracandleold manaxemassacrestabbingwomanstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitgrindhousevictimdead womanfull moonbra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutepsychotroniclostthunderstormbathingdisembowelmentsurpriseatticdead manslaughteraxe murderroomarrowdeath of loved onetank topphysical abuset shirtjoysexual awakeningcar troublemysterious manshortsdead animalsummer campcanoeadolescencerepressionsexual perversionrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanfamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdervillain not really dead clichegrindhouse filmmurder victimcurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

The People Under The Stairs (1991) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β€¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
psycho thrillerindependent filmcult filmblack comedydark comedysurvival horroramerican horror
Themes:
evilsadismpsychopathdeathmurderkidnappingdeceptionincestinsanitymental illnesshome invasiongreedcannibalismwealthstarvation β€¦claustrophobia (See All)
Mood:
slashergoresatiredarknesssocial satire
Locations:
los angeles californiaslum
Characters:
villainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipterrorkiller dog
Period:
1990s
Story:
psycho terrorpsycho killerhomicidal maniackilling an animalevil mansickomurder spreeserial murderhuman monsterpsychopathic killerbad guymadmanpervertbody countperversion β€¦severed fingerrampagepsychomaniacskeletoncharacter repeating someone else's dialogueimpalementblood splattershot to deathcorpseknifedogviolencebloodcigarette smokingtitle spoken by characterpistolshot in the chestface slapshotgunbirthdayflashlightmansionhousechild abusechild in perilvanracial slursuburbelectrocutiondolldeath of childbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacebreaking and enteringgothicscene during opening creditsragemutilationstabbed in the stomachspidersevered handgrindhouseskullsadomasochismmasked manstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticmurder of a childsouldead boycellarlasersightlandlordgothhiding in a closetold dark houseschemeevictionlighterfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathdisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodyabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Collector (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β€¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
sadistic horrorindependent filmsuspenseamerican horrorindependent horrorslasher horrorhorror b movie
Themes:
murder of a police officerevilsadismbrutalitypsychopathtorturemurderdeathescapeinsanityhome invasionexploitationcruelty
Mood:
blood and goreslashergorenight
Locations:
strip clubtrying to escape
Characters:
villainserial killerhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlhostagethiefkillerterrorself mutilationtalking to oneself in a mirrormysterious villainthe family β€¦mysterious killerkiller dogdirector of photography (See All)
Story:
psycho killerhomicidal maniackilling an animalevil manmurder spreecrime spreebutcherycut into piecesserial murderhuman monsterpsychopathic killerblood on camera lensbad guycharacters killed one by onepsychotic β€¦body countperversionbutchersevered fingerrampagepsychomaniachit by a cartied to a chairimpalementgay slurdead bodycar crashpunched in the faceblood splattercorpseknifeviolencefemale nuditycharacter name in titlebloodbare breastsfemale frontal nudityflashbacktwo word titlefightcigarette smokingnippleslesbian kisssurprise endingpistolbeatingmirrorshotgunslow motion sceneshowdownheld at gunpointhandcuffsgood versus evilsurvivalfoot chaseflashlightstabbingstabbed to deathstabbed in the chesthousescantily clad femalechild in perildangerscreamingelectrocutiondebtscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairslooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten alivewoman in jeopardyburglartrappedmobile phoneburglarymercilessnessgash in the facepsychotronicescape attemptscissorsscene after end creditsdisembowelmenttitle at the endslaughterknife throwinggasolinestabbed in the eyeboxbloodbathmasked killerdead dogfemale female kissinterrupted sexintestinesbarbed wiremysterious manwifestabbed in the handset upconstruction workerpistol whiplightervery little dialogueacidclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickjewelsadistic psychopathpsychotronic filmcut handhouse on firedragging a bodyviolent deathgrindhouse filmex wifeexploitation filmcaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

Friday The 13th Part III (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  β€¦friends. (Read More)

Subgenre:
slasher flickcult filmamerican horror
Themes:
psychopathmurderdeathabductionexploitation
Mood:
slashergoredarkness
Locations:
lake
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipteenagerteenage girlteenage boykillerterrorlow self esteemmysterious killer
Period:
1980s
Story:
psycho killerhomicidal maniackilling spreeevil manmurder spreeextreme violencecrime spreeserial murderhuman monsterpsychopathic killerbad guymadmancharacters killed one by onerampagepsycho β€¦maniacdismembermentsevered armimpalementpartysequelsexnuditynumber in titlebloodshowerdigit in titlebikinimasknumbered sequelsubjective cameraaxethird partcharacter's point of view camera shotmurderercabinsplattermass murdermachetelifting someone into the airragebarnroman numeral in titlesevered handgrindhousemasked manstupiditynew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyesequel to cult favoritemasked killertorso cut in halfcar troubledefecationsexual violenceslashingshot in the eyehillbillyeyeballhammockfamous scoremasked villainknittingpitchforksole survivordeformitysadistic psychopathpsychotronic filmbiker gangmass murdererdisturbed individualgrindhouse filmlifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

Halloween II (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (2009)

Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off  β€¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)

Themes:
murder of a police officerevilbrutalitypsychopathdeathsuicideghostdrunkennessinsanityexploitationhomelessnessdeath of daughter
Mood:
slashergorerainnightmaredarkness
Locations:
hospitalhelicopterstrip club
Characters:
sniper rifleserial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristcoroner
Story:
homicidal maniackilling spreekilling an animalevil manextreme violencecrime spreefilm starts with textserial murderhuman monsterpsychopathic killerbad guybeheadingcharacters killed one by onebody countrampage β€¦maniacstabbed in the backhit by a carexploding carthroat slittingimpalementdecapitationcar crashblood splattercorpsepartysingingsequelviolencefemale nuditynumber in titlebloodfemale frontal nudityinterviewflashbackfemale rear nuditychasepistolbeatingdreamcar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcafehallucinationstripperf wordhalloweenflashlightbandstrangulationstabbingdeath of friendstabbed to deathstabbed in the chestlatex glovesflash forwardstalkermicrophoneportraitclownattackhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzasurgerywoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthcorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murderswearinghalloween partymusic bandhit with a baseball batinterrupted sexgroupg stringreturning character killed offmedical masksurgical masksexual violenceslashingdental maskhead bashed inassistantstrong languagebody baghanged manhead cut offcountry housegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanternreturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloweenviii: Resurrection (2002) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β€¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
slasher flickindependent filmcult filmteen horroramerican horror
Themes:
murder of a police officerevilpsychopathmurderdeathrevengefeardeceptionsurveillance
Mood:
slashergoresatire
Locations:
forestwoodskitchenwheelchairrooftopfire truck
Characters:
slasher killervillainserial killerteenage girlteenage boynursekillersecurity guardpsychiatristcoroner
Period:
2000s
Story:
homicidal maniackilling spreeevil mancrime spreeserial murderhuman monsterpsychopathic killerbad guycharacters killed one by onebody countrampagebroken legmaniackillingsevered arm β€¦skeletonstabbed in the backsevered headthroat slittingimpalementdecapitationblood splattercorpseknifeviolencesequelfemale nuditybloodflashbacktwo word titlefightchasesurprise endingfirecell phonefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameragood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagestabbed to deathstabbed in the chestinternetpolice officer killednews reportelectrocutioncharacter's point of view camera shotproduct placementkicked in the facecollege studentlightningdisappearanceneck breakingmurdererthreatened with a knifeobscene finger gesturechainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatemasked manmental institutionstabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexsequel to cult favoritemasked killernewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetold dark houseabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

The Texas Chain Saw Massacre (1974)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β€¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
psycho thrillerslasher flickindependent filmcult filmblack comedysuspensetragedysurvival horrorteen horroramerican horrorindependent horror
Themes:
evilsadismbrutalitypsychopathtorturedeathmurderfriendshipkidnappingfearescapeparanoiadysfunctional familyinsanityexploitation β€¦paniccannibalisminheritancemadnessnear death experience (See All)
Mood:
slasheravant gardedarknessambiguous ending
Locations:
carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipfamily relationshipsteenagerbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostagekillerterrorself mutilation β€¦truck driverself inflicted injury (See All)
Period:
1970syear 1973
Story:
homicidal maniackilling spreeevil mansickomurder spreebutcheryhit with a hammersawfilm starts with texthit by a truckserial murderhuman monsterpsychopathic killerbad guymadman β€¦characters killed one by onebody countlens flarebutcherrampagehitchhikerpsychomaniackillingcountrysideskeletontied to a chairimpalementdecapitationwritten by directorblood splattercorpseknifeviolencebloodphotographchasesurprise endingvoice over narrationbeatingurinationblondecamerafalling from heightvomitingsunglassesrunninglow budget filmcollegesurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendstabbed in the chestdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementknocked outscardeath of brotherhairy chesttragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowsplatterfreeze framepickup truckchainsawropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodgrindhousevictimproduced by directorskullhitchhikingmasked manfull moonredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutepsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelaughingtank toploss of brotherbloodbathmasked killersouthern accentclose up of eyescar troublehysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditsmeatestatetexanabandoned housefarmhouseanimal crueltyslashingcar washhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencesole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airgrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

Halloween H20: 20 Years Later (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β€¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
psycho thrillerslasher flickindependent filmcult filmteen horroramerican horror
Themes:
evilpsychopathmurderdeathdrugsparanoiainsanityabductionalcoholism
Mood:
slasherhigh schoolnightmare
Locations:
schoolsmall townelevatorkitchentruck
Characters:
slasher killervillainserial killerboyfriend girlfriend relationshipfamily relationshipspolicemother son relationshipteenagerbrother sister relationshipteenage girlteenage boygirlnursepolicemansecurity guard β€¦alcoholicsecretaryterrormysterious villain (See All)
Period:
1990syear 1998
Story:
psycho terrorpsycho killerhomicidal maniacevil manmurder spreeserial murderpsychopathic killerbad guymadmanbeheadingcharacters killed one by onebody countrampagepsychomaniac β€¦stabbed in the backsevered headthroat slittingdecapitationdead bodyknifesequelviolencenumber in titlebloodchasepistolcar accidentfalling from heightmaskbirthdayneighborhallucinationtelephonesubjective cameragood versus evilhalloweenflashlightwinecandlecaliforniaaxeambulancestabbingdeath of friendstabbed to deathtoiletstabbed in the chestweaponattempted murderstalkerprologuekeyuniformcharacter's point of view camera shotmistaken identityactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingvictimfaked deathmasked mantrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinmasked killernewspaper clippinghockeyreflectionstolen caranniversarycar troublemysterious manfire extinguisherreturning character killed offhiding in a closetgateslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathvillain not really dead clichesittingseventh partmichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (2009)

A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β€¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)

Subgenre:
psycho thrillerslasher flick
Themes:
murder of a police officerevilbrutalitypsychopathtorturedeathmurderrevengedrunkennessdeath of mother
Mood:
slashergoredarknesshorror movie remake
Locations:
forestmotorcycleboatbathtubbicyclewaterwoodspolice carlakecampfiretunnelschool busbackwoodssex in a tent
Characters:
serial murderervillainboyfriend girlfriend relationshipafrican americantattoobrother sister relationshipteenage girlsheriffasian americanterrormysterious villainblonde girlgirl nudity
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniacevil mansickoserial murderhuman monsterpsychopathic killerbad guybeheadingcharacters killed one by onepsychoticsevered legbody countperversion β€¦rampagepsychoburned alivemaniactentstabbed in the backsevered headthroat slittingimpalementdecapitationmarijuanadead bodyshot in the headblood splattercorpsebare chested maledogviolencefemale nuditynuditynumber in titlebloodbare breastsfemale frontal nuditymasturbationsex scenefemale rear nuditynippleschasesurprise endingpistoltelephone callfiretopless female nuditywoman on topdigit in titleurinationblonderemakebare buttmaskhallucinationalcoholswimmingflashlightbracandlestrangulationtoplessaxemassacrevideo camerastabbingdeath of friendstabbed to deathstabbed in the chestcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerprologuescreamingmini skirtmoaningmissing personopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscampcovered in bloodmasked manrear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowcellphonedisfigurementbody landing on a carstabbed in the eyeaxe murderarrowburned to deathmasked killermannequinplantvillain played by lead actorporn magazinestabbed in the handbongcanoestaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmunderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All)

Grindhouse (2007) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grindhouse (2007)

A double-bill of thrillers that recall both filmmakers' favorite exploitation films. "Grindhouse" (a downtown movie theater in disrepair since its glory days as a movie palace known for "grinding out" non-stop double-bill programs of B-movies) is presented as one full-length feature comprised of two β€¦ individual films helmed separately by each director. "Death Proof," is a rip-roaring slasher flick where the killer pursues his victims with a car rather than a knife, while "Planet Terror" shows us a view of the world in the midst of a zombie outbreak. The films are joined together by clever faux trailers that recall the '50s exploitation drive-in classics. (Read More)

Subgenre:
slasher flickcult filmblack comedyb movieholiday horror
Themes:
murder of a police officersadismpsychopathmurderdeathfriendshiprevengeghostjealousylesbianismescapeextramarital affairsupernatural powerexploitationcannibalism
Mood:
blood and goreslashercar chasegore
Locations:
hospitalbarbeachrestauranthelicoptermotorcycleelevatorstrip clubmexicokiller car
Characters:
serial killermother son relationshipfather daughter relationshipdoctortattoobrother brother relationshipteenage girlteenage boyzombiesoldiernursepriestactresssingle mother β€¦killersherifftruck driver (See All)
Period:
year 2007
Story:
homicidal maniackilling an animalhit by a truckserial murderhuman monsterhead blown offsevered legshot in the facesevered fingermaniacdismembermentsevered armattempted rapeperson on firestabbed in the back β€¦hit by a carsevered headexploding cardecapitationmarijuanashot in the headshot to deathknifeviolencef ratedbloodone word titlefemale frontal nuditysex sceneinterracial sextitle spoken by characterfireshootoutunderweartesticlesmachine guncar accidentfalling from heightgood versus evilstabbingbridgestabbed to deathdinerstabbed in the chestapologyman with glassesassassinationdouble crossshot in the legmarriage proposalshot in the foreheadracial slurbeaten to deathringscarcheerleaderfilm within a filmexploding bodybasementpremarital sexshot in the armwerewolfsyringemachetewoman with glassesbabysittercookmad scientistmorguedrug abuseexploding buildingassaultgrindhouseparadeend of the worldinterracial friendshipeaten alivetensionloss of sonstabbed in the neckexploding headassault rifleinfectiondisfigurementsiegestabbed in the eyebarbecuecastrationgatling gungrenade launcherthanksgivingtext messagingcar troublestabbed in the handhomageexotic dancerjukeboxold flamecameo appearancetennesseemilitary basesaxophoneretrotrampolinedirector also cinematographerflesh eating zombiedisc jockeywalking deadstuntmandeformitybroken neckchild with gunaustin texasunwed pregnancyfake commercialmakeup artistbroken handfake trailerdirected by several directorsmultiple cameosanthropophaguswooden legthermometercinephiliachemical weaponsripped in halfaccidental suicidenazi experimentintentional goofmelting manreal twins playing twinsfilm breakon hood of moving car (See All)

Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (1981)

In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.

Subgenre:
psycho thrillerslasher flickcult filmsuspenseamerican horrorholiday horror
Themes:
murder of a police officerbrutalitypsychopathtorturemurderdeathjealousyfearvoyeurismmemoryseductionobsessionparanoiainsanityblindness β€¦traumamadnessmurder investigationpsychological trauma (See All)
Mood:
slashergorenightdarkness
Locations:
hospitalcarsmall townwheelchairpolice carhospital fire
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshippoliceteenagerteenage girlpolice officernursedetectivepolicemankillersheriffterror
Period:
1970syear 1978
Story:
psycho terrorpsycho killerhomicidal maniacmurder spreeextreme violencebutcheryserial murderhuman monsterpsychopathic killerbad guymadmancharacters killed one by onebody countbutcherrampage β€¦psychomaniacperson on firestabbed in the backhit by a carthroat slittingblood splatterknifesequelviolencesexfemale nuditynuditynumber in titlebloodmale nuditybare breastsmale rear nuditytwo word titlekissfemale rear nuditycigarette smokingnipplesexplosionchasetelephone callfirecryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilhalloweenflashlightold manstrangulationambulancestabbingstabbed to deathaccidentbrunettepart of seriesbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathprologuescreaminguniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapmurderersplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatmutilationwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolgrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetstabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyedark pastdead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerflat tirefemale stockinged feetdead girlconfusioncar troublemysterious manstoreneedlemedical masksurgical maskdark secretbandagelighteralonesuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscarenude bathingsilhouettevillain not really dead clichegrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidemidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Child's Play 2 (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play 2 (1990)

Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β€¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)

Subgenre:
psycho thrillerblack comedysupernaturalamerican horror
Themes:
evilpsychopathdeathsupernatural power
Mood:
slashercar chasegorerain
Locations:
chicago illinoisschool buswater gun
Characters:
slasher killerserial murderervillainserial killerhusband wife relationshippoliceboyteacherkillerterrornew student
Period:
1990s
Story:
psycho terrorpsycho killerhomicidal maniacevil manbutcherypsychopathic killerbad guymadmansevered legbody countbutcherpsychoburned alivemaniactied to a chair β€¦throat slittingcorpsesingingsequelbloodcigarette smokingpunctuation in titledigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedstrangulationambulancestabbed to deathstabbed in the chestfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondolllightningdeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturefalling down stairsgothiclifting someone into the airtied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersequel to cult favoritevoodoopajamasframed for murdersuffocationhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roomvillain not really dead clicheliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homemidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All)

The Green Inferno (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Green Inferno (2013)

In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β€¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)

Subgenre:
slasher flicksadistic horrorsuspensebody horroramerican horrorspanish horrorcanadian horror
Themes:
torturemurdersuicidefeardeceptioncannibalism
Mood:
blood and goreslashergorerainnightmare
Locations:
new york cityboatvillagejungleamericarain forest
Characters:
slasher killervillainfather daughter relationshiptattoolawyerterroramerican abroad
Story:
marijuana jointextreme violencehuman monsterbad guycharacters killed one by onesevered legbody countbroken legkillingdismembermentsevered armcharacter repeating someone else's dialoguesevered headthroat slittingimpalement β€¦decapitationshot in the backmarijuanawritten by directorblood splattershot to deathbare chested maleviolencefemale nuditymale frontal nuditymale rear nuditylesbian kissthree word titlepistolcell phoneshot in the chesturinationvomitingcollegeislandmale pubic haircolor in titlerivercookingdream sequenceritualroommatenecklaceshot in the foreheadprotestcollege studentscene during end creditsuniversityshot in the shoulderpigshot in the armblood spattersplattermachetemutilationspidercovered in bloodvictimmasked maneaten alivemale masturbationcannibalfalling to deathpsychotroniclesbian coupleairplane crashtitle at the endeye gougingslaughterstabbed in the eyebroken armenvironmentalismcapitalismactivisttorso cut in halfsatellitekillshot in the neckunited nationshomageflutenaivetyamazonslashingveganantbleeding to deathkiller childmiddle classperugraphic violencereference to twittertied up while barefootcamera phonebloody violencedeforestationignorancesadistic psychopathenvironmentalistpsychotronic filmbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophagusgory violenceeast coasteating human fleshfemale genital mutilationman eaterbody partshead on a stakemachete mutilationugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All)

Halloween (1978) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β€¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
psycho thrillerslasher flickindependent filmcult filmteen movieteen horroramerican horrorholiday horror
Themes:
evilpsychopathmurderdeathfearcorruptionparanoiamurder of family
Mood:
slasherhigh schoolnight
Locations:
carsmall towncar theftkitchen knife
Characters:
slasher killerserial murderervillainserial killerhusband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirllittle girlkillerlittle boypsychiatrist β€¦terrordoctor patient relationship (See All)
Period:
1970s1960syear 1963year 1978
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manmurder spreeserial murderhuman monsterpsychopathic killerbad guymadmanbody countpsychomaniackilling β€¦throat slittingmarijuanablood splattershot to deathknifeviolencedogfemale nuditynudityone word titleguncigarette smokingtitle spoken by charactersurprise endingshot in the chestwatching tvfalling from heightmaskrunninglow budget filmneighbortelevisiontelephonesubjective cameragood versus evilhalloweenstrangulationstabbingstabbed to deathchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shothalloween costumelong takestalkingmurdererfirst parthandgunpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airmutilationstabbed in the stomachblockbustergrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openpumpkinnude woman murderedphonemasked killerdead doggothmental patientyellingclosethiding in a closetkillsuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessvillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbmidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
slasher flickindependent filmcult filmteen movieteen horroramerican horrorindependent horror
Themes:
evilpsychopathmurderrevengesurrealismfuneralsupernatural power
Mood:
slashergorehigh schoolnightmareavant garde
Locations:
cemeterybathtubpolice station
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipteenage girlkilleralcoholicterrorpolice chaseself mutilation β€¦mysterious villainpolice lieutenant (See All)
Period:
1980s
Story:
psycho terrorhomicidal maniacevil manbutcheryserial murderpsychopathic killerbad guymadmancharacters killed one by onebody countbutchersevered fingerpsychoburned alivemaniac β€¦person on fireblood splattercorpsebare chested maleviolencebloodcigarette smokingsurprise endingdreammirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeefirst of seriescharacter's point of view camera shothangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairselectronic music scoregothiclifting someone into the airhatcrucifixgrindhousevictimstrong female leadseriesswitchbladeheadphonesbooby trapdisfigurementcellaralarm clockvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichegrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

Wrong Turn (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wrong Turn (2003)

Subgenre:
slasher flickindependent filmcult filmblack comedysuspensefish out of waterteen moviesurvival horrorteen horrorpsychological thriller
Themes:
murder of a police officerbrutalitypsychopathtorturemurderdeathfriendshiprevengekidnappingfearescapeparanoiainsanityhome invasionpanic β€¦cannibalismcouragehuntingwildernessnear death experience (See All)
Mood:
slashergore
Locations:
forestbathtubwoodspolice cartruckcavegas station
Characters:
slasher killerboyfriend girlfriend relationshipteenagerteenage girlteenage boypolice officerhostageinterracial relationshipself mutilation
Period:
2000s
Story:
human monstercharacters killed one by onesevered legbody countbroken legdismembermentsevered armperson on firestabbed in the backhit by a carsevered headexploding cardecapitationshot in the backmarijuana β€¦car crashshot in the headblood splattershot to deathcorpseknifeviolencesexbloodcigarette smokingexplosionchasesurprise endingpistolfirecryingcell phonebeatingcar accidentshotgunrescueslow motion scenefalling from heightshowdownriflecollegesurvivalfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendstabbed to deathtoiletstabbed in the chestmapdisarming someonepolice officer killedshot in the legtreestalkerdangerprologuescreamingfirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallnewspaper headlinearsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolineaxe murderarrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark housemental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All)

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
slasher flickindependent filmcult filmsuperherosupernaturalparanormalstop motion animationbody horroramerican horrorurban fantasy
Themes:
evilsadismbrutalitypsychopathdeathmurderfriendshiprapeghostpregnancyfearmonsterinvestigationsupernatural powerdepression β€¦insanitytrauma (See All)
Mood:
slashergorenightmare
Locations:
hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfrienddoctorboyfemale protagonist β€¦girlnursebabyartistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicterrorfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manmurder spreecut into pieceshit by a truckserial murderpsychopathic killerbad guymadmancharacters killed one by onepsychoticbody count β€¦rampagemaniackillingdismembermentsevered armskeletonhit by a carimpalementcar crashblood splatterknifepartybare chested malesequelviolencesexfemale nudityf ratednuditybloodbare breastsflashbackgunfemale rear nudityphotographchasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebeddemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of frienddinerweaponaccidentapologynunchilddream sequencepart of seriesdrawingunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollscreamstalkingautomobilepremarital sexmurdererhaunted houseredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutiondamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalegay stereotypeasylumfifth partnewspaper clippingmale objectificationvillain played by lead actortaking a showergiving birthmental patientmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlelollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handfetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Split (2016) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
psycho thrillerblack comedysuspensesuperherotragedysurvival horrorteen horrorpsychological thrilleramerican horror
Themes:
brutalitypsychopathdeathmurderfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeceptionvoyeurism β€¦death of fatherparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
slashergoreneo noir
Locations:
trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum
Characters:
slasher killerserial murderervillainserial killerfather daughter relationshipteenagerafrican americandoctorteenage girlpolice officerhostagekillersecurity guardpsychiatristterror β€¦uncle niece relationshippolice dog (See All)
Period:
2010s
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manserial murderhuman monsterpsychopathic killerbad guycharacters killed one by onebody countrampagepsychomaniackilling β€¦tentwritten by directorshot to deathcorpseknifepartybare chested malesequelviolencedogbloodone word titleflashbackdancingtitle spoken by characterchasesurprise endingpantiescell phoneshot in the chestshotgunrescuewatching tvcomputerpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing personknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskpump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastchloroformtorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditsspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

The Collection (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collection (2012)

Arkin escapes with his life from the vicious grips of "The Collector" during an entrapment party where he adds beautiful Elena to his "Collection." Instead of recovering from the trauma, Arkin is suddenly abducted from the hospital by mercenaries hired by Elena's wealthy father. Arkin is blackmailed β€¦ to team up with the mercenaries and track down The Collector's booby trapped warehouse and save Elena. (Read More)

Subgenre:
sadistic horrormartial artssurvival horrorhorror b movie
Themes:
torturedeathmurderrevengekidnappingescapetrauma
Mood:
gore
Locations:
hospitalnightclub
Characters:
serial murdererserial killerhusband wife relationshipfather daughter relationshipbrother sister relationshipfatherself mutilationyounger version of charactermysterious villainkiller dog
Story:
killing an animalcut into piecesserial murdersevered leglens flaresevered fingerbroken legburned alivedismembermentsevered armskeletonperson on firecharacter repeating someone else's dialoguestabbed in the backsevered head β€¦throat slittingimpalementcar crashpunched in the faceblood splattershot to deathcorpseknifepartybare chested maleviolencesequelfemale nuditybloodflashbacktwo word titledancingtitle spoken by characterexplosionlesbian kisschasesurprise endingpistolfistfightshot in the chestshotgunslow motion scenesubjective cameramassacredeath of friendstabbed to deathstabbed in the chestanti herochild in perilnews reportcharacter's point of view camera shotkicked in the faceexploding bodytrapcharacter says i love youmercenaryex convictobscene finger gesturesyringegrenadewarehousemass murdertied to a bedstabbed in the stomachspiderswat teamskullmexican standoffcrushed to deathmasked mancamera shot of feetswitchbladetrappedteamgash in the facejunkietitle appears in writingexploding headthrown through a windowassault riflebooby trapknife fighttitle at the endslaughterbody landing on a carraised middle fingerbroken armrescue missionmasked killerfirefightertorso cut in halfimpersonating a police officercrucifixionstabbed in the handbrainwashingmazekilling a doggerman shepherdstandoffstabbed in the armhanging upside downbody in a trunkcrashing through a windowheld captiverazor bladecrushed headravestabbed in the shouldergraphic violencecheating boyfriendstabbed in the facehomeless personclose up of eyegrindhouse filmcaptivityreturning character with different actorcoercionbear traphung upside downflickering lightwoman punches a manswattied to a tablecadavercircular sawbreaking a car windowsevered tonguegiallo esquehearing aidstrapped to a bombpeepholearm casthuman skeletonstabbed through the chinlocked in a cageteam uptrip wireabandoned hotelhung from a hookiron maidenrube goldberg machinebuilding firefusepleading for helpclimbing down a ropenailed to a wall (See All)

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β€¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
independent filmmartial artscult filmblack comedysuspensesupernaturalparanormalamerican horror
Themes:
evilpsychopathmurderrevengefuneralsupernatural power
Mood:
slashergorerainhigh schoolnightmare
Locations:
hospitalbeachcemeterysmall townelevatorschool nurseblood in water
Characters:
slasher killerserial murderervillainserial killerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitresskillerterror
Period:
1980s
Story:
psycho killerhomicidal maniackilling spreeevil manmurder spreebutcheryserial murderpsychopathic killerbad guybutcherrampagemaniackillingsevered armskeleton β€¦person on firecharacter repeating someone else's dialoguesevered headcar crashpunched in the faceblood splattercorpsebare chested malesequeldognumber in titlebloodfemale frontal nuditycigarette smokingphotographsurprise endingfiredreamdigit in titleurinationface slapplace name in titlerock musicneighbornumbered sequeldemonambulancedeath of friendstabbed to deathdinerstabbed in the chestcoffinlocker roomwidowerpay phonekicked in the facedeath of brothercheerleaderdeath of songlassesmurdererunderwatersleepingundeadpizzasurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armvillain played by lead actorreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimtime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Maniac (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Maniac (2012)

Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession  β€¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)

Themes:
sadismbrutalitypsychopathtorturedeathmurderfearlonelinessobsessiondepressiondrug useinsanityunrequited lovephotographychildhood trauma β€¦psychological trauma (See All)
Mood:
slashergoreneo noir
Locations:
restaurantlos angeles californiasex in public
Characters:
villainserial killerhomosexualmother son relationshiptattooprostitutephotographerterrormysterious villain
Period:
1980s2010s
Story:
evil manmurder spreeextreme violenceserial murderhuman monsterpsychopathic killerbad guysevered legrampagemaniacdismembermentsevered armcharacter repeating someone else's dialoguestabbed in the backhit by a car β€¦car crashblood splattercorpseknifeviolencebloodone word titlethreesomeflashbackfemale rear nudityphotographcell phoneurinationremakecomputercameravomitingbathroomneighborhallucinationvoyeursubjective camerafoot chasebound and gaggedwinestrangulationcocainestabbed to deathstabbed in the chestsubwaychild abusebreast fondlingvannews reportlooking at the cameranecklacetalking to the camerakicked in the facetragic eventstalkingthreatened with a knifelooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingpillsrejectiondeath of protagonistdisembowelmentwedding dressdark pasttied feetnervous breakdowndead woman with eyes openmisogynymannequinwoman in bathtubvillain played by lead actorsuffocationconfusionstabbed in the handhiding in a closetsubway stationsexual perversionslashingbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleavertied up while barefootknife murderfemale victimstrangled to deathschizophrenicbreaking through a doormurder of a nude womanonline datingdisturbed individualbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β€¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
psycho thrillerindependent filmcult filmsupernaturalstop motion animationamerican horror
Themes:
evilsadismpsychopathmurderdeathghostfuneralmonstersupernatural powerinsanity
Mood:
slashergorenightmare
Locations:
barchurchcemeteryschool boy
Characters:
slasher killerserial murderervillainserial killerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle motherkillerterrorself mutilation β€¦alcoholic fatherevil nurse (See All)
Period:
1980s
Story:
psycho killerhomicidal maniackilling spreeevil manmurder spreebutcheryserial murderpsychopathic killerbad guymadmancharacters killed one by onebody countbutcherrampagemaniac β€¦killingskeletoncharacter repeating someone else's dialoguestabbed in the backimpalementdecapitationblood splattercorpsebare chested maleviolencesequelfemale nuditynumber in titlebondagecigarette smokingsurprise endingfiredreamdigit in titleslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemonfoot chasenewspaperstabbingdeath of friendstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partscreamingpuppetpay phonedollisolationbasementmurderercharacter says i love youundeadsplatterfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoseswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyepajamassmokealleyreturning character killed offohioevil spiritabandoned housestabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsvillain not really dead clicheghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
slasher flickcult filmsupernaturalparanormalparanormal phenomenateen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
evilsadismbrutalitypsychopathdeathmurderfriendshiprevengesurrealismkidnappingghostfearescapemonstervoyeurism β€¦supernatural powerparanoiapanicmysterious deathshower murder (See All)
Mood:
slashergorerainhigh schoolnightmaredarknesspoetic justice
Locations:
barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriend β€¦brother sister relationshipteenage girlteenage boyteachergirlstudentpolicemanlittle girlkillerterrorself mutilationdrivergay teacher (See All)
Period:
1980syear 1985
Story:
psycho terrorpsycho killerhomicidal maniackilling spreekilling an animalevil manmurder spreebutcheryserial murderpsychopathic killerbad guymadmanbody countbutcherrampage β€¦psychoburned alivemaniacperson on firestabbed in the backimpalementdead bodyblood splatterknifepartybare chested maleviolencesequeldogcharacter name in titlenuditynumber in titlebloodmale nuditymale rear nuditybondagefightcigarette smokingchasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titleneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendscreaminglocker roomcharacter's point of view camera shotpossessionkicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malevisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moondamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellaralarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorgrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Texas Chainsaw (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Texas Chainsaw (2013)

After the first massacre in 1974, the townspeople suspected that the Sawyer family were responsible. A vigilante mob of enraged locals surrounded the Sawyer house, burning it to the ground and killing every last member of the family. Decades later, a young woman named Heather learns that she has inh β€¦erited a Texas estate from her grandmother. She decides to bring her friends along on the road trip to investigate her inheritance. On arrival, she discovers she has inherited a mansion, but is yet to uncover the terrors that lurk in the basement underneath it. (Read More)

Subgenre:
slasher flickb movie
Themes:
murder of a police officerdeathmurderrevengevoyeurism
Mood:
slashergorerain
Locations:
barcemeterypolice stationroad triptexas
Characters:
slasher killerfather son relationshipbabylawyerkillerinterracial relationshipsheriffcousin cousin relationshipmayoryounger version of character
Period:
1990s1970s
Story:
marijuana jointhit with a hammercut into piecescharacters killed one by onesevered legsevered fingerhitchhikerkillingdismembermentperson on firecharacter repeating someone else's dialoguestabbed in the backhit by a carsevered headimpalement β€¦shot in the backdead bodycar crashshot in the headblood splattershot to deathcorpsebare chested malesequelfemale nuditynuditybloodbare breastsfemale frontal nudityflashbackphotographpantiespistoltopless female nudityshootoutshot in the chestremakeshotgunslow motion scenevoyeurcleavagehalloweenfoot chasebound and gaggedmassacremansionstabbingstabbed to deathstabbed in the chestscantily clad femalegraveyardnecklaceshot in the foreheadblack pantiesbeaten to deathknocked outkicked in the facescarfemale removes her clothescorrupt copbralessgirl in pantieschainsawfalling down stairssupermarketrevelationscene during opening creditsbarnstabbed in the stomachsevered handcarnivalmasked manduct tape over mouthpump action shotguninterracial romancebra and panties3 dimensionalpool tablescene after end creditschainfifth partmasked killertorso cut in halfliving deadreturning character killed offmolotov cocktailgateplaying pooldouble barreled shotguninterracial kissnude girlhead bashed indeputywoman in bra and pantiesferris wheelwoman wearing only a man's shirtcrotch grabgraphic violencedeath of grandmothercheating boyfriendslaughterhousepsychotronic filmhouse firebonegrindhouse filmhatchetvinylwoman wearing black lingerieangry mobtrail of bloodshot through a wallhidden doorwine cellarmidnight moviesevered facehorror icontape over mouthduct tape gagbreast kissingchain link fencechainsaw murderblack man white woman relationshipwoman undressing for a manmeat grinderhung from a hookachilles tendon cuthacked to deathdead body in a freezerleatherface3d sequel to 2d filmopen graveskinningwearing human skinadopted girlretconstabbed with a pitchforkblood trailblack man white woman kissblack man white woman sexgroup photographhiding in a coffin (See All)

Bride Of Chucky (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bride Of Chucky (1998)

Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.

Subgenre:
cult filmblack comedyconspiracysupernatural
Themes:
murder of a police officersadismbrutalitypsychopathmurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyfear β€¦escapeweddingdeceptionseductionrobberysupernatural powerparanoiaredemptionunrequited lovepanicpolice brutalitypolice corruptionnear death experienceregret (See All)
Mood:
slashercar chasegorepoetic justice
Locations:
hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel
Characters:
serial killerboyfriend girlfriend relationshiphomosexualpoliceteenagertattooteenage girlteenage boypolice officerdetectivepriesthostagethiefpolice detective β€¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All)
Period:
1990s
Story:
homicidal maniacmarijuana jointmurder spreecar set on firehit by a truckblood on camera lensshot in the facesevered fingerhead buttmaniacskeletoncharacter repeating someone else's dialoguestabbed in the backhit by a carexploding car β€¦tied to a chairthroat slittingimpalementmarijuanadead bodycar crashblood splattershot to deathcorpseknifebare chested malesequelviolencesexcharacter name in titlebloodgunkissfightcigarette smokingphotographchasesurprise endingpistolfirecryingcell phonebeatingcar accidentmirrorshot in the chestrescueslow motion scenewatching tvbare buttlettershowdownheld at gunpointrock musichandcuffsrevolvertelephonef wordorphanflashlightambushstrangulationmansionmontagebridgestabbed in the chestfalse accusationdisarming someonecoffindrawingdouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkerdangerscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timedollknocked outbaseball batlightningringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copprivate detectiveflirtingchainsawpot smokingsabotagefireplacegothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamenew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothabandoned buildingsuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut updisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodychapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All)

House Of 1000 Corpses (2003) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

House Of 1000 Corpses (2003)

In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that  β€¦await. (Read More)

Subgenre:
slasher flicksadistic horrorindependent filmcult filmdark comedycreature feature
Themes:
murder of a police officersadismtorturedeathmurdersurrealismkidnappingrapejealousyfearfuneralmonsterseductiontheftdeath of father β€¦insanitymental illnesstheatrecannibalismmadness (See All)
Mood:
slashergorerainnightmare
Locations:
cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in
Characters:
slasher killerserial killerboyfriend girlfriend relationshipfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshiptattoobrother sister relationshipthiefsheriffpolice lieutenantevil doctor
Period:
1970syear 1977
Story:
evil manhuman monstermadmanpsychoticshot in the facehitchhikerpsychomaniacskeletonperson on firecharacter repeating someone else's dialoguesevered headtied to a chairshot in the backshot in the head β€¦blood splattershot to deathcorpseknifebare chested maleviolencenumber in titlebloodflashbackdancingphotographchasesurprise endingpistolfirebeatingdreamdigit in titlecar accidentshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolversubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesthousemapman with glassescoffinritualgraveyardshot in the foreheadgravecharacter's point of view camera shotactor playing multiple rolesmissing personlightninghanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directorpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencesevered handskullhome movierapistcommercialcrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openmannequintorso cut in halfhit with a baseball batintestinesburied aliveneedleshot in the neckold dark houseurban legendfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Land Of The Dead (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Land Of The Dead (2005)

Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.

Subgenre:
sadistic horrorcult filmblack comedysuspensepost apocalypsecreature featurezombie apocalypseamerican horrorzombie outbreakfrench horrorcanadian horror
Themes:
sadismbrutalitymurderdeathsuicidefearracismgreedapocalypsecannibalism
Mood:
blood and goregoredarknesssequel to cult horror
Locations:
urban settingcitytruckgas station
Characters:
villainafrican americanprostitutezombie
Period:
1990syear 1995
Story:
extreme violencebutcherybad guybeheadingsevered legracistbutchersevered fingerhead buttdismembermentperson on firesevered headexploding cardecapitationdead body β€¦shot in the headblood splattershot to deathcorpsesequelviolencefemale nuditybloodexplosionlesbian kisspistolshootoutmachine guncar accidentshot in the chestrescuearrestshootingjailriverdeath of frienddouble crossshot in the legshot in the foreheadracial slurlimousineelectrocutionkicked in the faceshot in the shoulderexploding bodyratmercenaryshot in the armcult directorundeadblood spatterarsonsplatterdisastermachetevirusfourth partassaultsevered handskateboardrocket launcherend of the worldback from the deadeaten alivefight to the deathgash in the faceshopping mallexploding headdisembowelmentsiegeethnic slursequel to cult favoritetorso cut in halfmexican americanliving deadkillgun in mouthskyscraperslashingfortressshot in the eyemeat cleaverburnt bodyshot through the mouthshot in the throatflesh eating zombiegraphic violencewalking deadbloody violenceburn victimshot in the crotchsevered footevil clownbody partoutbreakzombie attackpittsburgh pennsylvaniastairwellbitten in the throatliquor storehung upside downdoomsdayauto theftsliced in twofireworklawnmowerbitten handbodily dismembermentflesh eatingdisturbingevil deadanthropophagusgory violencespear guneast coastzombificationgruesomehell on earthman eaterbody partsblown to piecesdrawbridgezombie biteabandoned citydeadly diseasebrutalmonster as victimhole through torsopiercing ripped outthrowbackzombie with gunzombie invasionzombie clown (See All)

Halloween 4: The Return Of Michael Myers (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween 4: The Return Of Michael Myers (1988)

It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k β€¦illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)

Subgenre:
slasher flickindependent filmcult filmamerican horrorholiday horror
Themes:
evilpsychopathmurderpanic
Mood:
slashergore
Locations:
schoolcarsmall townpolice stationrooftop
Characters:
slasher killerserial killerteenagerteenage girlgirlsister sister relationshipmysterious villaincrying girl
Period:
1980syear 1988
Story:
psycho killerhomicidal maniackilling spreeevil manmurder spreecrime spreeserial murderhuman monsterpsychopathic killermadmancharacters killed one by onebody countrampagemaniackilling β€¦hit by a carthroat slittingimpalementknifedogsequelcharacter name in titlenumber in titlebloodgunsurprise endingdigit in titleshot in the chestfalling from heightmasknumbered sequelsubjective cameragood versus evilhalloweenflashlightambulanceanimalpart of seriespolice officer killedelectrocutioncharacter's point of view camera shothalloween costumepickup truckfalling down stairslifting someone into the airfourth parthitchhikingpump action shotgunchild's point of viewseven word titlemanhuntpower outageatticmasked killerdead dogreturning character killed offtrick or treatingalarmelementary schoolteasingkiss on the lipsmatchillinoismasked villainknife murderoff screen murdervillain not really dead clicheescaped mental patientlifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecesmall town sheriffmichael myerschild murdererlifting male in airscarred facehalloween prankboogeymandeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldjumpsuitthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrailer narrated by don lafontainetrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowoctoberkilling the wrong personteenager in dangersanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclefoster sistergirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
sadismbrutalitypsychopathmurderdeathsurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigation β€¦angercorruptiondeath of fatherparanoiablackmailinsanityillnesshome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All)
Mood:
slashergorenightdarkness
Locations:
australiahospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairpolice stationpolice car β€¦cityitalytruck (See All)
Characters:
slasher killerserial murderervillainserial killerboyfriend girlfriend relationshiphomosexualfather son relationshippolicemother son relationshipfather daughter relationshipdoctorsingerboygirl β€¦policemanmusicianactresskillerpsychiatristmaidprofessorjewterrorgermangay friendmysterious villainself pity (See All)
Period:
1970s
Story:
homicidal maniackilling spreemurder spreeextreme violencebutcheryhit by a truckserial murderhuman monsterpsychopathic killercharacters killed one by onepsychoticbody countbutcherrampagemaniac β€¦killingskeletonstabbed in the backhit by a carsevered headimpalementgay slurdecapitationdead bodyblood splattercorpseknifesingingviolencebloodflashbacktwo word titlegunkisscigarette smokingphotographchasesurprise endingtelephone callfiresongshootoutbeatingmirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningcafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective camerasurvivalnewspaperbedroomflashlightjournalistbandold manstrangulationaxestabbingstabbed to deathdinerhousejokebrunettedrivingbirddrawingsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerprologuescreamingpuppetprotestkeydollstatuechristmas treehangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropearsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionwhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastfemale reportergay stereotypeliving roomdead woman with eyes openvoodoolightplaying pianotelepathycrowclose up of eyesdead girldrumsmysterious manapparitiondark secretkillgloveslong hairmen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousesaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanfamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on fireclose up of eyefingerprintsilhouettegrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hostel (2005) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hostel (2005)

3 backpackers are in Amsterdam where they get locked out of their youth hostel. They are invited into a man's house where he tells them of a hostel somewhere in eastern Europe where the women are all incredibly hot and have a taste for American men. When they get there, everything is too good to be  β€¦true - the hostel is "to die for" (Read More)

Subgenre:
slasher flicksadistic horrorcult filmconspiracysurvival horror
Themes:
sadismbrutalitypsychopathtorturedeathmurderrevengesuicidekidnappingdrinkingfearescapedeceptionseduction β€¦travelpolice brutality (See All)
Mood:
slashercar chasegore
Locations:
trainpolice stationbrothelmuseumtrain stationsex in a bathroom
Characters:
slasher killerserial killerfriendprostituteamerican abroad
Story:
extreme violencehit with a hammercut into piecespsychopathic killersevered legpunched in the stomachdismembermenthit by a carsevered headtied to a chairthroat slittingshot in the backblood splattershot to deathcorpse β€¦bare chested maleviolencefemale nuditybloodone word titlethreesomefemale frontal nuditymale rear nudityfemale rear nuditydancingphotographtitle spoken by characterpantiespistolcell phonebeatingshot in the chestface slapvomitingheld at gunpointprostitutionhandcuffssubjective camerafoot chasebound and gaggedstrangulationdeath of friendchild in perilcontroversysearchfemme fataleshot in the foreheadpainon the runbeaten to deathscreamingcharacter's point of view camera shotmissing personcover upcollege studentdisappearanceglassestrappremarital sexfirst partwhippingeuropesurgerychainsawpot smokingwarehousegothicmachetemutilationdesperationsevered handcovered in bloodsadomasochismcrying manpassportsexual desirecameorear entry sexstealing a carwhipmercilessnesstitle appears in writingscissorstitle at the endvegetarianeye gougingtoursurprise after end creditsdrugged drinkmysterious manbongbag over headforeignerburnt faceamsterdam netherlandshead bashed inscalpelwoman in bra and pantiesicelandwhistlingbusiness cardunsubtitled foreign languagefinger cut offcrushed headcorrupt policekiller childspaslaughterhousedrillsole survivorlocked in a roomstupid victimnude photographhit by a traintorture chamberpower drillbodily dismembermentbubble gumblowtorchhostelhit with a rocksledge hammerbackpackersaladhit on the head with a rockdrill in the headburn injuryslovakiaachilles tendon cuthead in a toiletugly americanhit by a doorsevered toebegging for lifefanny packthrown out of a barbratislavareflection in glasshousehold cleaning gloveswhimperingkid gangtitle appears in text on screensearching for friendsearching for missing friend (See All)

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
psycho thrillersuspensesupernaturalparanormal
Themes:
evilpsychopathtorturemurderdeathsuicidekidnappingmarriagerapeghostprisonfearescapememorysupernatural power β€¦paranoiadrug useinsanitymental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
slashergorerainneo noirnightmaredarkness
Locations:
hospitalswimming poolcarbathtubtaxipolice stationpolice car
Characters:
slasher killerserial murderervillainserial killerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoofemale protagonistnursepoliceman β€¦lawyerreference to godkillersecurity guardpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
psycho terrorpsycho killerhomicidal maniackilling spreeevil manextreme violenceserial murderpsychopathic killerbad guymadmanpsychomaniackillingattempted rapeperson on fire β€¦throat slittingcar crashblood splattercorpseknifebare chested maleviolencesexfemale nudityf ratedbloodfemale frontal nudityinterviewflashbackgunkissfightphotographexplosionchasesurprise endingpistolshowertelephone callfirecryingcell phonedreamcar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunninghallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightaxevideo camerawomanbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingfantasy sequencepay phonefugitiveumbrellapossessionlightninginjectionpursuitstalkingdeath of husbandmurderertrusttherapypizzasyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarreckless drivingowlnewspaper clippingframed for murderdead girlmemory lossintimidationgothvideo tapemental patientelectricitykillmental breakdownblackoutsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockcamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β€¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
sadistic horrorindependent filmcult filmamerican horror
Themes:
evilsadismbrutalitypsychopathtorturemurderdeathrevengesuicidekidnappingrapeescapeinvestigationvoyeurismseduction β€¦insanityhumiliationabductioncrueltyvengeancemadnessrape and revengerape and murder (See All)
Mood:
slashergorehigh schoolnightmare
Locations:
swimming poolforestcemeterylakerunning through the woods
Characters:
slasher killerserial murderervillainserial killerfamily relationshipsfather son relationshippoliceteenage girlreference to godkillersheriffterrorself justice
Period:
1970s
Story:
homicidal maniacevil mansickofilm starts with textserial murderhuman monsterpsychopathic killerbad guymadmanpervertperversionmaniackillingdismembermentsevered arm β€¦stabbed in the backthroat slittingmarijuanablood splattershot to deathknifedogviolencefemale nuditybloodfemale frontal nuditygunfemale rear nudityfightfemale full frontal nuditypantiesshowerurinationremakeshootingbeerbirthdayvoyeurfoot chasebound and gaggedgangconcertstabbingstabbed to deathtoiletfemale pubic hairwhite pantiesscantily clad femalebathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictscreamingsuburbelectrocutionringconvertiblefemale removes her clothesmurdererchickendirectorial debuthandgunbased on filmcult directorbralesschainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creammutilationgrindhousevictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlprayingcannabisforced to striprunning awayspit in the facemisogynistphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbloody violencesadistic psychopathbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastycandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cabin Fever (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β€¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
independent filmcult filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
brutalitydeathmurderfriendshiprevengedrinkingfeardrunkennessescapeparanoiaguiltinsanityillnessunrequited lovehome invasion β€¦exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
car chasegorerainambiguous ending
Locations:
hospitalforestbathtubbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed
Characters:
boyfriend girlfriend relationshipfather son relationshippoliceafrican americandoctorpolice officersheriffself mutilationhomeless mankiller dog
Period:
2000s
Story:
marijuana jointhit with a hammerhead blown offcharacters killed one by onesevered legracistburned alivedismembermentsevered armperson on firestabbed in the backhit by a carsevered headtied to a chairimpalement β€¦gay slurdecapitationshot in the backmarijuanadead bodywritten by directorpunched in the faceshot in the headblood splattershot to deathcorpseknifepartybare chested maleviolencedogfemale nuditybloodfemale frontal nudityflashbackmasturbationsex scenefemale rear nuditycigarette smokingfingeringphotographchasesurprise endingpantiespistolshowerfirecell phonewoman on topbeatinghorsecar accidentshot in the chesturinationblondeshotgunslow motion scenebikinibrawlbare buttvomitingrifleheld at gunpointbeerlow budget filmhallucinationrevolverguitarf wordswimmingcleavagesurvivalfoot chaseambushaxemassacreambulancedeath of friendstabbed to deathstabbed in the chestbrunettefalse accusationscantily clad femaleradioshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathkaratescreamingproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutshot in the armobscene finger gesturevigilantecult directorcowcorrupt copblack americanpickup truckeavesdroppingfireplaceshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionslaughterdeerdisfigurementranchflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogdirector cameopromiscuous womandrifterdead animalhomageepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting blooddog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

Psycho (1960) is one of the best movies like Wolf Creek 2 (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  β€¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
psycho thrillerindependent filmcult filmsuspenseamerican horrorpsychological horror
Themes:
psychopathdeathmurdermarriagemoneyfearfuneraldeceptionvoyeurismdivorcetheftguiltinsanitydatingmental illness β€¦unrequited lovemadness (See All)
Mood:
slasherraindarknessbreaking the fourth wall
Locations:
churchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water
Characters:
slasher killerserial murderervillainserial killerfamily relationshipsmother son relationshipfriendpolicemansister sister relationshipthiefkillerpsychiatristsecretarysheriffterror
Period:
1960syear 1960
Story:
psycho terrorpsycho killerhomicidal maniacmurder spreecrime spreebutcheryserial murderhuman monsterpsychopathic killerbad guymadmancharacters killed one by onepsychoticbody countbutcher β€¦psychomaniackillingcountrysidecorpsebare chested maleviolencebased on novelbloodone word titleinterviewflashbackphotographsurprise endingshowertelephone callvoice over narrationunderweararrestundressingsecretbathroomjailhallucinationvoyeursubjective cameragood versus evilnewspaperbracaliforniadisguisestabbingwomanwidowstabbed to deathtoiletstabbed in the chestbirdbathold womanstalkerwidowerfirst of seriescharacter's point of view camera shotmistaken identitymissing personscreamlong takefemale removes her clotheswitnessbasementtrapmurdererfirst partthreatened with a knifecross dressingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airmutilationblockbusterimpersonationphone boothgrindhousevictimskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormextortionnervous breakdowncellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathfemale stockinged feetimpotencevillain played by lead actormysterious mandirector cameoold dark housefemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodyslashingdomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderbloody violencefemale victimreclusesadistic psychopathmurder of a nude womansilhouettefade to blackpeep holedisturbed individualgrindhouse filmidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

Child's Play (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play (1988)

When Charles Lee Ray needs to get quick escape from cop Mike Norris, he takes his soul and buries it into playful, seemingly good guy doll Chucky. Little does he know a little boy by the name of Andy Barclay will be the new owner of him soon-to-come. Charles confides in Andy while he commits numerou β€¦s murders. Once the adults accept Andy's story as truth, it's too late. (Read More)

Subgenre:
psycho thrillerslasher flickindependent filmcult filmstop motion animation
Themes:
psychopathmurderrevengesupernatural power
Mood:
slasher
Locations:
carelevatorapartmentpolice stationchicago illinois
Characters:
serial killermother son relationshipboypolice detectivehomeless manwitch doctor
Period:
1980swinter
Story:
hit with a hammerhuman monsterhead blown offsevered legbroken legburned alivemaniacdismembermentsevered armattempted rapeperson on firesevered headdecapitationshot in the backcar crash β€¦blood splattershot to deathcorpseknifebloodcigarette smokingpistolpunctuation in titleshootouturinationfalling from heightbirthdayapostrophe in titlesubjective camerafoot chasedeath of friendwidowstabbed in the chestsubwayfalse accusationchild in perilshot in the legelectrocutionfirst of seriescharacter's point of view camera shotpossessiondollknocked outlightningshot in the shoulderfirst partfreeze frametv newselectronic music scoregothicbabysitterlifting someone into the airtoyback from the deadreverse footagetensionchild's point of viewdark humorfalling to deathmental hospitalstabbed in the legthrown through a windowbody landing on a carvoodooblack magicgunfireframed for murderplanthit with a baseball batpresentstabbed in the handhiding in a closetwhodunitdepartment storescalpelelectric shockpolice interrogationbitten in the neckbumburnt bodysole black character dies clichehiding under a bedexploding housebreaking through a doorvillain not really dead clichefootprintjewelry storetauntingmuraltrail of bloodbandaged handevil dolltoy storebitten on the armremadevoodoo dollchantfalling through a windowbreakfast in bedskipping schoolevil laugharm blown offnude paintingmatcheskiller dollfloursoul transferencegingershot in the hearttwo killersdisbelieving adultleg blown offanimatronicattempted strangulationclaw hammerskid rowpeddlerelectroconvulsive therapyhead spinlightning stormmurder disguised as accidenttalking dollcartoon on televisionfalling on a carstalking victimjammed guncar cigarette lighterchild psychiatristelectric batterydisbelieving authoritiesfalling down a chimneyloss of aunt (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Wolf Creek 2?
<< FIND THEM HERE! >>