Please wait - finding best movies...
When a group of young friends take a trip to a remote mountain to get away from their families for Christmas, their stress-free getaway turns into a nightmare. Trapped in a cabin by a supernatural creature, their fight for survival puts their fracturing relationships to the test as it becomes increa …singly clear that all of them won’t be surviving the holidays. (Read More)
| Subgenre: | found footagesupernatural |
| Themes: | monster |
| Mood: | atmospheredarknessnightnightmare |
| Locations: | woodssmall townforest |
| Story: | supernatural creatureweekend getawayyoung adultssecluded cabinice hockeyhorror moviehorror filmvacation gone wrongfairy lightradio personalitylong waitbackgroundcaughtleavesholidays …hiddenfrozendisturbingcreepygetawayyoungscaredivorced parentscoldwallmental breakdowneyefolkloresurpriseguardgroup of friendsanswering machineicecabincreaturehouse (See All) |
A couple of college students known only as the Girl and the Guy are traveling home to Delaware the day before Christmas Eve. They're on a frozen road that the Guy is convinced is a scenic short-cut. In the middle of nowhere in below freezing conditions they are run off the road by a hit and runner. …They soon realize they're caught in a supernatural bubble where a crime from 1953 is doomed to repeat itself, year after year threatening new victims. The Guy attempts to walk back to the last petrol station but his wounds from the crash are worse than he let on. (Read More)
| Subgenre: | supernaturalindependent filmsuspenseparanormal phenomenaghost storyteen horrorholiday horror |
| Themes: | murderdeathsurrealismkidnappingchristmasbetrayalghostfearescapedeceptionobsessionsupernatural powerparanoiaunrequited loveabduction …panicpolice brutalitynear death experiencesupernatural being (See All) |
| Mood: | atmospheredarknessnightnightmare |
| Locations: | woodsforestcarsnowpolice carroad tripgas stationroad moviepennsylvaniafire truckcar fire |
| Characters: | zombiepolice officerpriesthostageterrordriver |
| Period: | 2000s1950swinter20th century21st century |
| Story: | horror filmcaughtfrozencoldicebloodviolenceflashbacktwo word titlekissphotographtitle spoken by charactersurprise endingfirecell phone …dreamcorpsecar accidenturinationrescueslow motion scenearrestcar crashbathroomhandcuffstelephonesurvivalflashlightambulancedinerdrivingdouble crossgraveyardracial slurstalkerdangerscreamingon the roadrace against timecollege studentuniversitylong takedisappearanceisolationsuspicionnewspaper headlineredheadcorrupt copholidaypickup truckburned alivegothiclifting someone into the aircowboy hatloss of friendstrangercrushhomeredneckbarefoottensionescape attemptracisthighwayduct tapeethnic slurburned to deathnewspaper clippingsouthern accenttext messaginghit and runcar troubleapparitionminimal castold dark houseevil spiritcrashhearing voicesroad accidentn wordseizureshockmacabrecollege campuscar radiocar breakdownfeettextingcamera phonememorialspitting bloodroadpsychotronic filmcar rolloverlifting person in airtruck stopremotehand injurynail polishvisionsfreezingcold weatherpublic restroomburning carschool classstate troopertire ironnameless characterfreeze to deathmistrustfrostbitevengeful ghosthighway patrolravineyear 1953pedicurereanimated corpsefrozen alivesurvivingfreezing to deathsnowplowtoesdead familyrigor mortisracist copoldsmobileurinating on groundevil copnamepsycho copghostly figurebulletin boardtelephone polejammed doorride shareroadside memorialbritish actress playing american characterbag of groceriesmad copmaniac cop (See All) |
The thirty and something years old psychiatrist Dr. Samantha Goodman has an incurable brain tumor that has just started to grow. Felling totally stressed, she decides to spend the weekend in her cottage with her husband, the writer David Goodman, and her sister Melody. She unexpectedly arrives in th …e cabin and finds a bottle of champagne in the refrigerator. Later, a young man, Adrian, asks for help due to the cold weather and once in the house, he shows a gun and brings his partner, the violent sexual offender and Samantha's former patient Harlan Pyne. Along the night, Harlan forces the family to participate in twisted games, where truths are disclosed. (Read More)
| Themes: | surrealismtortureextramarital affairpsychopathhome invasion |
| Mood: | night |
| Locations: | snowcanada |
| Characters: | husband wife relationshipfemale protagonisthostagesister sister relationshippsychiatristcanadiandoctor patient relationship |
| Period: | winter |
| Story: | weekend getawaysecluded cabinyoungcoldcabinhousesexbloodmale nudityflashbackdoggunthree word titlepantiespistol …dreamunderwearbare buttbraaxetied to a chairchampagnebasementgamecheating husbandrapistsevered fingeraxe murderdead dogmental patientforced to stripkilling a dogunconsciousnesscabin in the woodsfinger cut offbreast cancerweekendsnowmobilesexual humiliationbrain tumornailfemale psychiatristpliersshooting a dogstabbed in the earfamily petnail in the headsex with sister's husband (See All) |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
| Subgenre: | found footageindependent filmmockumentaryfake documentary |
| Themes: | murderfearsupernatural powerpanic |
| Mood: | darknessnightnightmare |
| Locations: | swimming poolkitchen |
| Characters: | boyfriend girlfriend relationshipself mutilationself absorption |
| Period: | 2000syear 2006 |
| Story: | youngscarehousebloodinterviewtwo word titlebare chested malephotographknifesurprise endingfirecomputercamerawritten by directorlow budget film …demonguitarf wordsubjective camerabedroomvideo camerano opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguemicrophonescreamingsuburbfirst of seriescollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst partsevered armhaunted houseobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterladdermale underwearbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerdemonic possessionexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexdragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All) |
Young newlyweds Paul and Bea travel to remote lake country for their honeymoon. Shortly after arriving, Paul finds Bea wandering and disoriented in the middle of the night. As she becomes more distant and her behavior increasingly peculiar, Paul begins to suspect something more sinister than sleepwa …lking took place in the woods. (Read More)
| Subgenre: | body horror |
| Themes: | lovemarriagemental illnessabortion |
| Mood: | night |
| Locations: | woodsforestrestaurantlakecampfirebackwoods |
| Characters: | husband wife relationshipalienchildhood friendtalking to oneself in a mirror |
| Story: | horror filmvacation gone wrongcabinhousefemale nudityf ratedmale nudityviolenceflashbackbare chested malefemale rear nuditytitle directed by femaleshotgunundressing …liemale pubic hairf wordapologydrowningtransformationtalking to the cameratentreunionstrong female charactercouplenipples visible through clothingtied to a bedmagazinebarefoot maletensionmale full rear nuditytied feetfemale directorplaybruisewedding receptionmemory losswifeset uprepeated scenedoubtreading aloudhoneymoonfemale psychopathmessagecabin in the woodsbaseball capmotorboatfemale villainsexual frustrationparasitemurderessmysterious womanestrangementwatching a videodeath by drowningundressing someoneimplied sexwet clothessleepwalkingslimefemale antagonistpancakenightgowntalking to oneselfhysterical womannewlywedssecretly observingwoman hits a manmissing womanshared showerrope bondagetwo in a showerwatching someone sleepmysterious eventwoman directorpost coital scenefishing rodmurder by drowningdice gamenaked outdoorsearthwormmissing wifewedding videobite marksleeping shirtlessbody snatchingfemale filmmakerpretending to sleepjust marriedskin diseasewoman wrapped in a towelreference to freddy kruegersuspicious husbandhuman behaviornewlywed couplerestauranteuranthilllightstied handsfrench toasthusband wife fightvaginal examfemale bondagelife preserverwoman tied to a bedblood pooltied mansurveillance videovaginal bleeding (See All) |
Five teenagers head off for a weekend at a secluded cabin in the woods. They arrive to find they are quite isolated with no means of communicating with the outside world. When the cellar door flings itself open, they of course go down to investigate. They find an odd assortment of relics and curios, … but when one of the women, Dana, reads from a book, she awakens a family of deadly zombie killers. However, there's far more going on than meets the eye. (Read More)
| Subgenre: | supernaturalblack comedyslasher flickteen horrorsupernatural horrorreality spoof |
| Themes: | monstermurdersurrealismsuicideghostdrunkennessgamblingsurveillanceapocalypse |
| Mood: | goresatireslasher |
| Locations: | woodslakegas stationtunnelcave in |
| Characters: | teenagerboyfriend girlfriend relationshipzombiesecurity guardwitchbabe scientistself referential |
| Period: | 2000s20th century1900s21st centuryyear 2009 |
| Story: | secluded cabineyegroup of friendscabincreaturefemale nuditybloodflashbackbare chested malesurprise endingpistoltelephone callshot to deathblood splattermachine gun …shot in the chestshot in the headcar crashcollegerobotf worddecapitationmassacreimpalementstabbed to deathstabbed in the chestsevered headman with glassesgravecharacter repeating someone else's dialoguevirginstabbed in the backclownperson on firediarymanipulationexploding bodymercenarydirectorial debutsevered armdismembermentsubtitled scenefreeze frametopless womanwerewolfhand grenadegrenadeathleterevelationswat teamsevered handcovered in bloodend of the worldeaten alivecelebrationredneckcameostabbed in the throatdark humorfalling to deathstabbed in the headthrown through a windowtitle at the endstabbed in the eyeaxe murdercharacters killed one by oneethnic slurcellarinterrupted sexmarijuana jointvideo surveillancestabbed in the handbonghuman sacrificestonerboy with glassesinterracial kissjapanese schoolgirlelectric shockcabin in the woodstentacleoffice workerbitten in the neckcarnagescarecrowjocksawgoblinstabbed in the shoulderfilmed killingtwo way mirrormusic boxwoman in a bikinimasked villainrecreational vehiclepsychological tortureku klux klantrapdoorlocked in a roomforce fieldevil clownhatchetunicorngiant spiderinternno survivorsbear trapgas station attendantdyed hairkiller clowngirl stripped down to pantiescyclopstorture chamberdirt bikezombie childtruth or darebody torn apartdead teenagerfilm reelcocktail partyscholarcubepuppeteerkilled in an elevatorgiant snakehorror icongrappling hookblonde stereotypeno cellphone signalblobevil godcontrol roomunderground bunkerpushed into waterritual sacrificestrange behaviorlovecraftianravinechasmanimate treemermantorture victimbulletproof glassspeaker phonedeconstructionswimming in a lakebloody hand printmountain roadyear 1903alpha maleboat dockpheromonesmounted animal headgroup of fiveconchgiant batharbinger of deathgiant handtrowelfalling into a lakebetting poolcaged monster (See All) |
| Subgenre: | found footagemockumentaryfake documentaryparanormal phenomenaparanormal investigation |
| Themes: | murderdeathsuicideghostdrinkingfearinvestigationevilcrueltypanicabortionmysterious death |
| Mood: | darknessnight |
| Locations: | woodssmall townforestcarboatvillagekitchenapartmentcitytown |
| Characters: | husband wife relationshipmother daughter relationshipboygirlpriestout of controlself immolation |
| Period: | 1970s2000s |
| Story: | scarefolklorehousebloodviolenceinterviewflashbackdogfightphotographtitle spoken by charactertelephone callfirebeatingcorpse …blood splatterfoodpunched in the facecameradrinksecretmaskbookrunningneighbordemonriverfightingtelephonejournalistvideo camerabridgeeatingman with glasseschilddrawingrituallooking at the cameratalking to the cameracursedangerscreamingperson on firepossessionstorytellingmissing personscreamdisappearancedarksacrificepsychickillingocculttv newsdestructionrevelationtape recorderwoman with glassesvideotapeeccentricdesperationdead womanhomicideapartment buildingmental institutiontokyo japanresearchhousewifehandheld cameradead mancellphonebalconydemonic possessionliving roomphoneneighborhoodpigeontelekinesisdead dogdark secretcar drivingrepeated scenecanoetelevision newsabandoned housecameramanflaskfilm starts with textconversationdamtelevision showmissingmediumpsychoanalysisfrightphone callmultiple murderritedead birdshrinewatching a videoanguishwindowhouse on fireanimal killingdoorclairvoyantnews footagephotoloss of controlvoicemultiple homicideextrasensory perceptionhostilitysickletelevision broadcastshaky cambomb shelterevil powerclairvoyanceobscurityanimal deathevil forceeccentricityembryophenomenonforces of evilmysterious noisestrange behaviorkillingsweird behaviorkyoto japanmysterious persontv journalistevil beingmysterious individualstrange noisedark powerraw footagemysterious voicepunch into the cameraevil spellyarnevil entitypsychological testingtelevision programtinfoilmultiple killingplanktonforce of evilectoplasmdiabolical possessionpsychic researchtinfoil hattelevision journalistdemonic entitydemonic force (See All) |
Phoenix Forgotten tells the story of three teens who went into the desert shortly after the incident, hoping to document the strange events occurring in their town. They disappeared that night, and were never seen again. Now, on the twentieth anniversary of their disappearance, unseen footage has fi …nally been discovered, chronicling the final hours of their fateful expedition. For the first time ever, the truth will be revealed. (Read More)
| Subgenre: | found footagemockumentarytragedyfake documentary |
| Themes: | friendshipfearinvestigationtravelevilabductionphotographypanicpolice investigation |
| Mood: | darknessnighthigh school |
| Locations: | carhelicopterairplanedesertairportpolice cargas station |
| Characters: | policefriendboybrother sister relationshipteenage girlteenage boygirlpolice officermilitary officerout of control |
| Period: | 1990s |
| Story: | scaredivorced parentssurprisegroup of friendshousebloodviolenceinterviewflashbackphotographwatching tvcamerasecretbookbeer …sunglassesrunningbirthdaybedbedroomflashlightmountainvideo cameramapman with glassesbirthday partyjourneylooking at the cameratalking to the cameradangerscreamingmissing personscreamdisappearancehigh school studentdarklaptopsadnessbrotherufosistertv newsrevelationjeepwoman with glassesnosebleedvideotapedesperationpress conferencegirl with glassesbloody noseplanelostarizonahandheld camerahighwayliving roomroomlighttriplaptop computervideo tapeexpeditiondark secretcar drivingdead animaldoubttelevision newsbitternessnight visionmilitary basemissingwalkingskyfrightriskwatching a videoanguishsymbolroadtapetalking while drivinghillvideo cassettephotoloss of controlmissing girlphoenix arizonamemoriesadolescent boyabandoned carair forceperilastronomeradolescent girlobscuritydeliriummysterious eventsuncertaintyair force basejeopardymysterious noisemissing brotherufo sightingdisorientationevil beingmilitary secretmissing boybroken marriagepetroglyphlost boylost personinterferencelightslost girlarizona desertlights in the skymysterious forcepetroglyphslost brothermysterious sound (See All) |
Beneath the fake blood and cheap masks of countless haunted house attractions across the country, there are whispers of truly terrifying alternatives. Looking to find an authentic, blood-curdling good fright for Halloween, five friends set off on a road trip in an RV to track down these underground …Haunts. Just when their search seems to reach a dead end, strange and disturbing things start happening and it becomes clear that the Haunt has come to them... (Read More)
| Subgenre: | found footagemockumentaryfake documentary |
| Themes: | deathfeartravelevilpaniccamping |
| Mood: | darknessnight |
| Locations: | barroad tripcampfiretexas |
| Story: | disturbingscaregroup of friendshouseviolencebare chested maleknifecamerawritten by directormasklow budget filmbathroomsubjective camerahalloweenvideo camera …maplooking at the cameratalking to the cameracursedangercostumescreamingclownscreamactor shares first name with characterhalloween costumedarkhauntingsleepinghaunted housemale underwearnew orleans louisianahandheld camerapumpkintripalleyburied alivenewscastfrightrecreational vehicleroadinvitationmonth in titlebegins with textscreaming in feardigital camerahaunted house attractionobscurityscreaming in horrorhands tied behind backhand camerapaintball gunmysterious noiseclown maskhalloween masklocked in a car trunkhauntmechanical bullrunning in the darkchaos in the darkbaton rouge louisianalights turned offscary clownhalloween nighthooded victimglowsticktyler texas (See All) |
Cristian and his sister, July, travel from Madrid to El Garraf with their parents and their little brother to spend the Holy Week in their old vacation home. They learn the legend of Melinda, a girl wearing a red dress that got lost in the labyrinth near the house, who helps people that also get los …t in the spot. Carlos, a visiting family friend, tells the siblings that there are different, more sinister versions of the legend. July and Cristian use two hand-held cameras to explore the labyrinth and investigate the mystery of Melinda, until something horrible happens. (Read More)
| Subgenre: | found footageindependent film |
| Themes: | murderdeathfearescapebrutalitysadismevilcrueltypanic |
| Mood: | darkness |
| Locations: | woodsforestspain |
| Characters: | boybrother sister relationshipgirlmother |
| Story: | scaresurprisehousebloodviolencedogphotographknifesurprise endingcamerasecretrunningsubjective camerabound and gaggedaxe …video camerasevered headlooking at the cameratalking to the cameralegenddangerscreamingscreamdarkbasementbrotherdismembermentkillingfreeze framesisterfireplacewatching a moviehomicidecrime scenehandheld cameradark pastaxe murdercellarlaptop computergatedark secretstaircasenight visionwellfilm starts with textcountry houserunfrightaltarlabyrinthchopping woodtrail of bloodstabbed in the footfamily vacationlost in the woodsobscuritybamboomysterious eventsrewindfast forward (See All) |
On a weekend camping trip, two struggling couples are haunted by La Patasola, a famed vampiric monster from Amazonian folklore, testing their relationships, morality, and will to survive.
| Subgenre: | supernatural horror |
| Themes: | monsterghostcheatingcamping |
| Locations: | woods |
| Characters: |
| Period: | 19th century |
| Story: | horror moviehorror filmvacation gone wronghiddenfolklorecreaturelegenddarktrippresentrunweekendhauntedcamping tripfemale …couplestestingmomentmarried with childrenfeature directorial debut (See All) |
In New York, Dr. Norman Boyle assumes the research about Dr. Freudstein of his colleague Dr. Petersen, who committed suicide after killing his mistress. Norman heads to Boston with his wife Lucy Boyle and their son Bob to live in an isolated house in the woods that belonged to Dr. Petersen. Bob befr …iends the girl Mae that only he can see and she warns him to leave the house. Soon his parents hire the mysterious babysitter Ann and creepy things happen in the house, When Bobby goes to the basement, his parents discover the secret of the house. (Read More)
| Subgenre: | supernaturalindependent filmcult filmsuspenseitalian horror |
| Themes: | monstermurderdeathghostjealousyfearpsychopathbrutalitysupernatural powerdeath of motherinsanitymental illnesssadismevilhome invasion …cruelty (See All) |
| Mood: | darknessnightmaregoreslasherblood and gore |
| Locations: | woodsforest |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipboyfriend girlfriend relationshipboyzombieserial killerkillervillainself mutilationslasher killermysterious villainserial murderer …ghost girlevil doctormysterious killerghost of mother (See All) |
| Story: | disturbingcreepyhousefemale nuditybloodviolenceflashbackphotographsurprise endingvoice over narrationcryingwoman on topcorpseblood splatter …slow motion scenepaintingdead bodyhallucinationscientistsubjective cameradecapitationfoot chasenewspaperflashlightaxemassacrestabbingthroat slittingstabbed to deathsevered headdream sequencechild in perilcharacter repeating someone else's dialoguedollevil manknocked outringscardirected by stardisappearancebasementtrapmurdererthreatened with a knifesevered armcult directorundeadblood spattermaniackilling an animalrevelationpokertape recorderbabysitterscene during opening creditsstabbed in the stomachpsychosevered handcovered in bloodgrindhousebroken legrampagereverse footagepillsstabbed in the throatstabbed in the neckbutcherpsychotronicimmortalityescape attemptscissorsstabbed in the headstairsdeath of protagonistslaughterdisfigurementh.p. lovecraftbody countcharacters killed one by onebloodbathpipe smokinglocation in titlepsycho killerclose up of eyesdead girlabandoned buildingserial murderpsychopathic killerreal estate agentbad guybeheadingmadmanmysterious manliving deaddirector cameokillold dark houseevil spirithomicidal maniactombstonedisposing of a dead bodytape recordinghead bashed inwormcarnageaudio cassettehanged manextreme violencegraphic violencemaggottoy gunzombie violencearm cut offsadistic psychopathpsychotronic filmbreaking through a doorold housestupid victimbutcheryglowing eyesgrindhouse filmbody partzombie attackmad doctorscreaming womanresearcherstabbed with scissorsexit woundends with texttoy cartrail of bloodblond boystabbed in the mouththroat rippingbitten handchild murdereritalian cinemademonicscalpingscreaming in horrordrive in classicspider webgory violencevideo nastyblonde childhearing noisesgruesomeseeing dead peoplerotting corpsevampire batpinestate agentlast man standingstabdark killerfire pokerattempted child murderlocked in a basementsadistic killermannequin headrotting fleshbat attackghostly figurehaunted buildingimpaled through the headknife through headripped neckslaughteredcreaking doorjammed doorslipping on bloodcellar doordragged down stairshole in the ceilingrotting body (See All) |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her … end up having to survive this swarm of evil until morning comes. (Read More)
| Subgenre: | independent filmcult filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror |
| Themes: | monstermurdersurrealismghostdancememorytime travelsadismbook of evil |
| Mood: | nightmaregoreavant garde |
| Locations: | woodsforestairplanekitchencastlestormbackwoods |
| Characters: | husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation |
| Period: | 1980s1990s20th centuryyear 1987 |
| Story: | secluded cabincabinsexnumber in titlebloodviolencesequelkisschasethree word titlesurprise endingpantiesvoice over narrationsongunderwear …blood splattermirrorshotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianodemonhallucinationdecapitationgood versus evilaxestabbingstabbed in the chestsevered headanti herotreecursestabbed in the backpossessionskeletonbasementhauntingratsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonshovelpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All) |
When hundreds of videotapes showing torture, murder and dismemberment are found in an abandoned house, they reveal a serial killer's decade-long reign of terror and become the most disturbing collection of evidence homicide detectives have ever seen.
| Subgenre: | found footagemockumentaryamerican horrorindependent horror |
| Themes: | murderdeathsuicidekidnappingrapefeartortureescapeinvestigationcorruptionpsychopathbrutalityguiltinsanityhumiliation …sadismevilhome invasionexecutionexploitationcrueltypanictraumamadnessmurder investigationmysterious deathpsychological trauma (See All) |
| Mood: | darknessnightgoreslasher |
| Locations: | hospitalcemeterywaterpolice carroad tripgas stationpennsylvania |
| Characters: | policeprostitutegirlpolice officerserial killerlittle girlvillainterrormysterious villainserial murdererout of controlmysterious killer |
| Story: | disturbingcreepysurprisehousefemale nuditynuditybloodviolencefemale frontal nudityinterviewbondageknifepantiesshowertelephone call …cryingbeatingcorpseblood splattercameramasktearsrunningbedbathroomtelephonereportersubjective cameranewspaperbedroomjournalistbound and gaggednew yorkaxevideo camerastabbingthroat slittingstabbed to deathprisonermapchild abusefalse accusationman with glasseschildgraveyardnews reportlooking at the cameratalking to the camerastalkerbeaten to deathscreamingfbimissing personevil mantragic eventstalkingautomobilethreatbasementtrapmurderernewspaper headlinedismembermentkillingchild murdermaniactv newsbreaking and enteringballoonstreetsexual abuseragemutilationsecurity cameracaptivefbi agentassaultvideotapedesperationpsychogrindhousevictimjournalismdriving a carrapistdead womantowelhomicidemasked mansubmissionslaverampagehookersufferingcouchkickingmercilessnessball gagstabbed in the neckanxietybutcherdespairscene after end creditspedophiledisembowelmenthandheld cameraperversiondead manmurder of a childhighwaybody countfemale reporternervous breakdownliving roominjusticecellarkilling spreemisogynychloroformpsychoticmasked killerpsycho killersurprise after end creditsdead girlpervertpsychopathic killerbad guymadmanmysterious manbrainwashingnecrophiliaset uppedophiliamisogynisthuman monsterhogtiesex slavesexual perversionsexual violencehomicidal maniactv reportermasochismslashingdegradationframednihilismamputationkidnappermissingdnasnuff filmsawnaked dead womandecadencemenacenervousnessdeath sentencemultiple murderchild molestertormentknife murderfemale prisonerpsychological tortureriskanguishbloody violenceroadfemale victimangstsadistic psychopathtapetalking while drivingmolestationmurder of a nude womanmurder spreecriminal investigationdisturbed individualbutcheryvideo cassettecrime spreecaptivitymissing daughterdepravityloss of controlfemale journalistsidewalkmissing girlstockholm syndromechild killedmystery killerfetishismmass mediamultiple homicideruthlessnessviral videosexual sadismchild killersexual crueltychild murdererbreakdownperiltorturerdead prostitutedehumanizationmissing womancollapsemasked womanknife attackserial child killerperversity911 callgrave robbingeast coastpsychological tormentgruesomeparaphiliadeviant sexglass of waterkidnapped womanunknown killerfemale fbi agentjeopardyinhumanitynecrophiliachelplessnessjustice systemmysterious personfbi investigationsexual devianttorture victimoutragephysical torturebound in chainsbrutalwoman in toweldna testhomicide investigationkidnap victimbrainwashassailantdysfunctionalityserial child murdersexual aberrationfemale slavedisturbed personfbi profilerloss of humanitydysfunctional societyneedlesprowlerfemale captivechelsea smiledefenselessnesstormentorphysical tormentpoughkeepsie new yorkdepravationhandsawdisturbed man (See All) |
There's something in this house... Something ancient and dark that remains still, hidden and silent. It can only wait, having been concealed in the shadows for years. In fact, its milieu is darkness. Only in it can it show itself and move. It even takes its name: DARKNESS. It's lived here since some …one tried to call it, more than forty years ago. Because this house hides a secret, a terrible past, an inconceivably evil act... Seven children, faceless people, a circle that must be completed. And blood, lots of blood... (Read More)
| Subgenre: | american horrorspanish horror |
| Themes: | murderbetrayalghostdysfunctional familyinsanitymental illnessphotography |
| Mood: | darknessrain |
| Locations: | swimming poolbathtubbuswheelchairtunnelspain |
| Characters: | father daughter relationshipteenagermother daughter relationshipchildrenboybrother sister relationshipteenage girlfemale protagonistlittle boydrivergrandfather granddaughter relationship |
| Story: | hiddenanswering machinehousebloodknifesurprise endingtelephone callbathroomgood versus evilbound and gaggedthroat slittingtied to a chairsubwaysnakechild abuse …cultdrawingrituallibraryportraitumbrellainjectionhaunted housechild murderrecord playeroccultsyringerevelationhypodermic needlegothicpillsgrandfatherstabbed in the throatstabbed in the neckmedicationthunderstormrainstormh.p. lovecraftswingtank toppillmysticismoverdosedead childrensecret societysatanismtraffic jamgramophonenihilismrazordarkroomold photographshapeshiftingswimmerpotatocut handpencilphonographvolkswagen beetleeclipseflickering lightthreat to killhidden roomhair dryerentitysolar eclipsesatanic ritualblueprintelectriciandriving in the rain9 year oldbox cuttervictrolachoked to deathold bookchild sacrificeestranged family memberfear of the darkslitting the throat of a childbanging on a doordrop of bloodgas stovemissing childrenyoung sonsuffocated to deathswimming lapsbloody handprintscruel fatherswimming bathshouse repairscolor pencilpuncture woundstartled by phone (See All) |
'REC' turns on a young TV reporter and her cameraman who cover the night shift at the local fire station. Receiving a call from an old lady trapped in her house, they reach her building to hear horrifying screams -- which begin a long nightmare and a uniquely dramatic TV report.
| Subgenre: | found footagecult filmmockumentaryb moviemock documentaryspanish horror |
| Themes: | murderdeathfearracismparanoiapaniccannibalismtraumaself sacrificemurder of a police officer |
| Mood: | darknessnightnightmaregoreambiguous endingone night |
| Locations: | helicopterpolice carspainfire truckfire station |
| Characters: | policemother daughter relationshipzombiepolice officerreligious icon |
| Story: | youngscarehousebloodviolenceone word titleinterviewchasesurprise endingpantiespistolcorpseshot to deathblood splattershot in the chest …face slapwatching tvfalling from heightshootingheld at gunpointhandcuffsreportersubjective cameravideo cameraambulancebasketballthroat slittingno opening creditslooking at the cameratalking to the cameralatex glovesgunshotmicrophonebeaten to deathdangerscreamingcharacter's point of view camera shotscreamactor shares first name with characterdarkisolationneck breakingfirst parthandgunfalling down stairsrevelationhypodermic needletape recorderrageloss of friendsalivacovered in bloodladderapartment buildingeaten alivegas maskcamera shot of feetspanishgash in the facespecial forcesinfectionfallblood on shirthandheld camerasiegedemonic possessionsirenfiremanblood on camera lensconfusionhysteriahit in the facebandageepidemicspiral staircasenight visionno title at beginningsecurityroadblockbitten in the neckbleedingkiller childshockquarantinegraphic violenceopen endedfrightbreaking through a doortelevision reporterbludgeoningloudspeakerstairwellbitetrail of bloodemergencybarricadebasketball courtzombie childemaciationtelevision broadcastfire engineflesh eatingremadeobscuritynight shiftscreaming in horrorsledge hammeranthropophagusfire hosemallethorror movie remadehandcuffed to a pipebitten in the facefire departmentpossessed girlflesh eating zombiesinfectious diseasebiting someonerewindpolice tapespeaker phonecontamination suithealth inspectorno background scorevideographerill childmedical internsick animaltv news crewlocked in an attichand over camera lens (See All) |
It has been sighted 42,000 times in 68 countries. A creature of myth and legend known by several names; Yeti, Sasquatch and the infamous Bigfoot! We've hunted it for years, but what happens when it decides to hunt us? "Abominable" centers on a man recovering from a mountain climbing accident, trappe …d in a remote cabin in the woods, who sees the legendary beast, and must convince someone to believe him, before the monster goes on a bloody rampage. (Read More)
| Themes: | monsterpanic |
| Locations: | woodswheelchaircave |
| Characters: | police |
| Story: | cabincreaturefemale nuditynuditybloodfemale frontal nudityshowercell phonecar accidentshotgunflashlightambulancebinocularsobscene finger gesturehunter …pump action shotgunpower outagethrown through a windowfemale in showerwilhelm screamclose up of eyesbigfootsasquatchwoman undressingrock climbingfootprintman in a wheelchairthroat rippinghuman skullcrawlingdead horserappellinganimal bitecar horntoasting marshmallowscar crashing into a treemonolithcell phone out of rangeinjected in neckdragged along the groundface bitten offprescription bottlecamp sitedouble bitted axethrown through windshieldanimal bone (See All) |
Thanks to a major power cut, a gang of psychopaths breaks out of the Haven maximum security mental institute in order to lay siege to the psychiatrists who have tormented them over the years with their bizarre theories...
| Subgenre: | independent filmcult filmblack comedysuspensedark comedyamerican horror |
| Themes: | murderdeathrevengeescapepsychopathbrutalityinsanitymental illnessevilpolice investigation |
| Mood: | darknessnightnightmaregoreslasher |
| Locations: | woodssmall towncarsnowbicyclebackwoods |
| Characters: | family relationshipsdoctorbrother sister relationshipserial killerkillervillainterrorslasher killerserial murderer |
| Period: | 1980s |
| Story: | disturbinghousebloodviolencefemale frontal nudityknifepantiestelephone callfireblood splatterdead bodyjailconcertstabbingdiner …child in perilvanstalkerevil manstalkingbasementmurderermaniacelectronic music scorebabysittermutilationnosebleedgrindhousepsychologistvictimrapistmental institutionrampagewoman in jeopardycrossbowpower outagethrown through a windowpedophilemurder of a childsiegeintruderbody countmasked killerpervertpsychopathic killerbad guymental patientfire extinguisherblackouthomicidal maniacshot with an arrowslashingmeat cleavergraphic violencechild molestermasked villainknife murdermailmanbloody violencefemale victimmass murderergrindhouse filmcreeplootingmental asylumsecurity systembarricadechild killerchild murdererhockey masktorturerdaydrive in classicserial child killereast coastgruesomemutilated bodyescaped killerattempted child murdermetal musicmental wardserial child murderspringwood ohioserial child murderercut telephone line (See All) |
When a normal American family moves into a beautiful old English house in a wooded area, strange, paranormal appearances befall them in this interesting twist to the well-known haunted-house tale. Their daughter Jan sees, and daughter Ellie hears, the voice of a young teenage girl who mysteriously d …isappeared during a total solar eclipse decades before... (Read More)
| Subgenre: | supernaturalcult filmparanormal phenomena |
| Themes: | revengesurrealismsupernatural power |
| Locations: | woodsforestchurchbicyclefarmengland |
| Characters: | family relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipchildrenteenage girlfemale protagonistalienmusicianwritersister sister relationshiplittle girlchildhood friend |
| Story: | youngcreaturehousebased on novelflashbackchasefiredreammirrorblondemasktearscar crashsubjective cameramansion …exploding carcoffinold womandrowningmissing personlightningpianistdisappearanceblindfoldtypewriteroccultspiritfireplacegothicbarncomposercarnivalrealityfull moonthunderpastpet dogbroken glassrainstormlanternpuppyhorseback ridingtombceremonyreal estate agentruinsapparitionblindfoldedseancebicyclingsecret societybroken mirrorbellpremonitionpondstation wagonpsychic powerchapelmusic boxmysterious womansymbolhermitold housealternate dimensionhorror for childrenmysterious strangercandlelightchurch bellinitiationsheet musiceclipsefairgroundmotocrossextrasensory perceptiondirt bikesolar eclipsegrand pianohummingtriangledimensioninitiation ritecountry homeabandoned churchdistorted voicedead daughteramusement park ridebrushing hairtalking in sleepflashing lightother worldbackwardslightning strikewriting on mirrorshattering glassblue lightcracked mirrorvictorian housecut fingerstained glasscollapsing bridgetransferencerunaway horsestalled carfun househouse of mirrorsportable radiotrapped in a mirrorenglish villagewriting backwardsghostly voicewind gust (See All) |
Bristling with equipment, two enthusiastic local access cable TV producers recruit an assistant and venture into a forest in search of the mythical and horrifying Jersey Devil. Days later, only one of the trio emerges. He becomes the prime suspect in the disappearances of the other two. However, a l …ocal filmmaker examines extensive footage found at the scene and arrives at a different conclusion. (Read More)
| Subgenre: | found footageindependent filmfake documentary |
| Themes: | murderdeathinvestigationmagicevilmysterious death |
| Mood: | darknessnight |
| Locations: | woodsforestsnowbackwoodsblood on snow |
| Characters: | detectivefilmmakermysterious killer |
| Period: | winter |
| Story: | surpriseviolenceinterviewsurprise endingcomputercamerasecretsubjective cameravideo camerainternetlooking at the cameratalking to the cameramicrophonedangerfilm within a film …darksuspicionkillingrecord playerlive broadcastrevelationvideotapeeccentricphone boothcamppsychopsychologisthomicideevidencehandheld cameralandlordvideo tapesuffocationmysterious mandark secretblood stainvhsroadtapedocumentary crewlong haired malecard trickdocumentary filmmakerplastic bagtelevision broadcasthidden truthlost in the woodsquestioningforensic evidenceobscuritycamera crewfake news reporttelevision crewear piercingyoung filmmakerjersey devilinternet broadcastarrest recordforensic psychiatrist (See All) |
HOLIDAYS is an anthology feature film that puts a uniquely dark and original spin on some of the most iconic and beloved holidays of all time. The film challenges our folklore, traditions and assumptions, making HOLIDAYS a celebration of the horror on those same special days' year after year. A coll …aboration of some of Hollywood's most distinct voices, the directors include Kevin Smith (Tusk), Gary Shore (Dracula Untold), Scott Stewart (Dark Skies), Kevin Kolsch and Dennis Widmyer (Starry Eyes), Sarah Adina Smith (The Midnight Swim), Nicholas McCarthy (The Pact), Adam Egypt Mortimer (Some Kind of Hate), and Anthony Scott Burns (Darknet). (Read More)
| Subgenre: | holiday horrorchristmas horror |
| Themes: | monstermurderchristmaspregnancytorture |
| Mood: | darknessnightvignette |
| Locations: |
| Characters: | witchfatherpregnantwriter directorlove letter |
| Story: | holidaysfolklorebloodviolenceone word titleorgyrevolverstripperhalloweensnakenunanthologyscreamdarkholiday …coachnew year's evepillsheadphonestied feetmasked killerlaptop computerbody in a trunkeasterhandvalentine's daymurderesstied up while barefootheart ripped outpsychotronic filmsevered footholiday seasongrindhouse filmnew wavemidnighttalevisual effectsmidnight movieheadsetdiving boardeaster bunnyvalentinewoman directorbox cuttermother's daycassetteeaster eggmedicine cabinetfather's dayst. patrick's dayhorror anthologycar batterydating siteideabullying victimcrown of thornsmysterious packageblood on armpagan cultvibrator in anus (See All) |
Tourists take a boat to a remote island, where they find that most of the people have disappeared, and something is stalking them. They find a hidden room in the big mansion on a hill, and an ancient diary, which gives them clues to the source of the terror.
| Subgenre: | independent filmcult filmb movieb horrorpsycho thrillerslasher flickindependent horroritalian horror |
| Themes: | murderdeathsuicideghostpregnancyfearpsychopathbrutalityinsanitysadismcrueltydeath of wifepaniccannibalismabortion |
| Mood: | darknessnightnightmaregoreslasher |
| Locations: | woodsforestbeachhotelcemeteryboatseacable car |
| Characters: | husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipvillainterrorgermanself mutilationsuicide by hangingself cannibalism |
| Story: | hiddendisturbinghousebloodviolenceone word titleflashbackbare chested malecigarette smokingphotographknifecorpseblood splattercatbikini …falling from heightvomitingrunninglow budget filmpianoislandsubjective cameracandlevideo cameramansionstabbingthroat slittingstabbed to deathstabbed in the chestsevered headcontroversygraveyardsmokingcharacter repeating someone else's dialoguestabbed in the backscreamingvacationmissing persondeath of childskeletonhangingdiarydisappearanceratthreatened with a knifeeuropeblood spattersplatterchild murdermaniacrevelationelectronic music scoremachetetouristmutilationstabbed in the stomachpsychocovered in bloodgrindhousevictimskulltorchrampagecannibalmercilessnesspower outagegreecebutcherheadphonespsychotronicstairsthunderstormstabbed in the legdisembowelmentatticschoolgirl uniformbody countcharacters killed one by onebloodbathpsycho killerintestinesserial murderpsychopathic killerbad guymadmanhair pullingold dark househuman monsterstrandedabandoned househomicidal maniacdisposing of a dead bodyslashingbitten in the neckdripping bloodmeat cleaversummer vacationguitar playerseizureuniversity studentbleeding to deathextreme violencemacabremurder attemptknife murderdeformitywoman smokerloss of familysadistic psychopathpsychotronic filmcut handmurder spreedragging a bodyhusband murders wifeathens greecebutcherygrindhouse filmcompassclairvoyanthead ripped offsleeping on a couchbitten in the throatunwed pregnancycandlelightwoman in bikiniblind girlknife in the chesttarot cardtrail of bloodchild killedfalling off a roofpick axeferry boatpsycho terrorgutswriting on a wallbody torn apartboneshanged womanitalian cinemapickaxedrive in classicstabbed in the foreheadanthropophagusends with deathhuman fleshinfamydesert islandbowelsvideo nastymurder of a pregnant womaneating human fleshgreek islanduxoricideeviscerationsandcastlewombboat trippsycho filmnotorietychild eatendeath of pregnant womandeserted townancient ruinsdeath of expectant motherpregnant woman in jeopardytranquilityfalling from a boatscare involving cathypothesiskerosene lanternmurder of an unborn childbucket of bloodhigh heel (See All) |
Margaret and Ben take a weekend trip with longtime friends Ellie and Thomas and their two young children. Eventually, Ben begins to suspect something supernatural is occurring when the kids behave strangely after disappearing into the woods overnight.
| Subgenre: | supernaturalsupernatural horrorpsychologicalpsychological horror |
| Locations: | woods |
| Characters: | children |
| Story: | horror moviehorror filmleaveshiddencreepyyoungcabinrunningvacationhomeensemble castshadowbuildingplaypunch …tripprayingset upkidkidspitminddealmantisgender rolescamping tripfuntalementalplayingcharacter drivenpraying mantislearnsound effectexploringunexplainedold buildingemotional turmoilweekend trippersonalwake upyoung childrenbottomless pitmental issues (See All) |
Documents one family's descent into darkness, using a compilation of found home-made footage. In the remote woods of upstate New York, the Poe family lives a Norman Rockwell life. Perfect house. Perfect marriage. If only the children stopped stapling frogs to trees. Something is very wrong with Jack … and Emily Poe, the ten-year old twins. And, to stop them, their parents must enter the nightmare of their minds. The only question is: who will survive the night? (Read More)
| Subgenre: | found footageindependent filmmockumentaryfake documentary |
| Themes: | murderchristmasdrunkennesspsychopathcrueltymadness |
| Mood: | darknessnightnightmare |
| Locations: | woodsforest |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshippsychiatrist |
| Story: | housebloodknifesurprise endingshowerbeatingmaskvomitinglow budget filmsubjective camerahalloweennew yorkvideo cameratied to a chairchild abuse …severed headdrawingchild in periltalking to the cameraattempted murderdragonstorytellingknocked outcharacter says i love youdirectorial debuttherapyholidaykilling an animaltied to a bedfrognew year's evehome movieministermedicationattictuxedoexorcismthanksgivinghit with a baseball batdead dogcrucifixionbag over headrepeated scenestabbed in the armclimbing through a windowgoldfisheasterkiller childvalentine's daydead catdragging a bodystupid victimholy watercandlelightwagonice cream truckfamily photographnailtied to a tableshaky camhit with a rockpicking a lockschool expulsionson murders motherthrowing a rockclubhousedreaddrugged foodeaster egghead on a stakeanti social behaviorbite markjack danielsrewindreference to paris hiltondisturbed childdaughter murders fathertrash bagirresponsible parentreference to scooby doofast forwardpsychological testingtwin brother and sisterdaughter murders motherbunny suitchild murders an adultnew year's resolutiondouble homicidepsychotic child (See All) |
When a small town is invaded by aliens from outer space who are capturing and killing the townspeople, no one takes them seriously. Why? The aliens all look like circus clowns, use weapons that look clown like, and all have painted on smiles. Only a few of the young people in the town realize the da …nger and of course no one believes them. Armed with an ice cream truck they try and rescue their friends. (Read More)
| Subgenre: | independent filmcult filmb moviepunk |
| Themes: | monstermurderjealousy |
| Locations: | woodssmall townforestbicyclepolice stationpolice car |
| Characters: | policeboyfriend girlfriend relationshippolice officeralienpolicemanvampireex boyfriend ex girlfriend relationship |
| Period: | 1980s |
| Story: | youngiceblooddoggunkisstitle spoken by charactershowershot in the chestbeerbathroomjaildecapitationflashlightold man …severed headspaceshippolice officer killedclownpuppetcollege studentexploding bodyufochild murderpizzanerdballoonice creamspacecraftparadebikereaten alivealien invasionpsychotronicamusement parkgeekextraterrestrialcandylevitationpopcornpiepizza deliveryalien contactdumpsterexploding shiptoy guntongue in cheekbiker gangevil clownboxing glovesnetdrugstoreice cream truckblood drinkingkiller clowngun shotpuppet showmarionettenosecotton candydisbeliefpie in the facealien space craftcocoondisbelieving adultstrawshadow puppetbloodhounddrinking strawballoon animalcircus tentbig toplovers lanepie throwingdisbelieving authorities (See All) |
In a red light district, newswoman Karen White is bugged by the police, investigating serial killer Eddie Quist, who has been molesting her through phone calls. After police officers find them in a peep-show cabin and shoot Eddie, Karen becomes emotionally disturbed and loses her memory. Hoping to c …onquer her inner demons, she heads for the Colony, a secluded retreat where the creepy residents are rather too eager to make her feel at home. There also seems to be a bizarre connection between Eddie Quist and this supposedly safe haven. And when, after nights of being tormented by unearthly cries, Karen ventures into the forest and makes a terrifying discovery. (Read More)
| Subgenre: | independent filmcult filmstop motionstop motion animationcreature featuresurvival horror |
| Themes: | monstermurderdeathlovefriendshipmarriageinfidelityrapejealousyadulterydeceptioncorruptionsupernatural powerunfaithfulnessfalling in love …amnesiaself sacrificehuntingmurder of brother (See All) |
| Mood: | nightgore |
| Locations: | woodsforestbarbeachlos angeles californiarural settingofficegas stationcampfire |
| Characters: | brother sister relationshipfemale protagonistserial killerpolicemanlustpsychiatristsheriffolder man younger woman relationship |
| Period: | 1980s |
| Story: | creepycabinfemale nuditybased on novelnuditymale nudityfemale frontal nuditytwo word titlesex scenekissfemale full frontal nuditynipplessurprise endingfire …fondlingcorpseshot to deathmirrorblondecamerabare buttriflevoyeurold mancaliforniaaxefemale pubic hairexploding carbrunettedream sequencedrawingtransformationdangerscreamingfirst of seriespay phonesensualitystalkingarsoncorrupt copwerewolftv newsburned alivedesiredressgothictape recordermorguephone boothdesperationsevered handgrindhouseforbidden lovehomiciderampagewoman in jeopardyreverse footagebookstorefogperversionvegetarianbarbecueattractionlens flaresurprise after end creditsbushcartoon on tvbandagesexual perversionacidrestroomsecret societycattlegroup therapyjacketsuicidalmetamorphosisflameorchestral music scoreshape shifterclawshapeshiftingpleasurecolonymurder victimregenerationfangsnews anchorawakeninghowlingwearing a sound wirehuman preyporn looplycanthropycampfire storysilver bulletfemale werewolfgrowlingwildfirecovelycanthropeadult bookstorewerewolf transformationwerewolf bitebloody scratchwerewolf packwerewolf family (See All) |
A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old …televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)
| Subgenre: | found footagesupernatural |
| Themes: | murderdeathghostdrunkennessdeceptionsupernatural powerevilhome invasionreligious cult |
| Mood: | darknessgoreone night |
| Locations: | forestbarroad triplakemotel |
| Characters: | husband wife relationshipzombiealienkillerghost in mirror |
| Period: | year 1998 |
| Story: | horror filmhousefemale nuditybloodmale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudityfemale full frontal nuditytitle spoken by character …male full frontal nudityknifelesbian kisstopless female nuditycorpserescuedemontelevisionsubjective cameradecapitationhalloweenflashlightgangvideo camerathroat slittingimpalementcocainestabbed to deathsevered headritualanthologylooking at the cameratalking to the cameraskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love youhaunted houserevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmenthandheld cameraone daytitle at the endknife throwingcastrationlooking at self in mirrorlens flareabbreviation in titlecharacters killed one by onefortune tellermarijuana jointblood on camera lenswoman cryingwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All) |
1976: Two young journalists leave for the French-Swiss border to investigate a strange case of cattle mutilations and record testimonies for a TV channel. Yet, once they get there, the scientific team they were supposed to meet has gone missing. Escorted by a first-aider, a British biologist and an …American forensic investigator, Melissa and David will go looking for the missing team deep into the mountains. (Read More)
| Subgenre: | found footageb movieb horror |
| Locations: | forestsnow |
| Period: | 1970s |
| Story: | horror moviehiddenyoungscarecoldicecameratrapteamhandheld camerabordermutationclimate changecattlemissing …on locationrunbonehillrecordno survivorsfreezingcold weathercasemountains70stelevision networkbloodyscientificleaveshot on location (See All) |
A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.
| Subgenre: | cult filmcreature featuresurvival horrorbritish horror |
| Themes: | monstermurderdeathfriendshiprevengeinfidelitybetrayalghostdrinkingfearescapebrutalityguiltgriefpanic …cannibalismblindnessmurder of familyclaustrophobia (See All) |
| Mood: | nightmaregore |
| Locations: | woodsforesthospitalcarcavecave in |
| Characters: | husband wife relationshipfriendfemale protagonistbest friendlittle girl |
| Story: | group of friendscabincreaturef ratedbloodviolencetwo word titlephotographknifesurprise endingcryingbeatingcorpseblood splattercar accident …blondefalling from heightbookvomitingliehallucinationsurvivalflashlightmountainvideo cameradeath of friendwomanthroat slittingimpalementstabbed in the chestunderwater scenenecklacesmokingbeaten to deathdolldarkisolationneck breakingfirst partunderwaterwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorlifting someone into the airvictimskullcheating husbanddriving a cartorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandkilling spreeblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All) |
A group of friends think they found the perfect easy score - an empty house with a safe full of cash. But when the elderly couple that lives there comes home early, the tables are suddenly turned. As a deadly game of cat and mouse ensues, the would-be thieves must fight to save themselves from a nig …htmare they could never have imagined. (Read More)
| Subgenre: | body horrorpsychological |
| Themes: | home invasion |
| Mood: | nightmareone night |
| Locations: | small townout of town |
| Characters: | doctorgirldoctor who |
| Story: | young adultshorror moviehorror filmhiddenyoungsurprisegroup of friendshousefightcatbasementdirectorial debutcouplegamemouse …hometensioninvasionsafeone dayboyfriendsexual assaultroomwifebreak inelderlyunplanned pregnancyreturnplancashtwin sistercat and mousedoctor's officefrying pangraphic novelfeature filmover the topelderly couplesingle locationold couplereturn homeempty houselocalisolated housedining roombattle of witsgross outphysical tortureterritoryfinal girlcup of teamentally illill wifehorror fanleaveold fashionedstand offaspect rationail bitinglovable loserfeature directorial debutthe secret (See All) |
Cox and Hirsch play father and son coroners who receive a mysterious homicide victim with no apparent cause of death. As they attempt to identify the beautiful young "Jane Doe," they discover increasingly bizarre clues that hold the key to her terrifying secrets.
| Subgenre: | supernaturalsupernatural horror |
| Themes: | murderdeathrevengefeartorturebrutalitysupernatural powersadismevilcrueltypanicmysterious death |
| Mood: | darknessnightgoreone nightblood and gore |
| Locations: | elevatorpolice carstorm |
| Characters: | father son relationshippolicezombiepolice officerbiblewitchsherifffathergirlfriendout of control |
| Story: | youngscaresurprisefemale nuditycharacter name in titlenuditybloodviolencebare breastsfemale frontal nudityfemale full frontal nuditynipplestitle spoken by characterfire …topless female nuditybeatingcorpseblood splattercataxeman with glassesradioritualpaindangerdarkkillingundeadsplatterdestructionrevelationmutilationmorguewitchcraftaccidental deathdead womanhomicidecrime scenesufferingsonpower outageescape attemptdisembowelmentautopsyheartdead mandark pastbruisedead girldark secretblackoutscalpelbellbleedinghallwaynaked dead womanfrightmultiple murdersorceryorganeyesloss of controlcorridortoothtortured to deathexaminationmultiple homicideliftsevered tongueevil powerdissectionevil forceaccidental murderbroken anklepower cuteviscerationforces of evilattempted escapekillingstorture victimlungsbroken bonedark forcestormy nightbruiseslungwhite eyesbroken wristmultiple killingforce of evilautopsy roomscar tissuemissing toothforces of darknessgrey eyescause of deathroman numeral (See All) |
This is the story of an isolated Alaskan town that is plunged into darkness for a month each year when the sun sinks below the horizon. As the last rays of light fade, the town is attacked by a bloodthirsty gang of vampires bent on an uninterrupted orgy of destruction. Only the small town's husband- …and-wife Sheriff team stand between the survivors and certain destruction. (Read More)
| Subgenre: | cult filmsuspense |
| Themes: | murderdeathsuicidemarriagefearbrutalitysupernatural powerdeath of wifewritingself sacrificemurder of a police officerwilderness |
| Mood: | darknessnightgore |
| Locations: | small towncarsnowairportshiptrucktownalaskaout of town |
| Characters: | brother brother relationshipvampiresheriffterrorgrandmother grandson relationshippolice arrestdeath of heroblood lust |
| Period: | 2000swinter |
| Story: | frozencoldcreaturenumber in titlebloodviolencedogexplosionknifepistolfirecorpsedigit in titleshot to deathblood splatter …car accidentshot in the chestshot in the headshotguncomputerfalling from heightbookbased on comicriflecar crashmarijuanajailhandcuffsorgyshot in the backdecapitationflashlightbased on comic bookgangaxethroat slittingimpalementdinerstabbed in the chestsevered headno opening creditschild in perilhit by a cargunshotperson on firereadingkicked in the facedeath of childscreaminjectionautomobileisolationneck breakingloss of fatherpolicewomansevered armshot in the armdismembermentundeadarsonpowercouplerecord playerdestructionkilling an animalrevelationhead butthypodermic needlecomic bookmutilationvandalismwalkie talkiebeardhidingwatching a movieexploding buildingloss of wifedesperationsevered handstrangerbroken legseriesteamstabbed in the neckoildeath of protagonistexploding headsundynamiteatticmurder of a childalzheimer's diseasemarital separationaxe murderlightsirenwilhelm screamseparationtorso cut in halfdead dogvodkabeheadingbarking dogsunsetwifeharborset uptractordead animalkilling a doghead blown offstrandedsubtitlesblonde womanmini dressblackoutcomicasthmalanguagebearded manburnt facehunthit by a truckbased on graphic novelmercy killingblizzardbitten in the neckbloody body of childsunrisecrushed headpotburnt bodycomicsfemale police officerdeath of grandmothersuperhuman strengthcut into piecesloss of familylunaticsnowmobiletoothlong haired malebear trapthroat rippingphonograph recordremotechevroletset on firewheelbarrowbitten handlocationgeneratorgraphic novelnumberburned bodyburning carbaitestranged couplelittle brotherover the topskull crushingestranged wifemarriage crisisbroken ankledark horse comicslocked upclosing credits sequencevampire versus vampiretundrahead on a stakehusky dogmini serieshand through headsled dogchild vampirevampires29 year olddog killedpopulationremote locationgraphicoil pipelineshort dresstraffic violationthroat slitreference to bela lugosihuman versus vampirehusband and wifeopening creditsanimal killedharbinger of deathhuskyidw publishingwife killedbad teethanimal violenceidw comicsdeath by sunrisedrilling for oilman's best frienddeath of animalgmc truckmusic video directorbarrow (See All) |
The counselors of Pine Hills Summer Camp are getting the grounds ready for the season. While they set up, a mysterious girl enters the camp after a night of bloodshed. And there are things following her as well.
| Subgenre: | teen comedymonster movie |
| Themes: | monsterdeath |
| Mood: | nightslashermysteriouszombie film |
| Locations: | woodscave |
| Characters: | zombiegirlsheriffmysterious girl |
| Period: | summer80s |
| Story: | young adultshorror filmyoungeyecreaturesexnuditybloodfightrunningsurvivalscreamingpuppetattack …tentcrosscouplechainsawcamppicnicadolescenttableset upblackteethparasitebloodshedkidsclotheseyescheckfakeinformationdirectionskinfunpartyingplasticcasebloodyseasonfinal girlgorypurposecontact lensesspraygrowingpicnic tablejokesremainsteasersharp teethdeath tollblood spraycasual nudity (See All) |
A young woman studying the habits of webcam chat users from the apparent safety of her apartment witnesses a brutal murder online and is quickly immersed in a nightmare in which she and her loved ones are targeted for the same grisly fate as the first victim.
| Subgenre: | found footage |
| Themes: | murderdeathfearescapeinvestigationvoyeurismpsychopathbrutalitysadismevilabductioncrueltypanicmurder of a police officermysterious death |
| Mood: | darknessnightmare |
| Characters: | policefriendboyfriend girlfriend relationshippolice officerpregnantmysterious killer |
| Story: | youngscarehousesexfemale nuditynuditybloodmale nudityviolencemale frontal nuditybare chested malegunfight …title spoken by characterknifepantiesbeatingshot to deathblood splattercomputercameramaskshootingbedcar crashvoyeurfightingsubjective camerabedroombound and gaggedstabbingstabbed to deathinternetlooking at the cameratalking to the camerapoint of viewdangermissing persondarklaptopkillingwoman with glassesdesperationpsychohomicidepet dogzooescape attemptperversionspyinge mailcellphoneliving roommasked killerpsycho killerhackerwebsitesexual perversionwebcammessagesnuff filmrussian roulettefrighttextingknife murderinternet chatriskanguishtalking about sexhackingthroat cutsexual arousalsexual innuendodigital camerarunning for your lifechatperilhanged by the neckperversityvideo chatcomputer screensoftwarewoman in pantiessmart phonejeopardyinternet researchstabdistressmysterious personmysterious individualhelmet cameraball peen hammersuffocated to deathsnuff videostrangled with a chainhooded killerstabbed over and over (See All) |
For young Charley Brewster, nothing could be better than an old horror movie late at night. Two men move in next door, and for Charley with his horror movie experience, there can be no doubt that their strange behavior is explained by the fact that they are a vampire and his undead day guardian. The … only one who can help him hunt them down is a washed-up actor, Peter Vincent, who hosts Charley's favorite TV show, Fright Night. Vincent doesn't really believe that vampires exist, but does it for the money... (Read More)
| Subgenre: | cult filmpost modernstop motion animationteen movieteen horrorhorror spooflgbt horrorvampire comedy |
| Themes: | deathherovoyeurismseductionsupernatural powerfaithpolice investigation |
| Mood: | nightgorespoof |
| Locations: | small townnightclub |
| Characters: | policemother son relationshipteenagerboyfriend girlfriend relationshipteenage boyserial killerdetectivepolicemanactorvampiresingle mothervillaingirlfriendparent child relationshipneighbor neighbor relationship |
| Period: | 1980s |
| Story: | horror movieyounghousefemale nuditynuditybloodmale nudityviolencemale rear nuditytwo word titlebare chested maleguntitle spoken by characterchase …surprise endingpistoltopless female nudityshot to deathmirrorshot in the chestpunched in the facewatching tvwritten by directorundressingfalling from heightpaintingheld at gunpointneighborvoyeurgood versus eviltoplessimpalementstabbed in the chestsevered headcoffinnews reporttransformationshot in the foreheadbinocularsvirginsuburbskeletonscarhigh school studentstalkingcrossexploding bodywitnessbasementcharacter says i love youfirst partundeadwerewolffalling down stairswolfburned alivelifting someone into the aircrucifixhunterteenage protagonistwoman in jeopardyreverse footagehypnosisjumping through a windowfriendship between boysdead boylevitationstabbed in the handhorror hostmale friendshipcamera shot of bare feetbroken mirrorkiss on the lipsrhyme in titlebitten in the necksuper powerbra removingbloody violencevampirismhomosexual subtextvampire hunterpsychotronic filmblack copghoullifting person in airglowing eyesgrindhouse filmholy watervampire slayerjumping out a windowtv hostthroat rippingolder man young girl relationshiphand injurystakelifted by the throatnext door neighborgarlichowlingsunlightnew neighbortv starremadewashed up starstabbed in the heartshort haired femalevampire bitehorror movie remadered eyesthreatening telephone calldead body in a car trunkteenage sonpointing a gun on someonevampire batseductive manboyfriend girlfriend conflictreflection in a mirrorgrabbed by the throatstabbed with a pencilfanboyeviction noticeusa horror hosttv personalitymale vampireseductive dancereflection in mirrormelting manbat attackreference to bela lugositeenager in dangerhuman versus vampirestake through the heartno reflectionvampire driving a carthrown across a roomtruth taken as a liereference to christopher leenosy motherpunch catch (See All) |
XX is a new horror anthology with a gender twist - all segments will be helmed by female directors and will star female leads. The directors have been given free creative rein within budget and time constraints, but all of the segments themselves will involve the horror genre.
| Subgenre: | supernaturalstop motionsupernatural horror |
| Themes: | monsterdeathchristmasdrinkingfearexploitationcannibalismself sacrificedeath of daughterstarvation |
| Mood: | nightmare |
| Locations: | hospitaltrain |
| Characters: | family relationshipshusband wife relationshipmother son relationshipdoctorsingle motherlittle boymotherfather |
| Story: | group of friendscreaturehousef ratedbloodviolencedogvoice over narrationdreamcorpsefoodwritten by directorsecretfalling from heightbirthday …dead bodysubjective cameraeatingwidowdinnerchild in perilbirthday partyanthologytransformationscreamingcharacter's point of view camera shotdolldeath of childgiftdeath of sondeath of husbandblood spatterpizzatwenty somethingbirthday cakebroken legsonshadowfamily dinnerboxfemale directorpresentbarking dogchristmas presentbirthday presentevil spirithikingcostume partyfallingeating disorderbechdel test passedrecreational vehiclehipsterspaghettiviolent deathantichristevil childbitten handghost costumefangsemaciationdollhousemotor homepossessed humanpossessed womanmarital strifeclawsrefusing to eathiding a dead bodybroken boneanimal mutilationrvsinging telegrampetroglyphstarving to deathtoenailmysterious objectstarving oneselfthrown through windowbelief in the supernaturalnuclear familyfalling down a mountainwalking up a wallparent teacher meeting (See All) |
A young girl witnesses her brother murder a man through a reflection in a mirror. Twenty years later the mirror is shattered, freeing his evil spirit, which seeks revenge for his death.
| Subgenre: | independent filmcult film |
| Themes: | murderdeathrevengedrinkingfeardrunkennessangersupernatural powerevilpanictraumavengeancechildhood trauma |
| Mood: | darknessnightnightmaregoreaffection |
| Locations: | churchcarcemeterykitchen |
| Characters: | husband wife relationshipmother son relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyserial killerpriestpsychiatrist |
| Story: | caughtyounghousebloodviolenceflashbackkisstitle spoken by characterknifepantiesfiredreamunderwearfoodmirror …drinkletterrunningbedbathroomalcoholbedroombrabound and gaggedstabbingimpalementstabbed to deathchild abusechildfishinggraveyardcursedangerstabbed in the backscreamingpossessionevil manscreamactor shares first name with charactertied upcoupleropeelectronic music scoresexual attractiontied to a bedcrucifixdesperationsexual desirewindcouchstabbed in the neckmutebroken glassscissorsdead childspyingdemonic possessionliving roomlightpsychoticreflectionold dark housebottleskirtsilentbroken mirroractress shares first name with characterrobeshirtmurder witnesssofarunfrighttied up while barefootknife murderpitchforkabusive boyfriendold housedisturbed individualcurtainabusive mothercapstabbed in the mouthliquormistreatmentblouseevil powerfragments of glassforced suicidetrousersripping clothesvideo nastydouble impalementmultiple stabbingreading letterknife through the neckchild witnessstocking masktraumatic childhood experienceblouse rippingdisturbed childchild killing an adultkilled with a forkmouth to mouththrown down a wellstocking hat face mask (See All) |
In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman, …will try to stop him and the plague of worms generated by the creature. (Read More)
| Subgenre: | cult filmblack comedyb moviecreature feature |
| Themes: | monstermurderdrunkennesscannibalismmurder of a police officer |
| Mood: | gorehigh school |
| Locations: | small townforestbarswimming poolpolice station |
| Characters: | husband wife relationshipteenagerzombiealienmayorcountry singer |
| Period: | year 2005 |
| Story: | creepycreaturesexbloodviolenceone word titleflashbackmale rear nuditybare chested malephotographexplosionpartypistolcorpseshot to death …blood splattershot in the chestshot in the headshotgunwritten by directorriflecar crashclassroomdecapitationfoot chasebandimpalementstabbed to deathstabbed in the chestmapsevered headchild in perilhit by a cartransformationshot in the foreheadcharacter repeating someone else's dialoguedomestic violenceexploding bodybasementpolicewomancharacter says i love youdirectorial debuttwincowdismembermentgrenadekilling an animalmutantbarnnosebleedmind controlanimal attackeaten alivealien invasionstabbed in the throatobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentinfectiondeerdisfigurementranchmutationfemale in showersurprise after end creditssouthern accentdead dogblood on camera lensdirector cameohigh school teacherdead animalhead blown offmeatpolice chiefacidold flameanimal abusedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All) |
Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and … made into a movie. The Blair Witch Project. (Read More)
| Subgenre: | found footageindependent filmcult filmblack comedysuspensemockumentarytragedyfake documentaryghost storysupernatural horrorfamily tragedyfolk horror |
| Themes: | fearsupernatural powerpanicwildernessstarvationcamping in the wilderness |
| Mood: | darknessstudent filmmyth |
| Locations: | woodsforest |
| Characters: | boyfriend girlfriend relationshipfilmmakercrying babyevil witch |
| Period: | 1990syear 1994 |
| Story: | scarefolklorecigarette smokingchasesurprise endingcryingcorpsebookrunninglow budget filmriveralcoholsubjective camerahalloweenflashlight …video camerafour word titlemaplooking at the cameratalking to the cameralatex glovespainlegendscreamingmissing personscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationhandheld cameravoodoohysteriahikingabandoned housemessageautumnfrightgrassno endingno survivorsscreaming in fearmarylandpaganviral videobased on supposedly true storylost in the woodssevered tongueloss of boyfriendthree friendsdocumentarianobscurityscreaming in horrorchild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All) |
True-crime writer Ellison Oswalt moves himself and his family into a house where a horrific crime took place earlier, but his family doesn't know. He begins researching the crime so that he can write a new book about it to help his flailing career. He uses some "snuff" film footage he finds in the h …ouse to help him in his research, but he soon finds more than he bargained for. There is a figure in each of the films but who or what is it? As a result, his family start to suffer (as does he) and things take a turn for the worse. Will they survive? (Read More)
| Subgenre: | found footagesupernaturaltragedysupernatural horror |
| Themes: | murderdeathghostfearinvestigationobsessionsupernatural powerevilpanicwritingmurder of familymissing childnovel writing |
| Mood: | darknessnight |
| Locations: | small townswimming poolpennsylvaniacar fire |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipwritersheriffterror |
| Story: | housebloodviolencedogcigarette smokingphotographknifecell phoneblood splatterwritten by directorpaintingbookalcoholbedroombound and gagged …massacrethroat slittingtied to a chairmapsnakeman with glassesdrawingchild in perildrowningcoffeetreeargumentdeath of childbaseball bathangingdisappearancelaptopfirst partkillingchild murderoccultburned aliverevelationtied to a bedwatching a moviepoolhomeduct tape over mouthwhiskeyresearchpower outagenovelistatticfamily dinnerlens flareaxe murderboxdrugged drinkbag over headdark secrettrue crimewebcamfilm projectordeputyscorpionpatricideheld captivebloody body of childsnuff filmcollege professorvhshanged manmoving inbackyardkiller childcar set on firefilmed killingmultiple murdermatricideknife murdersuper 8tapegrindhouse filmsleepwalkingsleeping on a couchfratricidesinisterfalling through the floormystery killernew housemovie projectorsuper 8mmst. louis missourighost childfilm reelhanged womangooglesingle locationnew homefoaming at the mouthsacramento californiafilm editingorange county california8mm filmhanged childpov shotkilled with a lawnmowernight terrorsax murdershushing someonecrime novelist (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou …nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
| Subgenre: | independent filmcult filmsuspensetragedycreature featureallegorysurvival horrorzombie apocalypseamerican horrorzombie survivalindependent horrorzombie outbreak |
| Themes: | murderdeathrevengemarriagefearescapemilitarybrutalityparanoiapanicapocalypsecannibalismcourageself sacrificepolice brutality …near death experienceradiation (See All) |
| Mood: | darknessnightgoreone night |
| Locations: | woodsforestcarhelicoptercemeteryrural settingkitchenfarmtruckpennsylvania |
| Characters: | husband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorbrother sister relationshipzombieprofessorsheriffterrorpolice dog |
| Period: | 1960syear 1968year 1967 |
| Story: | youngcreaturehousefemale nuditybloodviolencebare breastsfemale frontal nuditydoggunfemale rear nudityfightcigarette smokingexplosionknife …chasesurprise endingpistolfiretopless female nudityhigh heelsbeatingcorpseshot to deathblood splatterfistfightfoodcar accidentshot in the chestface slapshot in the headshotgunrescuepunched in the facewatching tvbrawlbare buttrifleheld at gunpointrunninglow budget filmrevolvertelevisionscientistshot in the backsurvivalfoot chaseaxemassacrestabbingwomanbridgearmystabbed to deathstabbed in the chestexploding carman with glassescultradiocontroversygraveyardpantyhosenews reporttransformationshot in the foreheadlimousinegravetreebeaten to deathdangerscreamingperson on fireattackfirst of seriesactor playing multiple rolesrace against timeknocked outscene during end creditsshot in the shoulderdeath of brotheramerican flagtragic eventexploding bodyisolationbasementdie hard scenariofirst partdirectorial debutsevered armgeneralhandgunvigilantecult directorundeadwashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned aliveelectronic music scoregothicmutantdiseasevirusbarnloss of loved onehammerimpersonationsevered handgrindhouseskulltorchend of the worldwhite housesocial commentaryback from the deadeaten alivecamera shot of feetseriescameobraverycannibalmercilessnesspower outagechaosresurrectionbroken glassinsectpsychotronicescape attemptscene after end creditsinfectionone daysiegegasolinemutationcellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterintestinesliving deadmolotov cocktailcremationgerman shepherdblack manpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillypatricidequarreloffscreen killingfriends who live togetherhandshocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manpsychotronic filmimprovised weaponfade to blackfamous lineghoulgrindhouse filmheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieexpertremadenational guardmultiple cameosdrive in classicporchtire ironanthropophagusmass deathrefugeends with deathjarentrailshorror movie remadezombificationhunting rifleheadshothell on earthlivermeat hooknon personbabehole in chestblack man white woman relationshipmutilated bodyreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenusexplanationhit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All) |
When plans for a weekend vacation hit a dead end, a group of close-knit friends find themselves stranded in unfamiliar territory, pursued by a menacing, blood thirsty predator. Holed up in an isolated cabin, tensions mount as long-buried secrets are revealed. As the body count rises, the group must …put their differences aside and fight for survival. (Read More)
| Subgenre: | monster movie |
| Themes: | monsterwilderness |
| Locations: | woodsroad tripsuv |
| Characters: | husband wife relationshipafrican americanboyfriend girlfriend relationshipgay friend |
| Story: | group of friendscabincreatureone word titlecoming outvacationblood spattersplattercloseted homosexualwalkie talkieloss of loved oneloss of wifeanimal attackinterracial friendshipbackpack …loss of brotherhikingflarecabin in the woodsroadblockweekendposing for a photographreference to david bowietrapped in a buildinginterracial love relationshipfinal girlreference to freddie mercuryboarded up windowcreature horror (See All) |
For the past 20 years, Frank Harrington has grudgingly driven his family to celebrate Christmas with his mother-in-law. This year, he takes a shortcut. It's the biggest mistake of his life: The nightmare begins. A mysterious woman in white wanders through the forest, leaving death in her wake. A ter …rifying black car - its driver invisible - carries the victims into the heart of the night. Every road sign points to a destination they never reach. The survivors succumb to panic, to madness; deeply buried secrets burst to the surface, and Christmas turns into a living hell. (Read More)
| Subgenre: | black comedyghost storysupernatural horrorchristmas horror |
| Themes: | marriagechristmaspregnancydysfunctional familybreak updeath of wifemadnessdeath of baby |
| Mood: | nightnightmare |
| Locations: | woodsforestcarcar driver |
| Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbabypregnant womancrying baby |
| Story: | cabinfemale nuditybloodmasturbationfemale rear nuditycigarette smokingsurprise endingcar accidentshotgunsecrethallucinationgay slurdream sequenceshot in the leggunshot …death of brotherdeath of sonmoonpornographysurvivormutilationloss of wifestrangervictimcelebrationfull moonwhiskeymale masturbationloss of sonunfaithful wifelostchristmas evebody countloss of brothersurprise after end creditsdead girlbarbed wirefencereference to the beatlescabin in the woodsecstasybody bagdeath of boyfriendstation wagonshockin lawsslaptime loopchristmas carolman slaps a womanman slaps womansevered earmarital crisisdead babybaby carriagegay jokegrandparentsno cellphone signalmarital discordblood on mouthdrivemarital argumentmarital strifebarbed wire fencepotato chiproad signmale wearing an earringman in blackasleep at the wheelout of gasunfaithfulgoing in circlesjingle bellsreference to marilyn mansonfractured skulldark roaddestinationchristmas vacationfalse scarepumpkin piefalling asleep at the wheel (See All) |
Twenty years after an accident during a small town high school play results in death, students at the school resurrect the failed stage production in a misguided attempt to honor the anniversary of the tragedy - but ultimately find out that some things are better left alone.
| Subgenre: | found footagesupernaturaltragedyslasher flickteen horroramerican horror |
| Themes: | murderdeathrevengebetrayalghostfearsupernatural powereviltheatrecrueltypanic |
| Mood: | darknessnighthigh schoolslasher |
| Locations: | small town |
| Characters: | friendboyfriend girlfriend relationshipboyteenage girlteenage boygirlpolicemangirlfriendslasher killer |
| Story: | scareviolenceflashbackphotographtitle spoken by charactersurprise endingcorpsecamerawritten by directorsecretrunningsubjective cameravideo cameraaccidentnews report …looking at the cameratalking to the cameradangercostumescreaminglocker roomscreamhangingprankhigh school studentcheerleaderdarkstagekillingrevelationbreaking and enteringvandalismaccidental deathbroken leghomicidejanitortitle appears in writingfootball playerhandheld cameraboyfriendcellphonedark pastdressing roomclassmatebody countcharacters killed one by onemasked killerhigh school teacherdark secretkilllockerevil spiritnight visionstage playlocked doorhallwayjocknoosehigh school girlfrightschool playphotosmartphonefire alarmhidden roomnebraskaadolescent boygallowsadolescent girlobscurityhigh school boysetcellular phonedrama classhanged to deathunderstudybroken door (See All) |
| Subgenre: | found footageindependent filmexperimental filmmockumentaryb movie |
| Themes: | monsterexperimental |
| Mood: | avant garde |
| Locations: | woodsforestcitylakerussia |
| Characters: | alcoholicrussian |
| Period: | summer21st century |
| Story: | creaturewritten by directorlow budget filmambulanceunderground filmwritten and directed by cast memberhome movielow budgetsunamateurwritten by cast memberdirected by cast memberurban legendtrashrailway …railroadcrazyroaddiysearchingamateur filmtwo directorsreportdirected by an actoramateur filmmakerabandoned placeamateur filmmakingindependent directoramateur cinemaexperimental movie (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d …ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
| Subgenre: | martial artspost apocalypsedystopiacyberpunkchrist allegory |
| Themes: | monstermurderdeathrevengekidnappingreligionbetrayaltorturefuneralherodeceptiondeath of fatherdeath of motherredemptionhome invasion …justiceself sacrificeghost town (See All) |
| Mood: | darknessnightnightmaregorepoetic justice |
| Locations: | small townbartrainchurchmotorcyclecemeterydesertelevatorcitycavetownbar brawlmotorcycle chasetrain explosionwalled city |
| Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshippriesthostagetough guychristianvampirewarrioraction herovillainbible …sheriffuncle niece relationshipex soldierhuman versus monsterfacial tattoo (See All) |
| Period: | future |
| Story: | youngguardcabincreaturecharacter name in titlebased on novelbloodviolenceone word titleflashbackbare chested malegunfightcigarette smokingphotograph …title spoken by characterexplosionknifechasesurprise endingfirevoice over narrationshootoutbeatingcorpseblood splatterfistfightmachine gunshot in the chestshotgunrescuepunched in the facebattlebrawlfalling from heightbased on comicshowdownheld at gunpointhand to hand combatinterrogationcombatkung fudecapitationgood versus evilsurvivalflashlightbased on comic bookambushmassacremountainthroat slittingimpalementstabbed to deathstabbed in the chestweaponsevered headno opening creditsanti heroone man armycoffinfictional wartransformationon the runconfessionone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuespiritualityperson on fireelectrocutionattackbased on mangamissionrace against timedollstatuekicked in the facetough girllightningfarmerscardeath of brothercrossexploding bodyneck breakingthreatened with a knifemercenarychickensevered armvigilantestylized violencestrong female characterbulletkilling an animalrevelationhead buttheavy rainmachetemutantcowboy hatjail cellcrucifixkicked in the stomachnosebleedasian womanjumping from heightcovered in bloodskullhonoraction heroineanimal attackcrushed to deathsocial commentarybar fighteaten alivepresumed deadfemale warriorfull moondamsel in distresstarget practiceveteransandcrossbowteamanimated sequence3 dimensionalgash in the facestabbed in the leg3dpunched in the chestdark herodynamitejumping through a windowdisembowelmentblood on shirtfascismboyfriendknife throwingdark pastlanternmutationgadgetsevered legcellardaggertorso cut in halftracking devicefemale soldierprayingcrucifixionruinsvigilantismparkourworld dominationconfessionalshot with an arrowmegalomaniacflask18 year oldflarequitting a jobgramophonepocket watchvigilante justicebased on graphic novelbitten in the neckmeat cleaveracrobatstabbed in the shoulderfight the systembladerepeated linesuperhuman strengthtragic pastsubterraneancut into piecestrapdoornight timemass gravevampire hunterone woman armypsychotronic filmanti heroinegogglesman with no nameacrobaticssome scenes animatedvampire slayerstarts with narrationhit by a trainwire fubritish actor playing american characterpassenger traintrain conductorcoming out of retirementmotorcycle stuntnieceoil lampexploding motorcyclecouncilinsubordinationoutpostalternate worldtrain wreckclergytrackinggeiger countertotalitarianknife in chestsuperhuman speedtrain derailmentexploding trainhit by a motorcyclefight on train roofhuntressmonolithsolar panelblack hathiveriding motorcyclehuman versus vampireopening credits18 year old girldisobeyfall through floorvampire queengiant statuelong haired womanwoman with long hairfemale vampire hunter (See All) |
Two campers in the New Jersey woods have their outdoor fun interrupted by the arrival of a meteorite crashing nearby. They go to investigate the crater, but are suddenly attacked and devoured by alien parasites who have hitched a ride to Earth. After finishing off the campers, the hungry space monst …ers head for a nearby town, where they make their domain in the basement of an old house soon begin polishing off one hapless inhabitant after another. Four young teenagers, plus one pre-teen boy, try to find a way to stop the angry space monsters before they reproduce and literally eat humanity. (Read More)
| Subgenre: | independent filmcult filmb moviecreature featurecampy |
| Themes: | monsterhunting |
| Mood: | darknessgorerain |
| Locations: | woodspolice car |
| Characters: | teenageralienpsychiatrist |
| Story: | youngcreaturehousebloodviolencesurprise endingfireblood splattermaskscreamingumbrellabasementheavy raintherapistmale underwear …alien invasionthunderboxer shortsblood on facethunderstormblood on shirtbriefscellarhysteriabandagebathrobewhite briefsmeteorparasitealien creatureface ripped offgiant creaturedissectionmultiple monstersblood on handvegetarianism (See All) |
After a group of bikers accidentally murder a young boy named Billy Harley his father Ed harley is devastated and the only thing he wants is revenge and goes to an old woman who is said to be a witch and conjures a demonic creature known as pumpkin head and with Revenge on his Mind unleashes him upo …n the bikers. (Read More)
| Subgenre: | independent filmcult filmsupernatural horror |
| Themes: | monstermurderdeathrevengevengeanceself sacrifice |
| Locations: | forestmotorcyclebackwoodsold church |
| Characters: | father son relationshipteenagerchristianwitch |
| Story: | younggroup of friendscabincreaturecharacter name in titleone word titleflashbackdogknifesurprise endingfirefalling from heightdemoncandleimpalement …suicide attemptgraveyardold womannecklacelegenddeath of childcrosssplattermutilationwitchcraftreverse footageloss of sondead childbroken armpumpkinflamethrowerloss of brotherowlcabin in the woodsdeath of title characterpitchforkgrave diggingbased on poemdirt bikeloss of girlfriendfatal accidentlocked in a closetpart stop motionsoul transferencedamnationburial groundpumpkin patchsoul sellingpumpkin headstorekeeper (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | supernaturalindependent filmcult filmblack comedydark comedyparanormalpsycho thrilleramerican horrorindependent horror |
| Themes: | monstermurderdeathsurrealismdrugsghosttorturepsychopathsupernatural powerdeath of motherinsanitysadismevilamnesia |
| Mood: | darknessnightmaregorerainhigh schoolslasher |
| Locations: | small townairplaneroad trip |
| Characters: | family relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillervillainterrorself mutilationyounger version of characterdeafnessslasher killerserial murderergerman american …evil father (See All) |
| Period: | 1990s1970s1960s1940s1950s |
| Story: | disturbingcreepyf ratedcharacter name in titlebloodviolencesequelflashbackbare chested maletitle spoken by characterknifefirepunctuation in titletitle directed by femaledream …blood splatterrescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorywater towerchild murdererman punches a womanadopted childreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
Jim and his girlfriend Kelly are visiting the infamous Willow Creek, the alleged home of the original Bigfoot legend - the tale of huge ape like creatures that roam the forests of North America. It was there that in 1967, the legendary beast was captured on film and has terrified and mystified gener …ations since. Keen to explore more than 50 years of truth, folklore, misidentifications and hoaxes, Kelly goes along for the ride to keep Jim happy, whilst he is determined to prove the story is real by capturing the beast on camera. Deep in the dark and silent woods, isolated and hours from human contact, neither Kelly or Jim are prepared for what is hidden between the trees, and what happens when the cameras start rolling... (Read More)
| Subgenre: | found footagemockumentaryfake documentarycreature feature |
| Themes: | campingcamping in the wilderness |
| Locations: | woodssmall townforestbarmotelgas station |
| Characters: | boyfriend girlfriend relationshipmusicianactressfilmmaker |
| Story: | hiddenfolklorenuditymale nudityinterviewmale frontal nuditymale rear nuditybare chested malekissmale full frontal nuditysurprise endingmale pubic hairsubjective cameraflashlight …video cameramarriage proposaltalking to the cameraskinny dippingtentlong takemale underwearredneckrejectionhandheld cameranude swimminghikingbigfootsasquatchproposalno endingscreaming in fearcreekman undressinglost in the woodsrangerunsolved mysteryhand camerahearing noisesboxer briefsraw footageno background scorebig footchaos in the darknational forest (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com