Please wait - finding best movies...
TetroVideo have today provided us with two exclusive photos from Confessions of a Necrophile Girl (aka Confessioni di una Necrofila), the highly-anticipated Italian film based on the true-life story of American necrophile Karen Greenlee. In the film, Karen (Angela del Regno) relives the most import …ant moments of her life through a video diary: from childhood to first love, to the scandal about her sexual attraction for corpses. Directed by Domiziano Cristopharo (House of Flesh Mannequins, Red Krokodil), Confessions of a Necrophile Girl is an "erotic and disturbing drama film" that is part of the TetroManiac series by TetroVideo (the shocking film series about the real stories involving criminals and serial killers). (Read More)
Subgenre: | video |
Themes: | first lovechildhoodnaturefunerallovedeath |
Locations: | bathtub |
Characters: | writer directorzombie |
Story: | serial killersbody countsexual attractionvideo diarydead bodyfilm serieslife storytrue lifelife and deathstrongfamiliarfeelingleavecriminalstalking …caughtdeepsentencegross outwantedthoughtsegmentsserialstingkillersstomachstoriesarrestedcasecaretailbreakdowndisturbingcountworkingheadinformationsexualdoublecheckrentshockeroticwrist slittinghearseindustryslashingnecrophiliabodypresentdeadattractionseriesstealingrecordingscandaltherapydiarycameradreamshowersex (See All) |
In Rome, after the abduction of a British tourist, the police inspector Anna Mari is contacted by the criminal, who self-entitles The Card Player, challenging the police department to dispute a video poker with him where the prize would be the life of the victim. The Chief of Police refuses to parti …cipate and the victim is tortured and killed in front of an Internet web cam. The British detective John Brennan is assigned to investigate the case and when another woman is kidnapped, they invite the addicted player Remo to play for the police. Anna and John lead the investigation trying to disclose who might be the serial-killer. (Read More)
Subgenre: | videoindependent filmsuspenseitalian horror |
Themes: | lovemurderfearinvestigationangerpsychopathblackmailsadismcrueltytraumapolice investigation |
Mood: | goreslasher |
Locations: | barboatwaterwoodsoffice |
Characters: | policepolice officerserial killerdetectivepoliceman |
Story: | sexual attractiondead bodyserialcaseattractioncamerasexfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nudityinterview …gunnipplesknifefondlingfoodshot in the chestsunglasseshandcuffsbedroombound and gaggedstrangulationstabbingthroat slittingimpalementinternetbrunettesevered headpolice officer killedsearchscreaminghangingmanipulationinjectionpolicewomanmurderercult directorkillingdesirepokerstreetmass murdermorguepsychodead womanrampagesevered fingerstabbed in the throatmercilessnessautopsyperversiondead mandisfigurementroombloodbathpsycho killerdead girlpsychopathic killergloveshuman monsterbitternesssexual perversionwebcamhomicidal maniacsilentcrushed headnaked dead womanmultiple murderknife murdercaressgiallotraumatic experiencehookcardsdeeply disturbed personhit by a traincutmystery killerdecomposing bodytortured to deathmultiple homicidemistreatmentblack glovessicklesearchingsearchlightdeath by impalementpolice protectioncomputer screenfemale corpsebox cutterunknown killerdecomposed bodydark killerunknown female corpse (See All) |
Set against Sin City, Las Vegas, "Murder-Set-Pieces" tells the story of a fashion photographer whose vocation is murder - a voyeuristic nightmare of blood, sex and brutality.
Themes: | deathmurderrapetortureescapevoyeurismpsychopathbrutalityhumiliationsadismevilphotographycrueltyrape and murder |
Mood: | gorenightmareblood and gore |
Locations: | bathtublos angeles californiabusstrip club |
Characters: | girlserial killerphotographerkillerserial murdererout of control |
Story: | sexual attractionslashingnecrophiliaattractioncameradreamsexfemale nuditynuditybloodmale nudityviolencefemale frontal nudityflashbackmale rear nudity …female rear nudityphotographknifecorpseblood splatterbedbathroomvoyeurstripperdecapitationbedroomstabbingthroat slittingstabbed to deathhousepaindangerscreamingscreamskeletonbasementmurdererlas vegas nevadakillingblood spatterchild murdermaniacchainsawdesiremutilationnosebleedpsychoskullrapistdead womanhomicidesexual desirescissorsperversionliving roomcellarpsychoticpsycho killerdead girlpsychopathic killermadmansexual perversionsexual violencehomicidal maniacdegradationrazorrazor bladenazismbladeknife murderriskdreamingsex shopsexual humiliationphotocaptivitydepravityloss of controlscreaming in fearmemoriestorture chambersexual sadismsexual crueltyperiltorturerscreaming in painscreaming in horrorjeopardykillingsstabphysical torturepsychotic killer (See All) |
Angela Baker has undergone years of therapy, electro-shock and sexual reassignment surgeries, and finally landed herself a job in the last place she should be working - camp rolling hills. She has an old fashioned approach as to how camp should be, and an old familiar deadly way of making sure that …those who don't follow her rules don't get to come back next summer. (Read More)
Subgenre: | independent filmdark comedyhorror spoof |
Themes: | murderpsychopath |
Mood: | spoofparodyslasher |
Locations: | trainswimming poolforestcampfire |
Characters: | teenagerchildrenserial killer |
Story: | sexual attractionfamiliarworkingsexualshockstealingtherapydreambloodsequelfemale frontal nuditybare chested malesingingknife …pantiescorpseunderwearblondebikinimasksecond partvoyeurguitardecapitationcleavageflashlightbound and gaggedstrangulationstabbingthroat slittingtoiletsevered headanti heroscantily clad femaledrowningpublic nudityproduct placementskeletonfemale removes her clotheshairy chestblindfoldsplatterchainsawropesociopathcampmale underwearmoralityboxer shortscard playingraidburned to deathsurprise after end creditsurban legendsummer camppink pantiesblue pantiesdead childrenwoodaciddisciplinebloody body of childburnt bodywet t shirttragic villainblond boyshort shortssevered tonguedisembodied handleechhanged boyouthousechild murderesscamp counselormullet haircuthead in a toilethead in toiletleatherfacedouble child murderdrilling machinefriday the 13th spoofwoman taking off pantstattletaleholiday camptongue cut off with knifeface in toilet (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j …ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | independent filmcult filmslasher flicksurvival horrorsadistic horror |
Themes: | murderkidnappingmarriageinfidelitytortureescapeextramarital affairpsychopathcancerinsanityhome invasionclaustrophobiaself harm |
Mood: | gorecar chaseslasher |
Locations: | hospitalhotelurban setting |
Characters: | husband wife relationshippolicefather daughter relationshipdoctorserial killerdetectivephotographerhostagekillerpolice detectiveself mutilation |
Story: | body countdead bodyleaveserialbodydeadcameraviolenceone word titleflashbackgunsurprise endingpistolcorpseshotgun …secretbathroomrevolverbound and gaggedthroat slittingstabbed to deathtoiletchild in perilpolice officer killedclownpuppetperson on firepoisonfirst partburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappeddisembowelmentbooby trapextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
When May was a child, she was a lonely girl with a lazy eye and without any friends except a weird and ugly doll kept in a glass case given by her bizarre mother on her birthday. May becomes a lonely, weird young woman, working in an animal hospital and assisting the veterinarian in surgeries and se …wing operated animals most of the time. Her lesbian colleague Polly has a sort of attraction for her. When the shy May meets the mechanic Adam Stubbs, she loves his hands and has a crush on him. They date, but the weirdness and bizarre behavior of May pushes Adam away from her. Alone, May has a brief affair with Polly, but she feels rejected again when her colleague meets Ambrosia. When her doll is accidentally broken, the deranged May decides to build a friend for her, using the best parts her acquaintances can offer. (Read More)
Subgenre: | independent filmcult filmblack comedytragedypunkslasher flickpsychological horrorlgbt horror |
Themes: | childhoodlovedeathmurderfriendshipjealousydrinkingdrunkennesslonelinesspsychopathbrutalityobsessiontime travelinsanitymental illness …crueltyblindnesschildhood trauma (See All) |
Mood: | gorestudent filmslasher |
Locations: | bathtubrestaurantelevator |
Characters: | mother daughter relationshipfriendtattooboyteenage girlteenage boyteachergirldancerfilmmakerslasher killer |
Period: | world war two1940s |
Story: | body countdead bodycaseworkingattractioncharacter name in titlebloodone word titleflashbackdogkisscigarette smokingdancingknife …surprise endingtelephone callcryingcorpsemirrorcatdrinklietearsbirthdaycafehalloweenbrastabbingmontagethroat slittingradioparkliardollhalloween costumestalkingfilm within a filmgaragesurgeryeyeglassesmass murdermutilationwatching a moviedesperationsevered handblack humormilksevered fingerstabbed in the throatstabbed in the neckbroken glassscissorscigarette lighterstabbed in the eyeeye patchsevered legcharacters killed one by onepumpkinvodkacoffee shop12 year oldforename as titleshynesslaundryinsecurityveterinariandead animaleyemasochismlaundromatyoung womananimal abusescalpelamputationobsessive loveeyeballauto mechanicsewing machinehanddead catsewingmoleclothesbody partjack o'lanternbitestabbed with scissorshardware storefingerfreezerfrozen bodygutstaxidermyseamstresssocial outcastmohawk haircutsalsacuttingsinkeye injurylegblood samplekilling a catashtraydry humoroutdoor cafeblind childchildren's songdrinking milkoptometristreference to betty grablenecksurgical toolsuturecontact lensesschool dropoutschool for the blindfake knifeday care centereye doctorjack knifekneebroken dollgatoradeanimal hospitalsucking on one's thumblazy eye (See All) |
Graphic, low-budget gore-shocker about Rob and Betty, a couple of ordinary necrophiles who apparently don't mind if their dead sexual partners are not so fresh. Rob's job affords him the opportunity to bring home corpses and the odd body part; when he loses his job, he loses Betty, and Rob's life ge …ts REALLY bizarre. (Read More)
Subgenre: | independent filmcult film |
Themes: | deathmurdersuicideinsanity |
Mood: | gore |
Locations: | bathtub |
Characters: | prostitutesuicide by stabbing |
Period: | 1980s |
Story: | dead bodysexualnecrophiliabodydeadsexfemale nuditybloodmale nudityviolenceone word titlebare breastsmale frontal nuditymasturbationfemale rear nudity …ejaculationnipplesknifesurprise endingcorpseblood splattercar accidentcatcondombedbathroomdecapitationbedroomstabbed to deathstabbed in the chestsevered headgraveyardgraveknocked outthreatened with a knifedismembermentmutilationmorguecovered in blooddark humorshovelpsychotronicdisembowelmentblood on shirtperversioneye gougingtorso cut in halfintestineshit in the facesexual perversionurinenihilismsense of smellactual animal killedhead cut offmacabrehit with a shoveltraffic accidentbody partbreaking glassdead prostitutekilling a catrotting corpsedeviant sexsplit in twonecrophiliachead chopped offsex with the deadcontamination suitstabbing oneselfrotting fleshtwisted behaviorjob terminationpetting a catrotting body (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | independent filmcult filmblack comedypsycho thrillersadistic horror |
Themes: | deathmurderfriendshiprevengesuicidekidnappingrapebetrayalfeartortureescapedeceptionseductionangerpsychopath …death of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
Mood: | gorenightmareambiguous ending |
Locations: | bathtubbarpolice stationfarmroad tripmotelgas stationtexasbrothel |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officerserial killernurse …hostagetough guyvillainmaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | serial killersbody countdead bodyserialkillersnecrophiliadreamshowerbloodviolencesequelflashbackmale rear nudity …dogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionknifechasepantiespistolfireshootoutwoman on topbeatingcorpseshot to deathblood splattermachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partlow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealerthroat slittingimpalementcocainestabbed to deathstabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
On a remote island, the FBI has a training program for their psychological profiling division, called "Mindhunters", used to track down serial killers. The training goes horribly wrong, however, when a group of seven young agents discover that one of them is a serial killer, and is setting about sla …ying the others. Can the few that are left figure out who the killer is in time? (Read More)
Themes: | deathmurdertortureparanoiagamblingpanicghost townfear of water |
Locations: | bathtubbarbeachhelicoptersnowelevatorkitchenwheelchairsex in showerboat explosion |
Characters: | tattooserial killerteacher student relationship |
Period: | winter |
Story: | serial killersbody countserialkillersshowerbloodmale nudityone word titleflashbackmale rear nuditykisscigarette smokingphotographsurprise endingpistol …shot to deathblood splatterfistfightmirrorshot in the chestshot in the headslow motion scenecomputercatfalling from heightsunglassesbombinterrogationhandcuffsislanddecapitationthroat slittingdinerstabbed in the chestbrunettesevered headdouble crossunderwater scenedrowningcoffeetrainingfbiopening action scenescreambasementtrappremarital sexsuspicionlove interestkissing while having sexrevelationsociopathloss of friendfbi agentwristwatchback from the deadfloodfogbulletproof vestbetsevered legcharacters killed one by onelasersightarrowpigeonmannequinfast motion scenemale in showertorso cut in halfdead dogvideo surveillancegroupfire extinguishershot in the neckdead animalblackoutacidponytailsimulationrainingsleeping in a cartomatoshot in the throatlighting a cigarettemaggotbettingdead catbutcher knifearmoryloudspeakerman in a wheelchairexploding boatdisabledcrossword puzzlewriting in bloodrubik's cubemost dangerous gamepuppeteeruh 1 huey helicoptercrime scene photographforensic evidencekilled in an elevatorstopwatchblood sampledecapitated headloud shirttwo in a showersplit lipunderwater fighthandcuffed to a pipedominoesliquid nitrogentrip wiresecret relationshipbeheadedprofilerwall clockbobble head dollspeed of lighttraining exercisefbi profilerhouse catmisfiring gundomino falltoy duckdrugged coffeefbi traineewool hatmilitary facilitydeath of co worker (See All) |
Anna Manni is a policewoman trying to capture a vicious serial rapist and killer. The problem is that she suffers from "Stendhal's syndrome", a psychosomatic disease that gives her dizziness and hallucinations when she is exposed to the sight of paintings and artistic masterpieces. When the maniac l …ures her into a trap inside Florence's famous Uffizi museum, her troubles are just beginning... (Read More)
Subgenre: | cult filmsuspensepsycho thrilleritalian horror |
Themes: | deathmurderrevengesurrealismkidnappingrapefeartortureartpsychopathbrutalityinsanitymental illnesssadismevil …crueltytraumaamnesiamadnessrape and revengepsychological traumarape and murder (See All) |
Mood: | goreneo noirnightmareslasherdarkness |
Locations: | rural settingitalymuseumart museum |
Characters: | female protagonistserial killerhostagekillervillainpsychiatristterrorself mutilationslasher killerserial murderersex killer |
Period: | 1990s |
Story: | body countdead bodyserialdisturbingslashingnecrophiliafemale nuditybased on novelbloodviolencebare chested malegunshootoutblood splatterblonde …slow motion scenegunfightkissingpaintinghallucinationcriminalcombatstrangulationmassacrestabbed to deathcontroversypolice officer killedevil mantrappolicewomanmurdererunderwatercult directoreuropekillingblood spattersplatteritalianmass murdersexual abuserome italyragemutilationpsychocovered in bloodvictimrape victimrapistmercilessnessbutcherpsychotronicperversionslaughtercharacters killed one by onekilling spreebloodbathpsychoticpsycho killerbullet timepervertserial murderpsychopathic killerbad guymadmankilllong hairhuman monsteralonehomicidal maniacblood stainbullet ballethead bashed inkidnappergun violencerazor bladecrushed headcarnagepsychoanalysisextreme violencecop killergraphic violencebloodshedknife murderbloody violencegiallotraumatic experiencefemale victimsadistic psychopathmurder spreedisturbed individualbutcherycrime spreecreepexit wounddeeply disturbed personserial rapistundershirtpaybacksexual predatormistreatmentpsycho terrorweirdocreepysex offenderitalian cinematorturersadistickneed in the groinperversitygory violencesickoabused womangruesomeambiguous titlemutilated bodynecrophiliacgraphic rapedark killersex maniacbrutalinsaneforced sexual contactgoreshedsadistic killerfemale victimswoman killerpredator becomes preyserial rapevilerazor murder (See All) |
Lt. Kinderman and Father Dyer cheer each other up on the anniversary of the death of their mutual friend, Father Damien Karras, by going to see "It's a Wonderful Life" at the local theater in Georgetown, near Washington D.C. But there's no cheering Kinderman while a particularly cruel and gruesome s …erial killer is at large. His murders, which involve torture, decapitation and the desecration of religious icons, is bad enough; but they also resemble those of the Gemini Killer, who has been dead for fifteen years. (Read More)
Subgenre: | independent filmcult filmpsycho thrillerparanormal phenomenaamerican horror |
Themes: | deathmurderfriendshipsurrealismghostdrinkingtortureinvestigationangerpsychopathbrutalitysupernatural powerinsanitysadismevil …executioncrueltyautismthe devil (See All) |
Mood: | rainnightmareslasherdarkness |
Locations: | bathtubhospitalrestaurantchurchhelicoptercemeterywheelchairpolice stationpolice carindiacatholic church |
Characters: | policefather daughter relationshipmother daughter relationshipafrican americanfriendbrother brother relationshipboygirlserial killernursepolicemanpriestartistreference to godwaitress …police detectivevillainbiblecatholicterrorgrandmother granddaughter relationshipslasher killermother in law son in law relationshipmysterious villainserial murderermysterious killerreligious statue (See All) |
Period: | 1990syear 1998 |
Story: | body countdead bodyserialslashingdeadcamerabased on novelbloodviolencesequelcigarette smokingphotographfirepunched in the facedrink …cafedemonreference to jesus christtelephonesubjective cameradecapitationsnakefishdream sequencebirdradiograveyardthird partpainconfessionattempted murdergravelibrarypilotspiritualitymissionpossessionangelevil manlightningstalkingcrossreference to william shakespeareundeadhateblack americanchild murderwashington d.c.chessmaniacfalling down stairssyringehypodermic needleragemutilationpatientpsychopart of trilogyrailway stationback from the deadhomiciderampagemovie theatrereverse footagewindbutcherpsychotronicrowboatreference to satanroseautopsymurder of a childolympicsalzheimer's diseasesequel to cult favoritetelekinesispsychoticexorcismsymbolismpsycho killerserial murderpsychopathic killerbad guybeheadingmadmanmysterious mancrucifixionreturning character killed offparalysishuman monsterevil spiritpenguinconfessionalhomicidal maniacrabbiwhisperingballerinastrait jacketscene of the crimecopenhagen denmarkvirginiamusic boxdead birdsadistic psychopathmurder spreefingerprintbutcheryholy watercrime spreeasphyxiationsurgical operationdance classrosarytarot cardevangelistmystery killerrowingmental asylumscreenplay adapted by authorsatanelectroshock therapypsycho terrorblackfacereference to shakespeare's macbethadaptation directed by original authordecapitated headcatatoniahell on earthmutilated bodyoardark killerseminaryrabiesrichmond virginiajesuitdecapitated childzodiac killerthrown out a windowsurgical toolgeminicharacter played by different actorscatheterreturning from the deadjesus statuelunatic asylumvocal cordsgeorgetown washington d.c.hiding on the ceilingisolation tankminstrel showlemon drop (See All) |
When hundreds of videotapes showing torture, murder and dismemberment are found in an abandoned house, they reveal a serial killer's decade-long reign of terror and become the most disturbing collection of evidence homicide detectives have ever seen.
Subgenre: | mockumentaryfound footageamerican horrorindependent horror |
Themes: | deathmurdersuicidekidnappingrapefeartortureescapeinvestigationcorruptionpsychopathbrutalityguiltinsanityhumiliation …sadismevilhome invasionexecutionexploitationcrueltypanictraumamadnessmurder investigationmysterious deathpsychological trauma (See All) |
Mood: | gorenightslasherdarkness |
Locations: | hospitalcemeterywaterpolice carroad tripgas stationpennsylvania |
Characters: | policeprostitutegirlpolice officerserial killerlittle girlvillainterrormysterious villainserial murdererout of controlmysterious killer |
Story: | body countserialdisturbingbreakdownslashingnecrophiliacamerashowerfemale nuditynuditybloodviolencefemale frontal nudityinterviewbondage …knifepantiestelephone callcryingbeatingcorpseblood splattermasktearsrunningbedbathroomtelephonereportersubjective cameranewspaperbedroomjournalistbound and gaggednew yorkaxevideo camerastabbingthroat slittingstabbed to deathprisonerhousemapchild abusefalse accusationman with glasseschildgraveyardnews reportlooking at the cameratalking to the camerastalkerbeaten to deathscreamingfbimissing personevil mantragic eventstalkingautomobilethreatbasementtrapmurderernewspaper headlinedismembermentkillingchild murdermaniactv newsbreaking and enteringballoonstreetsexual abuseragemutilationsecurity cameracaptivefbi agentassaultvideotapedesperationpsychogrindhousevictimjournalismdriving a carrapistdead womantowelhomicidemasked mansubmissionslaverampagehookersufferingcouchkickingmercilessnessball gagstabbed in the neckanxietybutcherdespairscene after end creditspedophiledisembowelmentsurprisehandheld cameraperversiondead manmurder of a childhighwayfemale reporternervous breakdownliving roominjusticecellarkilling spreemisogynychloroformpsychoticmasked killerpsycho killersurprise after end creditsdead girlpervertpsychopathic killerbad guymadmanmysterious manbrainwashingset uppedophiliamisogynisthuman monsterhogtiesex slavesexual perversionsexual violencehomicidal maniactv reportermasochismdegradationframednihilismamputationkidnappermissingdnasnuff filmsawnaked dead womandecadencemenacenervousnessdeath sentencemultiple murderchild molestertormentknife murderfemale prisonerpsychological tortureriskanguishbloody violenceroadfemale victimangstsadistic psychopathtapetalking while drivingmolestationmurder of a nude womanmurder spreecriminal investigationdisturbed individualbutcheryvideo cassettecrime spreecaptivitymissing daughterdepravityloss of controlfemale journalistsidewalkmissing girlstockholm syndromechild killedmystery killerfetishismmass mediamultiple homicideruthlessnessviral videosexual sadismchild killercreepysexual crueltychild murdererperiltorturerdead prostitutedehumanizationmissing womancollapsemasked womanknife attackserial child killerperversity911 callgrave robbingeast coastpsychological tormentgruesomeparaphiliadeviant sexglass of waterkidnapped womanunknown killerfemale fbi agentjeopardyinhumanitynecrophiliachelplessnessjustice systemmysterious personfbi investigationsexual devianttorture victimoutragephysical torturebound in chainsbrutalwoman in toweldna testhomicide investigationkidnap victimbrainwashassailantdysfunctionalityserial child murdersexual aberrationfemale slavedisturbed personfbi profilerloss of humanitydysfunctional societyneedlesprowlerfemale captivechelsea smiledefenselessnesstormentorphysical tormentpoughkeepsie new yorkdepravationhandsawdisturbed man (See All) |
Peaceful, rustic Berkeley is a charming fishing community where life is sweet and the people friendly. All that is about to change. After losing her childhood farm to the bank, local beauty Rene decides to leave town and head for the big city. Suddenly, an avalanche of meteorites races through the s …ky, bombarding the town and bringing an otherworldly infection. Departing is going to be much more difficult than she had planned. The living dead are awakened and Rene is now caught in a nightmare of zombies hungry for human flesh. She manages to find salvation in a small isolated farm house owned by the town loony, Marion. There she is met with four other desperate survivors. Together they battle their way through a plague of walking dead and discover that there is more transpiring than just an infection. (Read More)
Subgenre: | independent filmmartial artsblack comedydark comedyb movieb horroraustralian fantasyaustralian science fictionsurvival horroraustralian horrorzombie apocalypseindependent horrorzombie outbreak |
Themes: | childhooddeathmurderpregnancyescapesupernatural powerapocalypsecannibalismalien abduction |
Mood: | goreraindarknessaustralian supernatural |
Locations: | hospitalsmall townairplanewoodsaustraliafarm |
Characters: | zombiesoldierpolice officeralienterror |
Period: | 2000s |
Story: | dead bodyleavecaughtheaddeadbloodviolenceflashbackexplosionpistolblood splattermachine gunshot in the headshotgunfalling from height …riflerevolversurvivalaxearmyfishanti herobasementpolicewomanundeaddiseaseviruseccentricend of the worldgun fuback from the deadeaten alivegas maskalien invasionpump action shotguninvasiondual wieldconvenience storebutcherinfectionmutationexploding helicopterintestinesliving deadoutbackplaguefarmhousecricket the gamemeteorcurewalking deadbutcheryoutbreakzombie attackmeteoritedoomsdaybarricadeflesh eatinganthropophaguszombificationslip the undergarmentflesh eating zombiesdeadly diseasebank foreclosurekiller fishdeadly virusnordenfelt gunthrowbackzombie invasionshot in half (See All) |
While playing with a puzzle, a teenager is repressed by his mother, and he kills her and severs her body with an ax. Forty years later, in an university campus in Boston, a serial killer kills young women and severs their bodies in parts, stealing body pieces from each student. Lt. Bracken makes a d …eal with the dean of the campus, and infiltrates the agent Mary Riggs as if she were a tennis teacher and together with the student Kendall, they try to find the identity of the killer. (Read More)
Subgenre: | independent filmcult filmsuspenseb movieb horroramerican horroritalian horrorsadistic horrorspanish horror |
Themes: | deathmurderfriendshipfearvoyeurismcorruptionpsychopathbrutalitydrug useinsanitymental illnesssadismevilexploitationcruelty …trauma (See All) |
Mood: | gorenightslasherdarknessblood and gore |
Locations: | swimming poolwaterelevatoroffice |
Characters: | friendpolice officerserial killerpolicemanvillainsecretaryterrorslasher killermysterious villainserial murderer |
Story: | body countdead bodyserialdisturbingslashingbodystealingfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nudity …male rear nuditybare chested malefemale rear nuditymale full frontal nuditysurprise endingfondlinghigh heelsbeatingcorpseblood splatterurinationblondeslow motion scenegunfightbikinilow budget filmvoyeursubjective cameradecapitationbraold manaxemassacrestabbingstabbed to deathtoiletchild abusebrunettesevered headcontroversypantyhoseshot in the foreheadattempted murderstalkerdangerscreamingcharacter's point of view camera shotevil manuniversitymanipulationstalkingballetdismembermentkillingmaniacchainsawfemale stockinged legsdesireragemutilationdesperationpsychoswimsuitsevered handgrindhousevictimdead womantowelcamera shot of feetrampagewoman in jeopardyboston massachusettsmercilessnessbutcherpsychotronicfrustrationperversiondisfigurementcastrationdark pastaxe murdercharacters killed one by onedead woman with eyes opendead motherkilling spreebloodbathpsychoticpsycho killerbullet timefemale stockinged feetpervertserial murderpsychopathic killerbad guybeheadinggirl in bra and pantiesconfusionmadmanmysterious mankillglovesscene before opening creditshuman monsteralonerepressionsexual violencehomicidal maniacrestroomboy with glassesblood stainwetting pantsdying mandruggedcarnagesawuniversity studenthead cut offkiller childextreme violencegraphic violencesexual repressionmultiple murderknife murderbloody violencegiallofemale victimsadistic psychopathoff screen murdermurder of a nude womanmurder spreedisturbed individualgrindhouse filmcreepcurtainmysterious strangerfedoradead woman on floordeeply disturbed personmystery killeraxe fightdecomposing bodymultiple homicidehand cut offpsycho terrorblack glovesco edtennis playerweirdopranksterjigsaw puzzledecapitated bodysevered penistorturerdead woman on groundphantomcuttingdrive in classicnude pantyhoseperversitywaterbedgory violenceeast coastsickoman and woman in bedgruesomeson murders motherfemale corpsebody partschainsaw murderunknown killerfemale stockinged solesmutilated bodyurinating in feardark killerfemale urinatinghead chopped offbrutaltroubled childhoodchild killing an adultfemale victimsblack gloved killerunintentional humorabusive childhoodchainsaw fightson kills mothermentalitybostondisturbedspanish giallochild as murderer (See All) |
The restorer Stefano is hired by the Mayor Solmi of a small village nearby Ferrara to restore a painting of St. Sebastian, made by the mentally disturbed painter Buono Legnani in the local church. Stefano was recommended by his friend, Dr. Antonio Mazza, and he learns that Legnani was known as "The …Painter of the Agony", since he used to paint near-death people. Further, he was presumed dead many years ago but his body has never been found. Stefano works in the church, where he meets the weirdo Lidio, and he has one night stand with the local nymphomaniac teacher that is leaving the village. Meanwhile Antonio investigates the life of Buono Legnani and tells Stefano that he had found a dark secret about the painter and the villagers. However, Antonio dies before meeting Stefano and the police conclude that he committed suicide. Stefano is intrigued by the mystery surrounds Legnani and decides to investigate more about the deranged painter. However, he in evicted of his hotel room and Lidio brings him to the isolated house of a paraplegic woman where he lives. Meanwhile, he meets the teacher's substitute Francesca and they have a love affair. Francesca moves to Stefano's room and they are affected by the strange atmosphere of the place. When the restoration is damaged by acid, Stefano decides to leave the village with Francesca. However, he meets the alcoholic driver Coppola that decides to disclose to him the secret of the house of the laughing windows. But now it seems to be … (Read More)
Subgenre: | independent filmcult filmsupernatural horroritalian horror |
Themes: | lovedeathmurdersurrealismsuiciderapejealousyadulterytortureartinvestigationvoyeurismseductionangercorruption …psychopathbrutalityobsessionguiltunfaithfulnesshumiliationsadismcrueltytransgendertraumaaffairinheritancepsychological trauma (See All) |
Mood: | goreaffectionmurder suicide |
Locations: | restaurantsmall townrural settingitaly |
Characters: | police officernursepolicemanpriestartistlustcatholic |
Story: | sexual attractiondead bodyleaveslashingbodydeadattractionfemale nuditynuditybloodmale nuditybare breastsfemale frontal nuditymale frontal nuditybondage …sex scenekissnipplessurprise endingpantiesvoice over narrationfondlingbeatingcorpseunderwearslow motion scenethongpaintinglingeriehallucinationvoyeursubjective camerabisexualbraold manstabbingstabbed to deathbrunettepainterpainstrippingscreamingperson on firemissing personattempted rapesensualitymanipulationfemale removes her clothescountrysideglassesmurderersacrificepsychicblood spattercouplesisteroccultrevelationdesiremutilationcrucifixdesperationrape victimpresumed deadsexual desirebra and pantiessufferingcynicismmercilessnessplot twiststairsblack brasuperstitionfrustrationshadowdead mandark pastliving roombruisebloodbathdaggerframed for murderpsycho killerjoyconfusionfemale removes her dresspicturerepressiondegradationblood staincatholicismtransvestismhallwaymurder witnesssexual frustrationflamesexual repressionmenacemultiple murderknife murdercaresslegacygiallofemale victimwhite dressdisturbed individualmurder victimdeeply disturbed personcutcuriositygallerytortured to deathset on firepaganmistreatmentfemale in bra and pantiesawakeningpaganismman and woman in bedmisanthropydistorted voiceromantic obsessionbody mutilationambiguous titlederangedart restorationmystery individualsupernatural murdersuspicious deathopening creditsblood sacrificesaint sebastian (See All) |
A survivor in an Apocalyptic world tells stories leading to the end of the world.
Subgenre: | post apocalyptic |
Themes: | traveltime travelapocalypse |
Mood: | apocalyptic |
Locations: | country |
Characters: | pregnantpregnant wife |
Story: | strongfamiliarthoughtsegmentsstoriesinformationcheckdeadseriesviolencefoodbombscientistreadingbank …presidentsisterinjuryvirusplanetfatedead womanlostlonerinsultenergywifefighternotebookshortsnarratorgascleaningholeorganfairshelterpoorfathumanitymayhemnumberbomb shelterorder666scavengermotivationtaskmankindservicegruesomeback in timesystemlivingdigprimitivesharingconvictionpopulationrantingtouchimmune systemsavechroniclesideaconditioningprotectthemecleaning service (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
Themes: | funeraldeathmurderghostmonsterpsychopathsupernatural powerinsanitysadismevil |
Mood: | gorenightmareslasher |
Locations: | barchurchcemeteryschool boy |
Characters: | father daughter relationshipteenagermother daughter relationshipdoctorserial killernursetough guylittle girlsingle motherkillervillainterrorself mutilationslasher killeralcoholic father …serial murdererevil nurse (See All) |
Period: | 1980s |
Story: | body countcasedisturbingwrist slittingslashingtherapydreamfemale nuditynumber in titleviolencesequelbondagebare chested malecigarette smoking …surprise endingfirecorpsedigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperstabbingdeath of friendimpalementstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youkillingundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyecharacters killed one by onekilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armgroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
A large spider from the jungles of South America is accidently transported in a crate with a dead body to America where it mates with a local spider. Soon after, the residents of a small California town disappear as the result of spider bites from the deadly spider offspring. It's up to a couple of …doctors with the help of an insect exterminator to annihilate these eight legged freaks before they take over the entire town. (Read More)
Subgenre: | independent filmcult filmsuspensecreature feature |
Themes: | funeraldeathfearinvestigationparanoiapaniccouragenear death experienceunlikely hero |
Locations: | helicoptercemeterysmall townrural settingpolice carjunglesan francisco californiarain forest |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboybrother sister relationshippolice officerphotographerlittle girlnative americanlittle boyprofessorsheriff …coroner (See All) |
Story: | dead bodyhearsebodydeadcamerashowerone word titledogpartysurprise endingfirecorpseunderwearcatundressing …showdownneighborriverscientistsubjective camerasurvivalwineimpalementtoiletfalse accusationbirdcoffintrainingdangerlocker roompoisonrace against timetentgymdeath of husbandsuspiciondirectorial debutwaterfallheart attackrecord playercoachburned alivekilling an animalbarnmorgueamerican footballspidereccentricculture clashanimal attackearthquakewatching televisionbraveryboxer shortsmedical examinationautopsydead boycellarburned to deathsirensouthern accentenglishman abroadexpeditionhomagebugundertakerpopcornfish tankstretcherassistantmotorboatsouth americamicroscopedead birdguidestupid victimmortuarypet cattreadmillvenezuelatoy carmorticianfalling through the flooranimal in cast creditsfootball coachcanteencricketphonograph recordnail gunnestexhumationwine cellarblowtorchexterminatorgarden partypesticideequipmentencampmentdumb policeinfestationcocoonsinkholespiderwebtoxinremote controlled toy cararachnophobiaspecimenspider bitehuman versus spiderspider featurejungle expeditionkilling a bug (See All) |
The car of successful author Anna Rivers is found disabled next to the river, the thought being that she accidentally fell into the river while trying to change a flat tire. Her dead body is found upstream several weeks later, consistent with the accidental death theory. Based on incidents around hi …m, her grieving husband, architect Jonathan Rivers, decides several months later to visit with Raymond Price, who approached John prior to Anna's body being found with news that she was trying to contact him from beyond. At that time, John was skeptical of Raymond's claims of electronic voice phenomena (EVP): that he is contacted from the beyond through electronic means - radio, television - which he is able to record. Along with Sarah Tate, another of Raymond's "clients" whose fiance passed away, John becomes obsessed with EVP as he gets more and more audio and video messages, however fuzzy, from Anna from beyond. That obsession takes a slight change in focus when John believes that Anna is trying to pass along information to help others. But the nature of those messages and their connection to Raymond in combination with John learning that not all good comes through EVP leads to the possible belief that he dabbling in EVP in and of itself may be dangerous and the cause of those potentially deadly issues in which he is supposed to assist in helping. John has to decide whether or not to continue with his work in EVP, not continuing which means that he may actually prevent bad thing… (Read More)
Subgenre: | videosuspensesupernaturalparanormal phenomenasupernatural horror |
Themes: | naturefuneraldeathghostpregnancytortureangerobsessionsupernatural powergriefabductiondeath of wifepolice investigation |
Locations: | hospitalchurchswimming poolcemeterywheelchairpolice car |
Characters: | husband wife relationshipfather son relationshipmother son relationshipdoctorboypolice officerbabywriterpriestpolice detectiveex husband ex wife relationshipdeath of hero |
Period: | seeing the future |
Story: | dead bodythoughtinformationbodydeadphotographcell phonecorpseshot to deathcar accidentslow motion scenewatching tvcomputerfalling from heighttears …color in titlerivertelevisionreporterflashlightbound and gaggedsuicide attemptcoffinnews reportgunshotgraveauthorhotel roommicrophonesuburbwidowermoaningdisappearancepsychicoccultanswering machinespiritdesirelifting someone into the airarchitectloss of wifevideotapelosstimepromiseremote controlheadphonesnovelistpierbruisebeing followedabandoned buildingapparitionblackoutpregnancy teststepmothernewspaper articlebusiness cardmediumaudio cassettehome videoinspectorlifting person in airvideo cassettevolkswagen beetlevoicebedriddenhusband wife reunionwirewaterfronttape over mouthlistening to the radiowhite noisetv monitorbook publishingable to hear the deadcommunicating with the deadelectronic voice phenomenalogbookelectric cablenear miss (See All) |
Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.
Subgenre: | cult filmblack comedysuspensepost apocalypsecreature featurezombie apocalypseamerican horrorsadistic horrorzombie outbreakfrench horrorcanadian horror |
Themes: | deathmurdersuicidefearracismbrutalitysadismgreedapocalypsecannibalism |
Mood: | goredarknessblood and goresequel to cult horror |
Locations: | urban settingcitytruckgas station |
Characters: | zombieafrican americanprostitutevillain |
Period: | 1990syear 1995 |
Story: | dead bodydisturbingslashingdeadfemale nuditybloodviolencesequelexplosionlesbian kisspistolshootoutcorpseshot to deathblood splatter …machine guncar accidentshot in the chestshot in the headrescuearrestshootingjailriverdecapitationdeath of friendexploding carsevered headdouble crossshot in the legshot in the foreheadracial slurlimousineperson on fireelectrocutionkicked in the faceshot in the shoulderexploding bodyratmercenaryshot in the armcult directordismembermentundeadblood spatterarsonsplatterdisasterhead buttmachetevirusfourth partassaultsevered handskateboardrocket launcherend of the worldback from the deadeaten alivesevered fingerfight to the deathgash in the faceshopping mallbutcherexploding headdisembowelmentracistsiegesevered legethnic slursequel to cult favoritetorso cut in halfmexican americanbad guybeheadingliving deadkillgun in mouthskyscraperfortressshot in the eyemeat cleaverburnt bodyshot through the mouthextreme violenceshot in the throatflesh eating zombiegraphic violencewalking deadbloody violenceburn victimshot in the crotchsevered footbutcheryevil clownbody partoutbreakzombie attackpittsburgh pennsylvaniastairwellbitten in the throatliquor storehung upside downdoomsdayauto theftsliced in twofireworklawnmowerbitten handbodily dismembermentflesh eatingevil deadanthropophagusgory violencespear guneast coastzombificationgruesomehell on earthman eaterbody partsblown to piecesdrawbridgezombie biteabandoned citydeadly diseasebrutalmonster as victimhole through torsopiercing ripped outthrowbackzombie with gunzombie invasionzombie clown (See All) |
A janitor at a summer camp is accidently burned severely from a prank. Years later, he is released from an institute, and returns to the camp with a pair of hedge clippers to take revenge on the campers.
Subgenre: | independent filmcult filmblack comedysuspensedark comedyb movieb horrorslasher flickteen moviedisneyteen horroramerican horrorindependent horrorbritish horrorcanadian horror …slasher horror (See All) |
Themes: | deathmurderrevengevoyeurismpsychopathinsanitysadismevilbullying |
Mood: | goreslasher |
Locations: | hospitalforesthelicopterboatwoodswheelchairsealakebaseballoceancampfirestormbackwoodsrunning through the woodssex outdoors …by the sea (See All) |
Characters: | teenagerfriendboyfriend girlfriend relationshipdoctorboyteenage girlprostituteteenage boyserial killerbullykillervillainterrorslasher killermysterious villain …out of control (See All) |
Period: | 1980ssummer |
Story: | body countsexual attractiondead bodyslashingattractionshowersexfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nudityflashback …male rear nuditygunsex scenekissfemale rear nudityfightcigarette smokingnipplesknifechasepantiesfirecryingblood splattermirrorrescueslow motion scenecondomundressingbikinimasklow budget filmvoyeurcriminalf wordsubjective cameraswimminggood versus evilsurvivalfoot chaseflashlightaxemassacrestabbingthroat slittingimpalementstabbed to deathaccidentapologybirdroommateskinny dippingsmokingstalkerstrippingperson on firecharacter's point of view camera shotsuitcasemissing personevil manscreamprankdisappearancestalkingwitnesssuspicioncabinsevered armteenage sexmaniacholidaydisastercard gameburned alivedesirenipples visible through clothingelectronic music scoremass murderfriendship between menmutilationbarnstabbed in the stomachmale bondingmagazinecrying womancamppsychoswimsuitgaggedskullblack humorcommunityfollowing someonemasked mansexual desireredneckplayboy magazinesevered fingerstabbed in the throatscissorsoillostsexual harassmentslaughtersexual humordisfigurementaxe murderflamethrowermasked killersunbathingpsycho killerplaying cardspractical jokebeing followednude swimmingserial murderpsychopathic killertaking a showerbad guymysterious manporn magazineoutcastshortsdockrepeated sceneurban legendhuman monstersummer campcanoetelling someone to shut upwoodhomicidal maniacbroken windowrafthospital roommasturbation referencecliniccigarettewormmooningbaseball gamefinger cut offbreaking a windowmotorboatunderage smokinghorninesssexual frustrationcrying femaleextreme violencejumping into watermultiple murdercaretakerseductive behaviorman on firearm cut offwoman slaps a mansadistic psychopathpsychotronic filmburn victimhouse on firemurder spreenude bathingmass murdererimmolationfinding a dead bodygrindhouse filmdovepremature ejaculationpointing a gun at someonescreaming womanstabbed with scissorsburningshower roomhysterical womandiscovering a dead bodybloody facepassive aggressive behavioraxe in the headsecretly observingmultiple homicidehand injurypassive aggressive womanpranksterlost in the woodssocial outcastabandoned mineoil rigruinwoman hits a manmissing womansummer holidaynew york stateplan gone wrongover the topscreaming manroommate roommate relationshipvideo nastywatching someone sleepgarden shearscamp counselordisbeliefcampfire storymurder by stabbingpost coital sceneshower curtainprank gone wrongpushed into watersupervisorvitaminarm injuryseductive mansetting a firemalicestolen clothestalking about masturbationfacial injurymale female fightsleeping shirtlessfacial disfigurementforced kisspretending to sleepspurting bloodviolent manhustler magazinebluegrass musicswimming in a lakeweirdburning fleshleavingserial child murderinsane manobscene hand gesturereference to penis sizenaked bathingcrying for helpmistaken belief that someone is deadscissorpellet gunserial child murdererthroat slitslapped in the faceteenage prankstersleeping in underwearvoice over flashbackburned handfinger injuryreference to playboy magazinetalking to a dead bodyday for nighthedge trimmerhiding behind a treeocean floorplaying baseballsexual urgedrilling for oilmasturbation gesturenon disclosure agreementsleeping fully clothed (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
Themes: | deathmurdertorturepsychopathbrutalitysupernatural powerinsanitysadismevil |
Mood: | goreslasherbreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | brother sister relationshipteenage girlteenage boyserial killerkillervillainterrorslasher killermysterious villainserial murderermysterious killer |
Period: | 1980s |
Story: | body countsexual attractiondisturbingslashingsexfemale nuditynumber in titlebloodmale nudityviolencebare breastssequelfemale frontal nuditymasturbationmale rear nudity …female rear nuditysurprise endingpantiescorpseunderwearblood splattermasklow budget filmsubjective cameradecapitationstrangulationimpalementstabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurderercabinloss of motherobscene finger gesturekillingmaniaclifting someone into the airragemutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carcharacters killed one by onekilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrorhockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Illustrator Natalie is forced to create four terrifying stories for the new comic book "Hi-Fear".
Subgenre: | video |
Themes: | escapejustice |
Mood: | gore |
Locations: | forest |
Characters: | friendartist |
Period: | 80s |
Story: | body countthoughtsegmentsstoriescountbodycamerabookanthologycouplejazzlawcomic bookgrindhousevirginity …cameoinvasionunfaithful wifesoulnotemeetinglightwifeeyecomicshot on videoyoung mandigitalheadachestaffslimetrilogyremoteyoungdamagemovementvintagetelevangelistlocationfuntaledigital filmjazz scorelandmarkbloodyglorytalespriceafternoonappealremote locationlosingannouncementestablishmentsplashunfaithful2013throwbackjokesfilm damage (See All) |
Three college students stumble upon a secret television broadcast of a deceased serial killer and search for its location.
Subgenre: | found footageparanormal activity |
Themes: | childhooddeathprisonobsessiondying |
Mood: | slasher |
Locations: | carwoodspolice stationstation |
Characters: | policeserial killerpolicemankiller |
Story: | serial killersfamiliarsegmentsserialkillersinformationdeadinterviewgunknifeshootingbookrunningbedinterrogation …collegesearchclownbusinessdarkclasscopcrime scenefancameramandeath penaltyruncelltrackprotectioncardsjumpdecisiondealpocket knifedirectioncreepytelevision broadcastlocationwastetrailpublishingabandonedgrotesquewanderingbroadcaststudentsstretchinghorror filmroutecooperationcollege studentslivingcluespassmomentkilledtitle cardsdecision makingpenaltybreakpost credits scene (See All) |
A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old …televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)
Subgenre: | videosupernaturalfound footage |
Themes: | deathmurderghostdrunkennessdeceptionsupernatural powerevilhome invasionreligious cult |
Mood: | goredarknessone night |
Locations: | barforestroad triplakemotel |
Characters: | zombiehusband wife relationshipalienkillerghost in mirror |
Period: | year 1998 |
Story: | dead bodybodydeadfemale nuditybloodmale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudityfemale full frontal nudity …title spoken by charactermale full frontal nudityknifelesbian kisstopless female nuditycorpserescuedemontelevisionsubjective cameradecapitationhalloweenflashlightgangvideo camerathroat slittingimpalementcocainestabbed to deathsevered headritualanthologylooking at the cameratalking to the cameraskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love youhaunted houserevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmenthandheld cameraone daytitle at the endknife throwingcastrationlooking at self in mirrorlens flareabbreviation in titlecharacters killed one by onefortune tellermarijuana jointblood on camera lenswoman cryingwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All) |
While investigating a call in an abandoned house, Officer Frank Williams and a rookie find a woman brutally blinded, but they are attacked by a huge psychopath with an ax; the rookie is killed and Frank shoots the criminal in the head, but has a severed arm. Four years later, the mutilated Frank is …relocated, working as a guard in the County Detention Center. Frank goes with some delinquents to the Blackwell Hotel, an abandoned place since a fire burnt the last two floors, with the purpose of cleaning the location, preparing it to work as a shelter for the homeless; in return, the criminals will have their sentences reduced. During the night, the inmate Kira who has some Christian tattoos on her body is kidnapped by the deranged serial-killer Kane who collects the eyes of his victims, while the rest of the group is attacked by the psychopath with his ax. (Read More)
Subgenre: | psycho thrilleraustralian horroramerican horrorindependent horrorsadistic horror |
Themes: | murderrevengedrugsreligionprisontorturetheftpsychopathbrutalitydrug usesadismevilmurder of a police officer |
Mood: | gore |
Locations: | hospitalhotelelevatorkitchen |
Characters: | policemother son relationshiptattoolustvillainterrorreligious fanatic |
Period: | 2000s |
Story: | body countcriminalsserialworkingheadbodyshowerbloodviolenceflashbackmasturbationdoggunchasesurprise ending …pistolcorpseblood splattermirrorurinationshot in the headfalling from heightlow budget filmbathroomflashlightbound and gaggedstrangulationaxethroat slittingimpalementchild abuseevil manattempted rapestalkingsevered armmaniacpornographycagelifting someone into the airpsychoanimal attackcrushed to deathpresumed deadstabbed in the headstabbed in the legeye gougingstabbed in the eyecharacters killed one by onepsychoticpsycho killersinserial murderpsychopathic killersuffocationbad guyhuman monsterhomicidal maniacfemale psychopatheyeballcrushed headfemale villainevil womanmaggotmurderessmatricidelunaticsadistic psychopathmurder spreestupid victimcrime spreecaptivitycreepabusive motherwardenstun gunpsycho terrorfemale serial killersnorricamprosthetic limblifting a female into the airfragments of glasskilled in an elevatoranimal rights activistjuvenile detentionone armed mansickobad girlmeat hookstabbed through the chinchoked to deathfliesspinning axereference to three wise monkeys (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | deathmurderrevengefearpsychopathbrutalityinsanitysadismevilexploitationpolice investigation |
Mood: | gorerainnightmarenightslasherdarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | policemother son relationshipteenagerbrother brother relationshipserial killerkillervillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | body countdead bodyslashingdeadseriessexfemale nuditynumber in titlebloodviolencebare breastssequelfemale frontal nuditykissdancing …chasesurprise endingpantiesdigit in titleblood splatterlow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyeaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstonehillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
An unfortunate young woman, Marta, meets her tragic end in a horrendous car accident and is later transferred to the morgue. Later that night, two mortuary technicians finish their shift, however, one of them decides to stay and locks himself in the autopsy room to be left undisturbed with Marta's f …resh cadaver. Little by little, the examiner by taking his time undressing and fondling the dead body, he gets excited, mutilating and then molesting the corpse with enthusiasm, while at the same time, he takes morbid mementos with his camera. In the end, when everything is finally over, the man also takes with him another grotesque souvenir and heads back home. (Read More)
Subgenre: | independent filmmedical |
Themes: | evil |
Mood: | gore |
Story: | dead bodynecrophiliabodydeadcamerabloodviolenceone word titledogcorpsemorguedead womanautopsyperversiondead man …brainintestineswalkmandepravitycadavernecrophiliacsex with the dead (See All) |
Sheriff Dan Gillis has a nice life with his wife, the teacher Janet Gillis, in the small coastal and friendly town of Potter's Bluff. When visitors are mysterious killed in the town, Sheriff Gillis investigates the cases carefully and finds that dead people are reanimating and coming back to life. D …an finds a book of witchcraft and voodoo in his wife's drawer and he suspects that she might be practicing black magic. Dan meets the coroner-mortician William G. Dobbs and learns the dreadful and surprising secret. (Read More)
Subgenre: | independent filmsupernatural horror |
Themes: | murderadulterytortureseductionangersadismphotographycrueltytraumamurder investigationmysterious death |
Mood: | gorenight |
Locations: | hospitalcarsmall townofficecar on fire |
Characters: | zombiedoctorpolice officerdetectivephotographerwaitresspolice detectivesheriff |
Story: | dead bodydeadattractioncamerafemale nuditybloodviolencegunkissnipplesphotographsurprise endingtelephone callfire …punctuation in titlebeatingcorpseblondehallucinationrevolverflashlightold manmassacredinerhousebrunettegraveyardlatex glovespainpoint of viewscreamingperson on fireglassestrapundeadampersand in titleexperimentropehuggingdestructiondressredneckphoto shootsufferingmercilessnesshit on the headdead manstabbed in the eyelaughingvoodooleather jacketmysterious manharborbandagecar drivingjazz musicacidfilm projectorundertakernurse uniformhospital roomburnt facejacketburnt bodyextreme violencemysterious womanman wearing glassestraumatic experiencemurder victimmorticiannettortured to deathset on firemovie projectortrailer narrated by percy rodriguezpolice vanmutilated corpsevideo nastyatonal music scoreneedle in eyemusic score features saxophonebig band music (See All) |
Isabella, a young model is murdered by a mysterious masked figure at a boarding house run by Max Morlacchi and his lover Countess Cristiana Como. When Isabella's boyfriend is suspected of the killing, her diary, which apparently has some incriminating evidence linking her to the killer, dissapears, …the masked killer begins killing off all the models in and around the house to find the diary. (Read More)
Subgenre: | cult filmsuspensepsycho thrillerslasher flickitalian horror |
Themes: | murderfriendshipinfidelitydrugsjealousyadulteryfeartortureinvestigationvoyeurismextramarital affairangercorruptionpsychopath …brutalityobsessionparanoiablackmaildrug useguiltinsanityunfaithfulnessmental illnesssadismcrueltypanictraumadrug addictionaffairmysterious deathpsychological trauma (See All) |
Mood: | gorenightslasherdarknessaffection |
Locations: | bathtubwaterapartmentitalyoffice |
Characters: | policeboyfriend girlfriend relationshippolicemanpolice detectivepsychiatristsecretaryolder man younger woman relationshipmysterious villain |
Period: | 1960s |
Story: | sexual attractionwrist slittingslashingattractiondiarysexfemale nuditynumber in titlebloodviolencegunkisschasesurprise endingpanties …telephone callfirehigh heelsbeatingshot to deathunderwearblood splattershot in the chestface slapdrinkarrestthongmaskheld at gunpointlingeriebedhallucinationvoyeurcriminaltelephonebedroombrastrangulationmassacreambulancewidowcocaineaccidentmodelbrunettefalse accusationcultdrowningpaintreedangerfantasy sequencesensualitymanipulationwigstalkingthreatwitnessbasementsuspicionmurderercult directorsacrificerevelationdesirewounddressrome italyhatragemutilationdesperationcovered in bloodpsychologistdriving a cardead womanembarrassmenthomicideapartment buildingsexual desirecynicismgunshot woundstairsbathingfrustrationshadowdead manslaughterchairnotedark pastroombruisedead woman with eyes openmasked killerlingerie slipframed for murdermannequinpsycho killerdead girlgirl in bra and pantiesconfusionmysterious mandark secretviolence against womenglovesold dark houselong hairmental breakdownrepressionhomicidal maniacvillawhodunitdegradationblood stainburnt facehead bashed inpurserazorwrathbleedingfashion modelmurder suspectmurder witnesssexual frustrationsexual repressionmenacemultiple murderknife murdercaressgialloinspectorfemale victimoff screen murdercrime investigationdisturbed individualsexual obsessionbludgeoningmurder victimwoman in dangerstraight razorcurtainmysterious strangerfedoraburningdead woman on floordeeply disturbed personcutcoatantique shopburnmultiple homicideblack glovesdead woman on groundcar alarmburnt handpsycho sexualmurder disguised as suicidesmotheringstrange personfemale murdererwoman drownedfemale corpsedrowning in a bathtubman murders a womandark killerhaute coutureescaped killermurder by stranglingstocking maskwoman murders a womanmystery individualpolice psychologistblack gloved killerpounding on a doorstalking victimdead woman in car trunkblack suit clad killerhomicidalcar run overmultiple suspectsfashion houseopening creditswoman in a bedsearch for killerdead modeldead woman draggedred telephone (See All) |
After a horrific car accident, Anna (Ricci) wakes up to find the local funeral director Eliot Deacon (Neeson) preparing her body for her funeral. Confused, terrified and feeling still very much alive, Anna doesn't believe she's dead, despite the funeral director's reassurances that she is merely in …transition to the afterlife. Eliot convinces her he has the ability to communicate with the dead and is the only one who can help her. Trapped inside the funeral home, with nobody to turn to except Eliot, Anna is forced to face her deepest fears and accept her own death. But Anna's grief-stricken boyfriend Paul (Long) still can't shake the nagging suspicion that Eliot isn't what he appears to be. As the funeral nears, Paul gets closer to unlocking the disturbing truth, but it could be too late; Anna may have already begun to cross over the other side. (Read More)
Themes: | funeraldeath |
Mood: | nightmare |
Locations: | restaurantcemeterywheelchair |
Characters: | family relationshipsteacherserial killerfuneral directornear death |
Story: | feelingdisturbingbodydeadshowerfemale nudityf ratedfemale rear nudityfemale full frontal nuditywatching tvcandlegraveargumentinjectionfull frontal nudity …period in titlesyringelooking at oneself in a mirrorred dresscrucifixnosebleedcrying manshovelscissorsheartnewspaper clippingengagement ringman cryingburied alivefilm starts with sexmortuarycaskettear on cheekcamera focus on female buttcmnflocked infemale star appears nudetalking to the deadcmnf scenedriving in the rainstitchesbackhand slapdeath certificatekilled in car accidentsliplilyclothes cut offdead but doesn't know ithitting a childsoft spoken (See All) |
Thanks to a major power cut, a gang of psychopaths breaks out of the Haven maximum security mental institute in order to lay siege to the psychiatrists who have tormented them over the years with their bizarre theories...
Subgenre: | independent filmcult filmblack comedysuspensedark comedyamerican horror |
Themes: | deathmurderrevengeescapepsychopathbrutalityinsanitymental illnessevilpolice investigation |
Mood: | gorenightmarenightslasherdarkness |
Locations: | carsnowsmall townbicyclewoodsbackwoods |
Characters: | family relationshipsdoctorbrother sister relationshipserial killerkillervillainterrorslasher killerserial murderer |
Period: | 1980s |
Story: | body countdead bodydisturbingslashingbloodviolencefemale frontal nudityknifepantiestelephone callfireblood splatterjailconcertstabbing …dinerhousechild in perilvanstalkerevil manstalkingbasementmurderermaniacelectronic music scorebabysittermutilationnosebleedgrindhousepsychologistvictimrapistmental institutionrampagewoman in jeopardycrossbowpower outagethrown through a windowpedophilemurder of a childsiegeintrudermasked killerpervertpsychopathic killerbad guymental patientfire extinguisherblackouthomicidal maniacshot with an arrowmeat cleavergraphic violencechild molestermasked villainknife murdermailmanbloody violencefemale victimmass murderergrindhouse filmcreeplootingmental asylumsecurity systembarricadechild killerchild murdererhockey masktorturerdaydrive in classicserial child killereast coastgruesomemutilated bodyescaped killerattempted child murdermetal musicmental wardserial child murderspringwood ohioserial child murderercut telephone line (See All) |
In an Earthly world resembling the 1950s, a cloud of space radiation has shrouded the planet, resulting in the dead becoming zombies that desire live human flesh. A company called Zomcon has been able to control the zombie population. Zombies can be temporarily neutralized by being shot, but can onl …y be permanently neutralized by their brain being destroyed. Their ultimate disposal is through cremation, or burial, the latter which requires decapitation with the head being buried separately from the body. Conversely, Zomcon has created the domestication collar, when activated and placed on a zombie makes the zombie controllable and thus an eternally productive creature within society. Because all dead initially become zombies, the elderly are viewed negatively and suspectly. And all people, adult or child, learn to shoot to kill to protect society. Zomcon is the go to organization for all things zombie. In the town of Willard, the Robinsons - father Bill, mother Helen, and adolescent son Timmy - are one family who don't own a zombie as a domestic since Bill is afraid of zombies, as, when he was a child, he had to shoot his own zombie father, who tried to eat him. Bill has thus become fascinated with funerals to see zombies put away permanently. But Helen feels pressured to get a zombie when Zomcon's new head of security in Willard, the officious Jonathan Bottoms, moves into the neighborhood with his family. Never having had to deal with a zombie directly, Timmy is initially wa… (Read More)
Subgenre: | cult filmblack comedy |
Themes: | first lovefuneraldeathmurderfriendshippregnancymonsterexploitationcrueltycannibalismunlikely hero |
Mood: | goresatirespoofmurder of a boy |
Locations: | cemeterykitchen |
Characters: | zombiefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipboywarriorbully |
Period: | 1950s |
Story: | dead bodyheadbodydeadcharacter name in titleone word titlekisscigarette smokingchasemachine gunshot in the chestshot in the headslow motion scenewatching tvrunning …neighborclassroomdecapitationsevered headcoffinhit by a carcreatureold womanshot in the foreheadbeaten to deathsuburbscreamsevered armnewspaper headlineeaten aliverampageremote controltarget practicechild's point of viewchild protagonisthousewifemurder of a childsiegedead boysevered legneighborhood12 year oldfenceacidpeer pressurehazingunplanned pregnancykiller childzombie violencedelivery manevil corporationzombie attackgrave diggingevil childconformitytied to a treechild with a gunchild killerzombie childnext door neighborleashmass destructionwalkercanuxploitationreal life mother and daughter playing mother and daughterloud shirtchild as main characterchild uses a gunmultiple monsterswashing a carlawn mowingboy in perilboy dog relationshipbb guncrossing guardboy in dangerbloodthirstylove slaveemotionally unavailable (See All) |
After accepting a job at a low-rent pornographers, a feisty young woman must fight to survive against an ancient evil intent on killing everyone in its path.
Subgenre: | suspensesupernatural |
Themes: | fearfilmmakingevilthe devil |
Mood: | parodyslasher |
Characters: | girlfilmmakerfather |
Story: | body countfamiliarleavedeepcountworkingbodypresentsexbloodmaskshootingdecapitationcurse …prologueattackbusinessdarkgeneralheroinemacheteskulllow budgetmovie setboyfriendnotetripyoung womanrunno budgetclothesjumpfranchisepremierefunorderancientplayingenthusiasmbondtribalfilmmakerscurseddreadhorror filmstealrangestolenfinal girlimpressionproofsacredporn businessdierootoddballpresent daybackstory (See All) |
The head girl Justine gives a speech on the funeral of the teenage schoolmate Darren Mullet who has just committed suicide but she does not recall who he was. Then she is invited by Alexis to date him in the celebration party in the house of his friend Bradley. Soon Justine discovers that Darren had … a crush on her and was bullied by Bradley and his friends including Alexis. When each one of Bradley's friends is found dead, they discover that Darren has returned from beyond to revenge the humiliations he was submitted to. (Read More)
Subgenre: | slasher flick |
Themes: | funeralrevengeghostbullying |
Mood: | slasher |
Locations: | sex in car |
Characters: | teenagerteenage girlteenage boybullyslasher killer |
Story: | body countheaddeadshowermale nudityone word titlemale rear nuditybare chested maledecapitationimpalementsevered headdrowningscene during end creditssevered handcharacters killed one by one …dead woman with eyes openmale in showerframeddead teenagersevered peniswoman drownedasthma inhalerdead body in swimming poolstabbed with a screwdriverfinal girlhappy slappingreturn from dead (See All) |
After writing a series of articles about pedophilia, the journalist Ji-won receives threatening calls on her cellular and she changes her number. Her close friend Ho-jung and her husband Chang-hoon invite Ji-won to move to their house in Bang Bae that is empty and closed. When the young daughter of …her friends Young-Su answers a phone call in her mobile phone, the girl screams and changes her behavior, feeling a great attraction for her father and rejecting her mother. Meanwhile Ji-won receives weird phone calls and sees and listens to a teenager playing Beethoven's "Moonlight Sonata" on the piano. After investigating her phone number, Ji-won discovers that the original owner of the number, Jin-hee, had vanished and the two next owners of the number have mysteriously died in unusual circumstances. Her further investigation about Jin-hee discloses that the teenager was absolutely disturbed with her obsessive love for a man that had broken the relationship with her, and later she unravels dark and tragic secrets about the fate of Jin-hee. (Read More)
Subgenre: | suspense |
Themes: | lovedeathmurderrevengeinfidelityghostpregnancyextramarital affairguiltmurder of husband |
Mood: | rainnightmarecar chase |
Locations: | bathtubhospitalsnowelevatoroceantaxi driver |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipdoctorfemale protagonistbabypsychiatristself mutilationghost in mirror |
Story: | feelingwrist slittingattractionseriesdiarydreambloodone word titlefemale frontal nudityflashbackbare chested maletitle spoken by characterknifesurprise endingtelephone call …cell phonecorpseface slappunched in the facepaintingcar crashclassroomjournaliststrangulationstabbed in the chesttied to a chairparkstalkerscreamingpossessiondolldeath of childflowerslaptopschoolgirlthreatened with a knifeheart attackfalling down stairskicked in the stomachart galleryduct tape over mouthmurder of a childgasolinephoto albumserial murdertaserlong hairsubway stationpiano playingkoreanpregnancy testsouth koreatreadmillfootprintflickering lightolder man young girl relationshipsecurity systemhandkerchieftrapped in an elevatorsex scandalhiding in a carjealous wifeanonymous telephone callnail through handhole in wallphone terrorstabbed in the eartelephone terrorfingernail cut offscared to deathegg donorbody hidden behind a wallmoonlight sonata (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | independent filmcult filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror |
Themes: | deathmurderfriendshiprevengedrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion …exploitationpanicpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | bathtubhospitalforestbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | dead bodyrentbodydeadshowerfemale nuditybloodviolencefemale frontal nudityflashbackmasturbationdogbare chested malesex scenefemale rear nudity …cigarette smokingfingeringphotographpartyknifechasesurprise endingpantiespistolfirecell phonewoman on topbeatingcorpseshot to deathblood splatterhorsecar accidentshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerlow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushaxemassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
Themes: | deathmurderdrugsrapetortureincestpsychopathbrutalityinsanityevilexploitationmurder of family |
Mood: | goreslasher |
Locations: | chicago illinois |
Characters: | brother sister relationshipprostituteserial killerkillervillainterrorslasher killermysterious villainserial murderermurder of a prostitute |
Period: | 1980s |
Story: | body countleaveserialslashingfemale nuditycharacter name in titlenuditybloodviolencebare breastsgunsurprise endingshot to deathblood splatter …shot in the chestlow budget filmmarijuanacriminaldecapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentkillingsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
A remake of George Romero's 1968 black-and-white classic that begins in a cemetery, as the recently-dead return to life - from an unknown cause - and attack the living as their prey. One woman escapes the frightening zombies to take refuge with others in a farmhouse, as every cadaver for miles aroun …d hungers for their flesh. Will they make it through the night...that the dead came back to life? (Read More)
Subgenre: | cult filmsuspensesurvival horrorzombie apocalypseamerican horrorzombie outbreak |
Themes: | deathmurdersuicidefearapocalypsecannibalismmadnesswilderness |
Mood: | goredarknesshorror movie remakeblood and gorezombie film |
Locations: | helicoptercemeteryamericapennsylvaniabackwoodsback country |
Characters: | zombieafrican americanboyfriend girlfriend relationshipterror |
Period: | 1990syear 1990 |
Story: | dead bodydisturbingdeadbloodmale nuditymale rear nuditybare chested maleexplosionfirecorpseblood splatterremakeshot in the headshotgunbeer …exploding cargraveyardpantyhoseshot in the foreheadperson on fireattackcountrysidebasementvigilantekillingundeadblood spattersplatterchainsaweyeglassesvirusloss of loved oneloss of wifesevered handend of the worldback from the deadbikereaten alivecamera shot of feetredneckinvasionchaosbutcherdead childdead manloss of brotherfemale stockinged feetleather jacketliving deadloss of daughterfarmhousefoot closeuphillbillycarnagefriends who live togethersole black character dies clicheextreme violenceflesh eating zombiegraphic violencewalking deadbloody violencesole survivorzombie violencebiker gangghoulbutcherybody partoutbreakzombie attackpittsburgh pennsylvaniabitten in the throatdoomsdayzombie childcreepyflesh eatingruralmultiple cameosdrive in classicanthropophagusgory violenceeast coastremake of cult filmzombificationeating human fleshgruesomehell on earthbody partsflesh eating zombiesfighting womenzombie bitecult favoritedeadly diseaseflesh eaterloss of family memberzombie invasionbald zombie (See All) |
The wife and mistress of a sadistic boarding school headmaster plot to kill him. They drown him in the bathtub and dump the body in the school's filthy swimming pool... but when the pool is drained, the body has disappeared - and subsequent reported sightings of the headmaster slowly drive his 'kill …ers' (and the audience) up the wall with almost unbearable suspense... (Read More)
Subgenre: | cult filmconspiracymurder conspiracy |
Themes: | deathmurderrevengeinfidelityadulteryfeardeceptionextramarital affair |
Mood: | murder plot |
Locations: | bathtubtrainschoolswimming poolcartaxiapartmentfranceschool teacher |
Characters: | husband wife relationshipfemale protagonistteacherdetectiveneighbor neighbor relationship |
Period: | 1950s |
Story: | dead bodybodyseriesf ratedbased on novelviolencetwo word titlephotographsurprise endingcorpsesecretbathroomclassroomwinedriving …double crossdrowningmanipulationautomobilesleepingheart attackstrong female characterprivate detectivemorgueintrigueblack and whiteboarding schooldead woman with eyes opentaking a photographwifecar drivingfemale teacherschool principalprincipalbreaking a windowmanipulative behaviorpsychotronic filmheadmasterstrong femalemanipulative womanpreparatory schoolguilty conscienceboys' schoolmanipulative manphilanderermurder by drowningloverdrowning in a bathtubmissing bodybronzebelief in ghostsblack and white filmboys' boarding schoolstocking feetcitroen 2cv (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | deathmurderfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | gorenightmarecar chasenightslasherdarknessblood and gore |
Locations: | bathtubhospitalforestwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend …killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | body countdead bodyslashingnecrophiliadreamshowerfemale nudityf ratedbloodviolencebare breastsfemale frontal nudityflashbackmasturbation …dogguncigarette smokingphotographknifelesbian kisschasesurprise endingtelephone callcorpseblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashlow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmateaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathlistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
A wave of gruesome murders is sweeping Tokyo. The only connection is a bloody X carved into the neck of each of the victims. In each case, the murderer is found near the victim and remembers nothing of the crime. Detective Takabe and psychologist Sakuma are called in to figure out the connection, bu …t their investigation goes nowhere. An odd young man is arrested near the scene of the latest murder, who has a strange effect on everyone who comes into contact with him. Detective Takabe starts a series of interrogations to determine the man's connection with the killings. (Read More)
Themes: | deathmurdersuicideescapeinvestigationmemoryinsanitymental illnessdeath of wifeamnesiaphilosophythe devil |
Mood: | rainneo noir |
Locations: | hospitalbeachrestauranthotelbuswheelchairjapanrooftoptunnel |
Characters: | husband wife relationshippolicefather daughter relationshipdoctorprostituteteacherserial killernursepolicemanwaitresspolice detectivepsychiatristsuicide by hanging |
Story: | dead bodyarrestedcaseseriestherapyshowerfemale nuditybased on novelbloodmale nudityone word titleinterviewflashbackcigarette smokingphotograph …knifesurprise endingcryingcell phonebeatingcorpseunderwearfoodmirrorshot in the headcomputersecretshootingbookbeertearsinterrogationcafehallucinationhandcuffscriminalnewspaperflashlightstrangulationthroat slittingeatingfootballcoffeelatex glovesconfessionmicrophonereadinghanginglong takescarwitnesssleepingmonkeyhaterecord playertwenty somethingteahidingpsychologystrangermind controlwatching televisiontokyo japanconvenience storemental hospitalhypnosiscigarette lighterlostsuspectfemale doctorclassmateceremonyvideo tapemysticismjunkyardwalletrestroomscalpelepiloguehypnotismcop killerpsychotherapyfingerprintpolice sirenpsychosistoothbrushcaged animaldeath by hangingjumping from a rooftopflickering lightburnrailroad crossingworryinginfluenzabludgeoned to deathheresyokinawa japanfootbridgei.d.dry cleanerssuicide of wifepersonality disordernegligeehypnotherapyankle injurythrown out a windowsprained anklereference to carl jungconjurershot in the back of one's headcop killed by a coppost hypnotic suggestionmesmerismpsychology studentpolice boxwater thrown into someone's faceonce upon a timewater leak in the ceilingbluebeardspilled water (See All) |
Based on a true story set in pre-war Japan, a man and one of his servants begin a torrid affair. Their desire becomes a sexual obsession so strong that to intensify their ardor, they forsake all, even life itself.
Subgenre: | cult film |
Themes: | lovedeathmurderrapejealousyadulterylesbianismdrinkingvoyeurismobsessioninsanitysexualityfalling in love |
Mood: | affection |
Locations: | japansex outsidesex in public |
Characters: | lust |
Period: | 1930s |
Story: | sexual attractionstrongsexualattractionfemale nuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditymasturbation …male rear nuditysex scenekissfemale rear nudityfemale full frontal nudityejaculationnipplesmale full frontal nudityknifeleg spreadingerectionlabiabased on true storylickingfondlingcryingwoman on toptesticlespenetrationfoodurinationwritten by directordrinkbedvoyeurorgybedroombreast sucklingstrangulationarmyhousecontroversyspermstrippingpassionsensualitysadnesscult directorwhat happened to epiloguedesiredressegghappinessmutilationbisexual girlsadomasochismcoitussexual desiresex talksnowingcastrationunsimulated sexstadiumroomcopulationexhibitionismexplicit sexjoymenstruationfingering vaginabitternesssexual tensionexhibitionistinfatuationnihilismobsessive loverobekimonogropingtragic lovewoman slaps manpleasuresexual obsessionmusical instrumentman slaps womansexual explorationsex addictionwashingsex with foodsex addictsex gamegeishasteam trainobject in vaginacaressingerotic asphyxiationman and woman in a bedsexual satisfactionpsychological tormentpre warsexual behaviorloverpre world war twoyear 1936possessivenesshuman sexualityfood in vaginasexual murdersliding doorface slappingtouching peniserotic gameshiveringsmellpossessive loveegg in vaginawriting on a corpse (See All) |
In the 13th century there existed a legion of evil knights known as the Templars, who quested for eternal life by drinking human blood and committing sacrifices. Executed for their unholy deeds, the Templars bodies were left out for the crows to peck out their eyes. Now, in modern day Portugal, a gr …oup of people stumble on the Templars abandoned monastery, reviving their rotting corpses to terrorize the land. (Read More)
Subgenre: | cult filmzombie survivalspanish horror |
Themes: | deathmurderfriendshiprapetortureescapevoyeurismseductionbrutalitysupernatural powerhumiliationsadismevilcruelty |
Mood: | goredarknessaffection |
Locations: | trainswimming poolrural settingcastletrain station |
Characters: | zombiefriendbikini girlzombie soldier |
Story: | sexual attractiondeadattractionseriessexfemale nuditynuditybloodviolencebare breastsflashbackkissfemale rear nuditynippleslesbian kiss …firetopless female nudityfondlingcorpseblood splatterhorseblondeswordbikinibare buttvoyeurbisexualbrabreast sucklingstabbingstabbed in the chestpart of seriesrituallesbian interestgraveyardpaingravelegendscreamingperson on firefirst of seriespassionevil manscreamskeletonsensualitycrosshorse ridingfirst partsacrificekillingundeadoccultdesireroyaltymutilationcrucifixmorguebisexual girlknightdead womansexual desirerampagemercilessnessmedieval timesfrustrationautopsyperversiondead maneye gougingarmordisfigurementdark pastroommannequinexhibitionismblindcrowdead girltombbisexualityliving deadhistorical fictionshortsbandageeyehuman sacrificesexual perversionstabbed in the armdegradationblood stainexhibitionistbitten in the necktrain ridewrathsapphismsexual frustrationportugalflamepart of a serieswalking deadmultiple murdercaresszombie violencearm cut offfemale victimsexual obsessionzombie attackburningcutbitinghooded figureset on firemultiple homicidemistreatmenttorture chamberblouseevil powerevil deadhuman fleshmutilated corpsezombificationstab woundfleshfemale corpseforces of evilknights templar13th centurydeserted towntemplar knight1200spart of tetralogyanimate skeletonknight templareye socketkilled by evil deadskeleton warriorsword woundbitten by evil deadbloody scratchesfirst of tetralogy (See All) |
In 1978, in Broadway, the decadent and narcissist actress Madeline Ashton is performing Songbird, based on Tennessee Williams' Sweet Bird of Youth. Then she receives her rival Helen Sharp, who is an aspiring writer, and her fiance Ernest Menville, who is a plastic surgeon, in her dressing-room. Soon … Menville calls off his commitment with Helen and marries Madeline. Seven years later, Helen is obese in a psychiatric hospital and obsessed in seeking revenge on Madeline. In 1992, the marriage of Madeline and Menville is finished and he is no longer a surgeon but an alcoholic caretaker. Out of the blue, they are invited to a party where Helen will release her novel Forever Young and Madeline goes to a beauty shop. The owner gives a business card of the specialist in rejuvenation Lisle Von Rhuman to her. When the envious Madeline sees Helen thin in a perfect shape, she decides to seek out Lisle and buys a potion to become young again. Further, she advises that Madeline must take care of her body. Meanwhile Helen seduces Menville and they plot a scheme to kill Madeline. When Madeline comes home, she has an argument Menville and he pushes her from the staircase. She breaks her neck but becomes a living dead. When Helen arrives at Menville's house expecting that Madeline is dead, she is murdered by Madeline. But she also becomes a living dead and they conclude they need Menville to help them to maintain their bodies. But Menville wants to leave them. (Read More)
Subgenre: | cult filmblack comedydark comedy |
Themes: | funeraldeathmurderfriendshiprevengebetrayaldrinkingdrunkennessseductionextramarital affairsupernatural powerrivalrytheatreabortionvengeance …afterlifebeyond death (See All) |
Mood: | satiremurder plot |
Locations: | swimming poolcemeterytheatre performance |
Characters: | zombiehusband wife relationshipdoctorfemale protagonistlove triangleactressalcoholicmaid |
Period: | 1980s1990s1970s2020s |
Story: | dead bodyleavecarebodydeadfemale nuditynuditypartycorpseshotguncatshootingriflemansionman with glasses …nunflash forwardauthorfantasy sequencemanipulationundeadoccultfalling down stairssurvivorred dresswitchcraftbuttblack humorhypocrisyobesityironydark humorshovelimmortalityrivaldisfigurementplayplastic surgeryclinicnarcissismpotiondisembodied headvanityevil womanmacabremanipulative behaviorbechdel test passedimmortalfemale to male foot in crotchspray paintbroken neckweight lossregenerationfemale antagonistmorticianmusical performancebeverly hills californiaselfish womanbossy womanmanipulative personplastic surgeonmanipulative womanfat suitmagical potionegoismtrailer narrated by percy rodriguezfantasy sceneegocentrismbossy wiferejuvenationfemale chauvinismeternal youthageismfemale chauvinistfriends who hate each otherdeath in titleeternal lifeegocentric womanhead spinabusive womanantagonist as protagonistbreasts growingfalling through a glass roofhole through torsomurder disguised as accidentspraygrande dame guignolmusical scenebroken wristshallownesshypocritical womanabusive wifeage regressionactress as protagonistcynical womannarcissistic womanwashed up (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
Themes: | funeraldeathmurdersurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessinvestigationangercorruptionpsychopath …death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
Mood: | gorenightslasherdarkness |
Locations: | bathtubhospitalbarrestaurantschoolcarcemeterybicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car …cityitalytruck (See All) |
Characters: | homosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlserial killerpolicemanmusicianactress …killervillainpsychiatristmaidprofessorjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All) |
Period: | 1970s |
Story: | body countdead bodydeepdisturbingslashingcamerabloodviolenceflashbacktwo word titlegunkisscigarette smokingphotographsinging …knifechasesurprise endingtelephone callfiresongshootoutbeatingcorpseblood splattermirrorface slapwatching tvdrinksecretshootingpaintingbookvomitingrunningcafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective cameradecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxestabbingimpalementstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
Karen Davis, an American Nurse, moves to Tokyo and encounters a supernatural spirit who is vengeful and often possesses its victims. A series of horrifying and mysterious deaths start to occur, with the spirit passing its curse onto each victim. Karen must now find away to break this spell, before s …he becomes its next victim. (Read More)
Subgenre: | psycho thriller |
Themes: | deathmurdersuicidemarriageghostjealousyadulteryfearsupernatural powerdating |
Mood: | goreneo noirhorror movie remakemurder suicide |
Locations: | bathtubhospitalcemeterybuselevatorjapanpolice caroffice |
Characters: | family relationshipshusband wife relationshippolicemother son relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistteacherpolice officernursedetectivelittle boysecurity guardjapanesepolice detective …professorterroramerican (See All) |
Story: | careshockseriesdiaryshowerflashbackmale frontal nuditytwo word titlephotographsurprise endingcell phonecorpsecomputercatfalling from height …stabbingnonlinear timelineritualold womandrowningstalkercursemissing personneck breakingfirst parthaunted housearsonwaitergothicragemorguecrime scenetokyo japanvisionsonhousewifeatticbalconysocial workerbuddhismloss of husbandgothreal estate agentvideo surveillanceclosetelderlymailmurder of wiferealtorpet catsurveillance footagevcrvideo cassettestairwellghost childfilicideinter culturalsinkspider webcatatoniaremake by original directorwraithremake of japanese filmdrowning someonebroken electronic workssevered jaw (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
Themes: | deathmurderprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer |
Mood: | gorecar chaseslasherdarknessbreaking the fourth wall |
Locations: | forestcemeterysmall townboatwoodslakeamerica |
Characters: | zombiepoliceteenagerserial killerkillervillainsheriffterrorslasher killerserial murderer |
Period: | 1980s |
Story: | body countslashingdeadsexcharacter name in titlenumber in titleviolencesequelflashbacksurprise endingblood splattermasknumbered sequeldemondecapitation …flashlightmassacreambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughtersevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
Subgenre: | independent filmcult filmslasher flickteen movieteen horroramerican horrorindependent horror |
Themes: | funeralmurderrevengesurrealismpsychopathsupernatural powerevil |
Mood: | gorehigh schoolnightmareavant gardeslasher |
Locations: | bathtubcemeterypolice station |
Characters: | husband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain …serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | body countdisturbingseriesdreambloodviolencebare chested malecigarette smokingsurprise endingcorpseblood splattermirrorface slapslow motion scenearrest …falling from heightbeddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementcharacters killed one by onecellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerhanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
Young Canadian nurse Betsy comes to the West Indies to care for Jessica, the wife of a plantation manager Paul Holland. Jessica seems to be suffering from a kind of mental paralysis as a result of fever. When she falls in love with Paul, Betsy determines to cure Jessica even if she needs to use a vo …odoo ceremony, to give Paul what she thinks he wants. (Read More)
Subgenre: | cult filmb moviesupernatural horror |
Themes: | lovedeathsuicideinfidelityreligiondrunkennessdeceptionillnessalcoholism |
Locations: | boatseacaribbean |
Characters: | zombiehusband wife relationshipmother son relationshipdoctorsingerbrother brother relationshipnursedancercanadian |
Story: | dead bodycarebased on novelbare chested maledancingtitle spoken by charactersingingvoice over narrationsongswordislandcursedollstatuecult director …claim in titletold in flashbackpatientloss of wifetorchslavewhiskeyloss of sonpsychotronicsuperstitionblack and whitevoodooblack magicloss of brotherliving deadeuthanasiadrummercy killingromantic rivalrywalking deadfirst person titledeath of title characterpsychotronic filmhalf brotherghoulplantationtropical islandwater fountaintitle spoken by narratoropening narrationmodern day adaptationremaderumhorror movie remadeoneiriccanadian womanwest indiesdream logicshock treatmentsomnambulismspear fishingsobbing femalecalypsofever dreamsugarcane plantationvoodoo priestvoodoo ritualcaribbean seamental manipulationplantation ownervoodoo cursedream like experiencefigureheadvoodoo ceremonycaribbean islandman carrying woman in arms (See All) |