Please wait - finding best movies...
A pagan village, founded on the bones of both innocent and foul, is deeply rooted within the heart of an ancient Eden. When a balance of flesh and soil decays, the last surviving village elder battles madness and the macabre to save her people from not only themselves, but the monstrous judgement th …at burrows up from below. (Read More)
Subgenre: | folk horror |
Themes: | monster |
Mood: | nightmare |
Locations: | woodsvillageforest |
Story: | village elderthree peoplepagan cultday offfilm debutexplanationsettlementfeature filmvowvancouver british columbia canadahuman sacrificebodyfolklorefilm set |
In 1965, after provoking a fire in a forest, the rebel teenager Heather Fasulo is sent to the boarding school Falburn Academy in the middle of the woods by her estranged mother Alice Fasulo and her neglected father Joe Fasulo. The dean Ms. Traverse accepts Heather in spite of the bad financial condi …tion of her father. The displaced Heather becomes close friend of he weird Marcy Turner, while they are maltreated by the abusive mate Samantha Wise. During the nights, Heather has nightmares and listens to voices from the woods, and along the days she believes that the school is a coven of witches. When some students, including Marcy, simply vanish, Heather believes she will be the next one. (Read More)
Subgenre: | independent filmcult film |
Themes: | fearsupernatural powerdeath of motherbullying |
Mood: | nightmaregore |
Locations: | woodsforesthospitalwheelchairpolice carschool nurse |
Characters: | policefather daughter relationshipmother daughter relationshipdoctorsingerteenage girlteachernursestudentpolicemansister sister relationshipbest friendbullyteacher student relationshipwitch …self mutilationgirl fightgirl bully (See All) |
Period: | 1960syear 1965 |
Story: | human sacrificebloodviolenceflashbackfightsingingknifechasetelephone callfiredreamfoodcar accidentblonde …face slapslow motion scenesecretvomitingrunninghallucinationclassroomdecapitationorphanflashlightaxeambulanceeatingimpalementradioritualsearchtreepossessionstorytellingkicked in the facescreamhangingdisappearanceinjectionloss of motherclassobscene finger gestureredheadarsonspiritsyringewitchcraftloss of wifecaucasiannosebleedmilkbreakfastheadphonesprophecylostschool uniformboarding schoolschoolgirl uniformclassmatetelekinesiscontractdormitorylevitationfemale bondingfemale teachercrutchesname callingwellnurse uniformhearing voicesgreenhousevolleyballdisciplinebreaking a windowhearsescholarshipnurse outfittrunkbreaking a mirrormissing girlnightgowngirls' schoolnurse hatconcussionmistset on firerestraintwheelbarrowdorm roomvinefemale nurserebellious daughterdining hallarsonistinfirmaryheadmistressbroken windshieldfinger cutmusic conductorcovenhanged girlrootsfalling treeoverturned carpyromaniacreference to pubic hairbalanceleavestwisted anklepipe organanimate treespilled milktwitchunwanted childlighting a matchcutting one's handpaper cutschool choirfirestarter (See All) |
HOLIDAYS is an anthology feature film that puts a uniquely dark and original spin on some of the most iconic and beloved holidays of all time. The film challenges our folklore, traditions and assumptions, making HOLIDAYS a celebration of the horror on those same special days' year after year. A coll …aboration of some of Hollywood's most distinct voices, the directors include Kevin Smith (Tusk), Gary Shore (Dracula Untold), Scott Stewart (Dark Skies), Kevin Kolsch and Dennis Widmyer (Starry Eyes), Sarah Adina Smith (The Midnight Swim), Nicholas McCarthy (The Pact), Adam Egypt Mortimer (Some Kind of Hate), and Anthony Scott Burns (Darknet). (Read More)
Subgenre: | holiday horrorchristmas horror |
Themes: | monstermurderchristmaspregnancytorture |
Mood: | vignettenightdarkness |
Locations: |
Characters: | witchfatherpregnantwriter directorlove letter |
Story: | pagan cultfeature filmfolklorebloodviolenceone word titleorgyrevolverstripperhalloweensnakenunanthologyscreamdark …holidaycoachnew year's evepillsheadphonestied feetmasked killerlaptop computerbody in a trunkeasterhandvalentine's daymurderesstied up while barefootheart ripped outpsychotronic filmsevered footholiday seasongrindhouse filmnew wavemidnighttalevisual effectsmidnight movieheadsetdiving boardeaster bunnyvalentinewoman directorbox cuttermother's daycassetteeaster eggmedicine cabinetfather's dayst. patrick's dayhorror anthologycar batterydating siteideabullying victimcrown of thornsmysterious packageblood on armvibrator in anus (See All) |
Subgenre: | independent filmcult filmcoming of agedark comedyfairy taledark fantasygothic horroradult fantasy |
Themes: | monsterdeathsurrealismmarriagefuneralseductionnaturesupernatural powersexualitycrueltydevilmythology |
Mood: | nightmaregore |
Locations: | woodsforestrural setting |
Characters: | mother daughter relationshipchildrenteenage girlfemale protagonistgirlcrying baby |
Period: | 1700s |
Story: | folklorebloodbare chested malekisstitle spoken by characterfiredreammirrorface slaprifleanimal in titlebeddemondecapitationsnake …severed headanimaltongueold womantransformationscreamingstorytellingdollpigratcabinchickengrandmotherwerewolfwolffireplacekilling an animalgothichidingspidersevered handfrogteddy beartorchmilkapplewoman in jeopardyfirst kissdeath of sisterlipstickalternate realityduckwedding receptionsexual awakeninggerman shepherdmetaphorpubertybeastacceptancemetamorphosiscrashing through a windowdripping bloodclimbing a treebattle of the sexesfatal attractionshape shifterbritish renaissanceclose up of eyebreaking a mirrordovetoadhuman becoming an animalrolls roycehedgehogskinstorytellergrave side ceremonyred roseambiguityrite of passagebaitpeacockpsycho sexualbadgerlittle red riding hoodlycanthropyanvilsympathyhorseshoedead sisterpigletmagical creaturetelling a storysplashed with waterwalking in the woodscrane the birdhogwoman holding a babyanimal carcasskissing a dead bodycostume horrorbarn owleyebrowunibrowbird nestegg hatchinghand mirrorblind man's bluff gamedoll housebassinettegiant mushroom (See All) |
When their car breaks down at a small Texan town, two sisters must do everything in their power to survive a sadistic pagan cult.
Subgenre: | cult film |
Themes: | evilwilderness |
Mood: | night |
Locations: | woodscarsmall townroad tripgas stationtexastownbackwoods |
Characters: | fatherwriter director |
Story: | pagan culthuman sacrificebodyfolklorecultdarksacrificelostbody countvoodootripabandoned housecoloradogaspoor …bickeringcountsatanic ritualtwo sistersarguingout of gaswidowed fatherideayear 2020wake upemotional detachmentwind uptoo late (See All) |
Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn …that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)
Subgenre: | folk horrorcult filmcoming of agesuspensetragedyfairy talecreature featurebased on fairy talegothic horror |
Themes: | murderdeathlovefriendshiprevengekidnappingbetrayalfeartortureescapedeceptionseductionangerdeath of fathersupernatural power …death of motherparanoiahumiliationunrequited loveexecutionpaniccouragedeath of daughterautism (See All) |
Mood: | nightmaredarkness |
Locations: | woodsvillageforestchurchsnowboatlakecavelog cabin |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistsoldierpriesthostagesister sister relationshiplove trianglegrandmother granddaughter relationshiphunting party …woodcutter (See All) |
Period: | winter |
Story: | f ratedcharacter name in titlebloodviolenceflashbackdancingpartyknifechasethree word titlesurprise endingfirevoice over narrationtitle directed by femaledream …corpseblood splatterhorseshot in the chestrescueslow motion sceneswordarrestmaskinterrogationcolor in titlesubjective cameragood versus evilsurvivalfoot chaseorphanambushaxemassacremountainarmyimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossritualflash forwardtreecursedangerstabbed in the backcharacter's point of view camera shotrace against timetragic eventpigloss of fatherwaterfallloss of motherwerewolfcaptainsabotagewolfrevelationgothichelmetjail cellhuntersevered handtorchanimal attackpreacherfull moonrampageshieldvisionbraveryarranged marriagecrossbowhatredrowboatmedieval timesdeath of sisteraerial shotcapturesnowingdark pastfemale directorkilling spreemoral dilemmatelepathyclose up of eyesnarrated by characterface maskhistorical fictionabuse of powerloss of daughtermental retardationshot with an arrowyoung version of characterwhodunithunttaverncabin in the woodsmercy killingpatricidereverendaltered version of studio logoloss of sisterchapeldeath of grandmothertragic pastmatricidemiddle agesblacksmithmind readinganimal killingwrongful arrestglowing eyeshatchetcard trickhorse drawn carriagestagecoachmistsuit of armorcaged humanbasketsilverwood choppingwhite rabbitloss of grandmotherred riding hoodwomen dancing togetherred capebrothers grimmtorture devicetunicthrown from a boatwitch hunterdaughter murders fatherplanetary alignmentwerewolf bitewoodsmanbitten in the handwalking over hot coalsbitten in the armred hoodblood moonbitten in the legmurder of grandmotherrabbit trapwater bucketmonster hunterred moon (See All) |
After a young American backpacker goes missing in Europe, a group of journalists link his disappearance to a remote village in Poland. They travel there hoping to get the story, but as they unravel the secrets behind this mysterious village, they are suddenly pursued by hostile locals. Unable to esc …ape, they soon become the next victims of ritualistic human sacrifice. Forced into the gruesome reality of true survival horror, the journalists soon discover that this village hides a much darker secret than they could ever imagine. (Read More)
Subgenre: | supernatural |
Themes: | murderescapereligious cult |
Mood: | nightmaregore |
Locations: | village |
Characters: | boyfriend girlfriend relationshipphotographerlittle girl |
Story: | human sacrificebloodbare chested maleheld at gunpointdead bodydemonhallucinationfoot chasejournalistcoffinargumentstatuemissing personskeletondiary …heavy raintrappedcrossbowblood on faceknife fightfogpolandlooking at self in mirrordead boydemonic possessionsmokejournalhearing voicesbloodshedinternblond manman hits womaninvestigative journalismmusculardemonicmissing sonmirror does not reflect realityliving statuepig slaughtermagazine reporterlost in fog (See All) |
A faithful rendition of H.P. Lovecraft's short story, presented in the style of a silent film from the 1920s. While organizing the affairs of his late Uncle, a man accidentally stumbles across a series of clues toward an ancient horror lurking beneath the sea, waiting for the time when the "Stars ar …e Right" and it shall be free to wreck havoc upon mankind. In his investigation he learns of an artist influenced by strange dreams, a police officer discovering an ancient cult worshiping "Great Cthulhu" and ultimately a tale of sailors encountering sanity-shattering horror as they discover Cthulhu himself. (Read More)
Subgenre: | independent filmsuspensesilent filmcreature feature |
Themes: | monstermurderinsanity |
Mood: | nightmareneo noir |
Locations: | woodsboatwheelchairship |
Characters: | doctornative americanprofessor |
Period: | 1920s |
Story: | human sacrificecharacter name in titleflashbackdreamislandaxemapdiarycaptainsergeantpuzzlesevered fingerswamph.p. lovecraftsailor …eye patchboxrunning awaygiant monstershipwrecksilentnewspaper articlelandladyidolnephewcthulhuabandoned shipdeath of uncleeskimo indiansecret cultgreat uncle (See All) |
Based on a short story by H.P. Lovecraft, the undisputed master of the macabre, Dagon tells the story of Paul Marsh, a young man who discovers that the truth will not set him free instead it condemns him to a waking nightmare of unrelenting horror. A boating accident off the coast of Spain sends Pau …l and his girlfriend Barbara to the decrepit fishing village of Imboca looking for help. As night falls, people start to disappear and things not quite human start to appear. Paul finds himself pursued by the entire town. Running for his life, he uncovers Imboca's dark secret: that they pray to Dagon, a monstrous god of the sea. And Dagon's unholy offspring are freakish half-human creatures on the loose in Imboca... (Read More)
Themes: | monstermurderdeathsuicidereligiondrunkennessincest |
Mood: | nightmarerainone night |
Locations: | villagechurchhotelcarboatwaterseaspainyachtsea monsterboat accidentblood in water |
Characters: | boyfriend girlfriend relationshipbrother sister relationshippriestfiance fiancee relationshipmermaiddeath of girlfrienddream girlself immolationevil priestsuicide by stabbing |
Story: | human sacrificefemale nuditycharacter name in titlebased on novelbloodmale nudityfemale frontal nudityflashbackkissfemale rear nudityknifechasesurprise endingpistolundressing …bare buttprayerswimmingold manthroat slittingtoiletman with glassescultdream sequenceritualunderwater scenetransformationhotel roomperson on firebased on short storycrosssevered armsacrificehugginggolddestinyfalling down stairsbreaking and enteringmutantstabbed in the stomachcrucifixloss of loved onevillainessbrother sister incestfrogfloodattempted suicidekickingkicked in the crotchstairsrainstormh.p. lovecraftmutationdeath of loved onelighterhugburnt facemetamorphosistentacleamputationdripping bloodshockchainedextreme violenceriteman on firesledgehammerpitscreaming womantoadpagancomic heroskinship wreckfollowingcaught in a netcthulhustabbed in the bellyskinned alivechantsinkbiblical quotegaliciadisciplecoastal townbreedinghalf brother half sister relationshipkidnapped womanskin rippingdrunk manhalf humansinking boatkeroseneleather maskfollowerisolated communitybed sheetmiscegenationthrowing a bottleholding one's hand over someone's mouthiconoclastpeeling skinwearing human skinbreaking a bottlecoastal villageface peeled offhalf brother half sister incestkilled by monsterexposed intestinesdestroying a computersetting someone on firesharp teethwoman held captiveloose adaptationmurdered with a hammerfish monsterdeadboltdilapidated buildinghead dunked in a toilet bowlthroat slashingtongue kissingwebbed fingershuman turns into monsterdesecrating a churchdestroying a statuefish peoplehand over one's mouth (See All) |
Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and … made into a movie. The Blair Witch Project. (Read More)
Subgenre: | folk horrorindependent filmcult filmblack comedysuspensemockumentarytragedyfound footagefake documentaryghost storysupernatural horrorfamily tragedy |
Themes: | fearsupernatural powerpanicwildernessstarvationcamping in the wilderness |
Mood: | student filmdarknessmyth |
Locations: | woodsforest |
Characters: | boyfriend girlfriend relationshipfilmmakercrying babyevil witch |
Period: | 1990syear 1994 |
Story: | folklorecigarette smokingchasesurprise endingcryingcorpsebookrunninglow budget filmriveralcoholsubjective camerahalloweenflashlightvideo camera …four word titlemaplooking at the cameratalking to the cameralatex glovespainlegendscreamingmissing personscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationhandheld cameravoodoohysteriahikingabandoned housemessageautumnfrightgrassscareno endingno survivorsscreaming in fearmarylandpaganviral videobased on supposedly true storylost in the woodssevered tongueloss of boyfriendthree friendsdocumentarianobscurityscreaming in horrorchild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All) |
Subgenre: | independent filmexperimental filmmockumentaryb moviefound footage |
Themes: | monsterexperimental |
Mood: | avant garde |
Locations: | woodsforestcitylakerussia |
Characters: | alcoholicrussian |
Period: | summer21st century |
Story: | written by directorlow budget filmambulancecreatureunderground filmwritten and directed by cast memberhome movielow budgetsunamateurwritten by cast memberdirected by cast memberurban legendtrashrailway …railroadcrazyroaddiysearchingamateur filmtwo directorsreportdirected by an actoramateur filmmakerabandoned placeamateur filmmakingindependent directoramateur cinemaexperimental movie (See All) |
Loosely based on H.P. Lovecraft's novel THE CASE OF CHARLES DEXTER WARD, this fright flick opens with a warlock placing a curse on a group of villagers about to burn him at the stake. Generations later, the warlock's descendant returns to the village to pick up where his ancestor left off.
Subgenre: | independent filmgothic horror |
Themes: | monstermurderrevengeghostmythology |
Mood: | darkness |
Locations: | villagerural settingcastlenew england |
Story: | human sacrificepistolfirewinecandlemansioncursepossessionlightningattempted rapehauntingexperimentoccultfireplaceburned alive …gothicmutantmad scientistmobresurrectionsuperstitiondungeonh.p. lovecraftmutationblack magicpalacegothphysiciansorcerertaverncaretakersecret passageburning buildingangry mobblind girlbased on poemsecret doorliterary adaptationwarlockancestorgrandsonburned at the stakenecronomicongrave robbingpossessed humanspiderwebcobwebgrave robberdescendant (See All) |
The elderly bat researcher, professor Abronsius and his assistant, Alfred, go to a remote Transylvanian village looking for vampires. Alfred falls in love with the inn-keeper's young daughter Sarah. However, she has been spotted by the mysterious count Krolock who lives in a dark and creepy castle o …utside the village... (Read More)
Subgenre: | gay interestcult filmhorror spoofgothic horrorvampire comedy |
Themes: | monsterkidnappingincestabduction |
Mood: | spoofgay vampire |
Locations: | villagesnowbathtubrural settingcastle |
Characters: | husband wife relationshiphomosexualfather daughter relationshipvampireteacher student relationshipmaidprofessorreligious art |
Period: | winter19th century |
Story: | folkloremirrorbedroomanti herocoffinbathspankingwritten and directed by cast membercountrysideundeadgothiccrucifixhammercannonwoman in jeopardy …damsel in distressdark humorimmortalityballfallskiingsnowingaristocratirreverencebathomagefreakfemale vampirecostume partyinnsnowmanvampire hunterfamous linecrypthunchbackvampire slayertransylvaniastaketalismaninnkeepergarlicsleighlooking through a keyholebreakfast in bedkicked in the buttbloodsuckerbumblersexy female vampirenoblefrozen corpsecostume horrorlecherysauerkrautassistance (See All) |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her … end up having to survive this swarm of evil until morning comes. (Read More)
Subgenre: | independent filmcult filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror |
Themes: | monstermurdersurrealismghostdancememorytime travelsadismbook of evil |
Mood: | nightmaregoreavant garde |
Locations: | woodsforestairplanekitchencastlestormbackwoods |
Characters: | husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation |
Period: | 1980s1990s20th centuryyear 1987 |
Story: | sexnumber in titlebloodviolencesequelkisschasethree word titlesurprise endingpantiesvoice over narrationsongunderwearblood splattermirror …shotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianodemonhallucinationdecapitationgood versus evilaxestabbingstabbed in the chestsevered headanti herotreecursestabbed in the backpossessionskeletonbasementhauntingratcabinsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonshovelpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All) |
Subgenre: | mockumentaryfound footagefake documentaryparanormal phenomenaparanormal investigation |
Themes: | murderdeathsuicideghostdrinkingfearinvestigationevilcrueltypanicabortionmysterious death |
Mood: | nightdarkness |
Locations: | woodsvillageforestcarsmall townboatkitchenapartmentcitytown |
Characters: | husband wife relationshipmother daughter relationshipboygirlpriestout of controlself immolation |
Period: | 1970s2000s |
Story: | folklorebloodviolenceinterviewflashbackdogfightphotographtitle spoken by charactertelephone callfirebeatingcorpseblood splatterfood …punched in the facecameradrinksecretmaskbookrunningneighbordemonriverfightingtelephonejournalistvideo camerabridgeeatinghouseman with glasseschilddrawingrituallooking at the cameratalking to the cameracursedangerscreamingperson on firepossessionstorytellingmissing personscreamdisappearancedarksacrificepsychickillingocculttv newsdestructionrevelationtape recorderwoman with glassesvideotapeeccentricdesperationdead womanhomicideapartment buildingmental institutiontokyo japanresearchhousewifehandheld cameradead mancellphonebalconydemonic possessionliving roomphoneneighborhoodpigeontelekinesisdead dogdark secretcar drivingrepeated scenecanoetelevision newsabandoned housecameramanflaskfilm starts with textconversationdamtelevision showmissingmediumpsychoanalysisfrightphone callmultiple murderritedead birdshrinewatching a videoanguishscarewindowhouse on fireanimal killingdoorclairvoyantnews footagephotoloss of controlvoicemultiple homicideextrasensory perceptionhostilitysickletelevision broadcastshaky cambomb shelterevil powerclairvoyanceobscurityanimal deathevil forceeccentricityembryophenomenonforces of evilmysterious noisestrange behaviorkillingsweird behaviorkyoto japanmysterious persontv journalistevil beingmysterious individualstrange noisedark powerraw footagemysterious voicepunch into the cameraevil spellyarnevil entitypsychological testingtelevision programtinfoilmultiple killingplanktonforce of evilectoplasmdiabolical possessionpsychic researchtinfoil hattelevision journalistdemonic entitydemonic force (See All) |
Sam, 12, is in trouble: his entire "Pathfinder" scout troop picks on him - and worse. The leader, Peter, is the worst of all. He seems to find a sadistic pleasure in humiliating Sam. This year's trip is to a woods near the French border where a curious legend named Kai is said, around the campfire, …to make mischief. But when Sam finds that Kai is no legend and that he makes more than mischief, no one believes him. (Read More)
Themes: | monstermurderdeathtorturevoyeurismtrauma |
Mood: | nightmaremythmurder of a boy |
Locations: | woodsforestbicyclefrancetruckcar explosionrunning through the woods |
Characters: | teenagerboyfriend girlfriend relationshipboyteenage boythiefbullyboy in underwearboy singer |
Story: | female nuditybloodviolenceone word titledogbare chested malefemale rear nudityfightexplosionknifechaseshowerbeatingunderwearface slap …catmaskhandcuffsvoyeurriverfoot chaseflashlightstabbingbasketballstabbed to deathmapchild abusechildanti herohit by a carunderwater sceneon the runflash forwardbinocularscostumekeysuburbtenttrapgamecookmagazinecampbarefoot maleladderimaginationplayboy magazineblood on facechild protagonistcellphonearrowbonfirefemale in showermuddead dogserial murdertaking a showerflag12 year oldkilling a dogrepeated scenesummer campmotorbikecamera shot of bare feetdisposing of a dead bodydiggingoutsiderwhistlewellmasturbation referenceburnt facebare chested boyclimbing a treecountdownhiding placelimpdog attackmass murdererpunch in facefinding a dead bodyevil childspoiled bratdiscovering a dead bodybad dreamsing alongcar wreckhand injurynestpocket knifeantiheroabandoned carchild murdererscoutwaspboy scoutflandersbuggyswarmchild as main characterhand bandagemurder by stabbingcarrying a dead bodyboy in perilferal childstingtree houseboy scoutsmass child killingface burnwild childlatrineunpunished antagonistdriving a truckattacked by a dogwrecked carcrying for helptrip to franceanimal torturecub scoutfalling into a wellinsect swarmtinviolent childbeating a childreference to playboy magazinewasp nestdevil maskfemale bondagescout campbull terrierhitting a childcrazy boyhitting a dogtorturing an animalwooden maskbreaking a legpsychotic villainscoutmaster (See All) |
The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum …mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)
Subgenre: | martial artsblack comedysupernaturalfairy talesword and sorcerysteampunkdark fantasy |
Themes: | murderdeathsurrealismkidnappingbetrayalescapemagicdeath of fathersupernatural powerdeath of motherabductionfalling in lovemissing child |
Mood: | gore |
Locations: | woodsvillageforestsmall towndesertcity |
Characters: | policebrother sister relationshiphostagetough guyaction herovillainsniperwitchsheriffmayorsniper rifleself inflicted gunshot woundevil witch |
Story: | human sacrificefemale nuditycharacter name in titlenuditybloodviolenceflashbackbare chested malegunfemale rear nudityfightphotographexplosionknifechase …pistolfirevoice over narrationpunctuation in titlebeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownrifleheld at gunpointhand to hand combatinterrogationcombatshot in the backf worddecapitationgood versus evilcleavageorphanassassinsword fightambushaxemassacrestabbingimpalementstabbed to deathcolon in titlestabbed in the chestsevered headanti herochild in perilritualpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backperson on firemissionrace against timeknocked outtough girlopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachwitchcraftbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballgun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All) |
Following the events of Alien vs. Predator, and the maturation of the chestburster that erupted from the body of Scar (the Predator that defeated the Alien Queen) into an adult Predalien, the Predator scout ship crashes in the woods of Gunnison County. A local, Buddy Benson, and his son, Sam, are hu …nting in the forest and witness the crash, but they are chased and are implanted with alien embryos by facehuggers along with several homeless people living in the sewers. Meanwhile another Predator lands seeking out the Alien and destroying evidence of their presence on Earth. The dwellers of the town find themselves in the middle of a battlefield between the two deadly extraterrestrial creatures, and the small group of survivors splits between the leadership of Sheriff Eddie Morales and the bad-boy Dallas Howard. Both have different opinions about the best means to escape from the beings. (Read More)
Subgenre: | cult film |
Themes: | monstermurderdeathpregnancyescapedeceptiondeath of fatherbrutalitysadismhomelessnesshuntingmurder of a police officer |
Mood: | gore |
Locations: | woodsforesthospitalschoolhelicoptersmall townsewerhumvee |
Characters: | boyfriend girlfriend relationshipbrother brother relationshipalienbullysheriffhomeless mandeath of girlfriend |
Story: | bodybloodviolencesequeldogsurprise endingpistolshot to deathblood splattershot in the chestshot in the headshotgunsecond partshot in the backflashlight …based on comic bookimpalementstabbed to deathdinerstabbed in the chestno opening creditsacronym in titlechild in perilshot in the foreheadstabbed in the backkeymissing personcover updeath of childtankexploding bodyratsemiautomatic pistolex convictsevered armdismembermentchild murderkilling an animalmorguewristwatchcolonelveteranpower outageevacuationm 16stabbed in the headexploding headplaystation 2deermutationlasersightdeath of loved oneprequelgirl in bra and pantieshead blown offacidnight visioncoloradohanging upside downhelicopter crashcrash landingpredatorbased on graphic novelbloody body of childcrushed headstabbed in the shouldercrossovernuclear bombparasitealien planetestrangementcut into piecesnuclear explosionnight vision gogglesversus in titlealien creaturegovernment conspiracyinfanticidepizza delivery boyhuman versus alienchevroletalien technologypregnant woman murderedair strikehomeless womanpepsihybridnational guardskinned alivegun storestabbed in the foreheadgreen bloodmismatched bra and pantieshunting rifleindoor swimming poolmelting facexenomorphalien space craftdark horse comicsinfestationspaceship crashhondanissanstorm drainford motor companyalien hunterinfrared visioninvisibility cloaksporting goods storealien artifactfalling down an elevator shaftford taurushonda civicextraterrestrial alienalien breedingalien versus alienchevrolet capricehonda accordjeep cherokeedodge the carhuman body alien host (See All) |
The ultimate weapon, which was meant to be safe for humankind, produces global side-effects, including time slides and disappearances. The scientist behind the project and his car are transported from the year 2031 to 1817's Switzerland, where he finds Dr. Victor Frankenstein and his contemporaries.
Subgenre: | independent filmcult filmpost apocalypsefish out of water |
Themes: | monstermurderdeathsurrealismtime travelmadnessartificial intelligence |
Mood: | nightmaregoreambiguous endingmurder trial |
Locations: | woodsvillagesnowlos angeles californiabicyclecourtroomlakelaboratory |
Characters: | boyfriend girlfriend relationshipolder man younger woman relationship |
Period: | future1800s1810s2030s |
Story: | sexcharacter name in titlebased on novelbloodgunexplosionsurprise endingdreamcorpseblood splatterhorseshot in the chestletterbookscience …scientistdecapitationaxestabbed in the chestfalse accusationjudgesevered headtrialchild in perilunderwater scenecreaturenews reportone against manybinocularselectrocutionlightningfarmerhangingcourtautomobilesevered armshot in the armgeneralfireworksdismembermentchild murderexperimenteavesdroppingspeartold in flashbackbarnmad scientistwristwatchsheeplasertorchback from the deadrampageresurrectiondeath threatthunderstormdisembowelmentalternate realityswitzerlandburned to deathsuper strengthportalwhistletaverndeath sentenceheart ripped outtrapdoorlocketscience runs amokfrankenstein's monsterangry mobtrail of bloodflintlock pistolhorse drawn carriagelordrescue attemptpolyamorystowawaymanor housecandelabragrave side ceremonygallowshand through chestsuper computergeneva switzerlandempire fashionbroken backhanged by the necklynch mobbell towerfootbridgetalking computertime paradoxreference to benjamin franklinplaying godpublic hangingtalking carcossackimplosionrowing a boatbeating heartdoctor frankensteindevastated landscapemary shelleyweapons researchaccused of witchcraftbyronpercy shelleythrown into a lakefuture cityscapeinnocent woman executed (See All) |
Greta is a young American woman who takes a job as a nanny in a remote English village, only to discover that the family's 8-year-old is a life-sized doll that the parents care for just like a real boy, as a way to cope with the death of their actual son 20 years prior. After violating a list of str …ict rules, a series of disturbing and inexplicable events bring Greta's worst nightmare to life, leading her to believe that the doll is actually alive. (Read More)
Subgenre: | family tragedy |
Themes: | murderescapevoyeurismmysterious death |
Mood: | nightmare |
Locations: | woodsvillageforestcemetery |
Characters: | family relationshipshusband wife relationshipfemale protagonistamerican abroadex boyfriend ex girlfriend relationshipsuicide by drowningamerican in europe |
Story: | photographsurprise endingshowermaskpaintingstabbingon the rungraveportraitdollhaunted housekilling an animalloss of sonplot twistattic …family secretnannyface maskstuffed animalold dark housebroken mirrormaking outknocked unconsciousgramophonedeath by drowningsecret roomsex dollabusive relationshiphidden roomlearning the truthgovernessscrewdriverelderly couplereference to johannes brahmsanimate dollgoodbye letterbelief in ghostsrat trapmouse trapcreepy child (See All) |
Subgenre: | martial arts |
Themes: | monsterdeathfearangerdeath of fathersupernatural powerpanicdeath of baby |
Mood: | gorerainmyth |
Locations: | woodsvillageforestwaterrural settingcavechinacampfire |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipsingerdancermusicianbabypriestlittle girlchinese |
Story: | bloodmale nuditybare chested malefightdancingsingingknifefirecryingsongbeatingcorpseface slaprescuepunched in the face …swordpaintingtearsrunningdemonriverswimmingfoot chasecandlemountainbridgeprisonermapsnakeanimalritualcreaturejourneytransformationlegendcostumestatuelightningscreambraceletringwigpigtraptied upwaterfalldismembermentmonkeysistertraditionhuggingdestructionarchitecturecaptivehuntertemplenosebleedgiantmobfaked deathtorchanimal attackcelebrationfull moonthunderguestobesitythunderstormlaughterbananatigerbuddhismlanternengagement ringmagic trickcanoesubtitlescorporal punishmentgorillaraftcoughingtentacleapemartial artinnritemonumenticonvillagergoggleshookbuddhacustomboarmantissong and dancesealcartrock paper scissorsbamboofake bloodstrong womanwalking in the raincalligraphyunderwater photographymandarinencampmenterotic dancingvegetationbuddha statuepigletdemon hunterwhirlpoolwooden swordpamphletwarthognative dressgiant fishmonkey kingflower petaljubilationstingraysuspended by armsape manlotuslureman eaten by monsterroasted pigswimming in a riverjourney shown on a mapfacial scratchgold ringjourney to the westpulling hair outbengal tigersutrasimiangear worksgushing bloodroast pigtaoist (See All) |
After a stint in a psychiatric facility Jessica, her husband and a friend move to remote farm they have recently purchased. There they find a young woman by the name of Emily living in the house and they invite her to stay. When Jessica goes for a swim in the lake, she sees a body just below the wat …er's surface. When they go into the village to sell some old furniture, they learn that a woman by the name of Abigail Bishop drowned in the lake and her body was never found. Local folklore has that Abigail is now a vampire roaming the countryside. A mute blond girl leads her to the body of a dead man but the body is not there when Jessica goes for help. Jessica and those around begin to wonder if she is losing her mind. (Read More)
Subgenre: | cult film |
Themes: | murderdeathsurrealisminfidelityghostfearescapeweddinginvestigationdeceptionseductionsupernatural powerparanoiainsanitymental illness …panic (See All) |
Mood: | nightmareambiguous ending |
Locations: | villagecemeterysmall townboatrural settingfarmlakekitchen knife |
Characters: | husband wife relationshipzombiemusicianvampire |
Story: | bodyfolklorecharacter name in titlebased on novelbloodphotographknifechasepunctuation in titlecorpsedead bodyhallucinationislandguitarswimming …old manstabbingstabbed to deathdinnerfishinggraveyarddrowningscarisolationwaterfallhaunted houseredheadundeadwoundbarnmouseswimsuitstrangerbridemental institutionhaunted by the pastblood on facehippiemutemental hospitalrowboatatticasylumferryapparitiondrifterbandagedockdead animalold dark houseseancepicturestaircasefarmhousehearing voicesbitten in the neckhearseseductresscrazinessgravestoneantiquewhite dressold househookframed photographrocking chairmistconnecticutferry boatbohemianoil lampambiguitysynthesizerorchardpesticidecheating on wifeantique dealerblue eyesinternal monologueseclusioncountry homeparanoid schizophreniacoveharpyepitaphdriven madmute persontownspeople (See All) |
Egyptian caterer busies himself collecting body parts from young maidens in order to bring Ishtar, an ancient goddess of good and evil back to life. When he has prepared enough parts for the ceremony, he hypnotizes a woman giving an engagement party for her daughter, at which he plans to perform the … ancient rites of summons, using the daughter as his final sacrifice. (Read More)
Subgenre: | independent filmcult filmdark comedyslasher flick |
Themes: | murderdeathtortureangerpsychopathbrutalityhumiliationsadismevilexploitationcrueltycannibalism |
Mood: | gore |
Locations: | hospitalswimming poolbathtub |
Characters: | policeserial killerself mutilation |
Story: | pagan culthuman sacrificebodyfemale nuditynuditybloodviolencecigarette smokingknifeblood splatterfoodbikinibathroomold manstabbing …stabbed to deathstabbed in the chestsnaketonguescreamingevil manconvertiblewhippingcult directorsacrificedismembermentmaniacragemutilationfloridadead womanwhipmercilessnessresurrectionhypnosisdisembowelmentheartstabbed in the eyesevered legdead woman with eyes openmisogynybloodbathbrainpipe smokingpsycho killerdead girlceremonyintestinesmisogynisthomicidal maniaclegswrathgoddessnaked dead womanstabbed in the facegarbage truckriteknife murderbutcher knifeheart ripped outfemale victimfloggingmurder of a nude womanchainsheart in handsinistertortured to deathdead woman on bedsevered tongueremadeinfamyblonde stereotypehorror movie remadevideo nastycatereregyptologynotorietydead woman in bath tubtongue rippinghuman heartegyptologistritual killingancient riteancient ritualdead woman on a beach (See All) |
A man from London comes to a small remote village in Serbia to look after the cemetery. He starts to have nightmarish visions and suspects the friendly villagers have a more sinister intention with him.
Subgenre: | folk horrorindependent filmsuspenseconspiracyarthousebritish horror |
Themes: | dyingmythology |
Locations: | woodsvillagecemeteryrural setting |
Characters: | priestvampire |
Story: | folklorebloodgraveyardredvampirismpsychotronic filmserbiavillagersinisterremotevisionsvampire biteserbianremote villageauteur …folktalevampire cultvampire attack (See All) |
In the heat of the summer, a lonesome house in the countryside between woods and corn fields, lives nine-year-old twin brothers who are waiting for their mother. When she comes home, bandaged after cosmetic surgery, nothing is like before. The children start to doubt that this woman is actually thei …r mother. It emerges an existential struggle for identity and fundamental trust. (Read More)
Subgenre: | cult filmsuspense |
Themes: | murderdeathmoneytorturedivorcedysfunctional familymental illnesssadismtrauma |
Mood: | nightmaregore |
Locations: | woodsvillageforestchurchcemeterybathtublakestormtwo in a bathtubrunning through the woodsboy in a bathtub |
Characters: | family relationshipsmother son relationshipchildrenbrother brother relationshipboypriestchristiancrying boyevil mother |
Period: | summer |
Story: | female nudityf ratedviolencebare breastsbondagefemale rear nudityphotographsingingknifetelephone callfiretopless female nudityurinationface slapcat …undressingbare buttmasklieprayerflashlightbound and gaggedhouseaccidentapologychilddream sequencegraveyardstrippingactor shares first name with characterdomestic violencecountrysidegifttrapreunionsuspiciontwinarsonstrong female characterpizzasurgeryeavesdroppingidentitygamekilling an animalnipples visible through clothingwoundlooking at oneself in a mirrorrepetition in titletied to a bedcaptivetwinscrying womanaccidental deathvisithomefull moontrappedcrossbowimpostorchild protagonistcharityplot twistdelusiondead childbathingbarefoot femaleduct tapefieldcellarburned to deathphoto albumfirefighterplastic surgerycockroachdoubtbugfish tankdomineering motherimaginary friendaustriacornfieldtaking a bathbare chested boyhead injurytaking off shirtlocked dooridentical twinskiller childcrying femaletrampolinehiding under a bedfirst person titlematricide11 year olddead catdistrustwatching a videomagnifying glasspsychotronic filmwet clothesaltardelivery manhouse on fireimmolationframed photographabusive motherburningcentral europelong haired malebirthmarkhysterical womanred crossbloody facebad dreamaustriansecretly observingbossy womancharacter says i'm sorrydead brotherlocked inhysterical outburstmother son reunionhead bandageaudio tapeemotional abusebad motheraudio recordinghouse arrestwalking in the raincounting moneybaby monitorestranged sonwatching someone sleepwetting oneselfchild as main characterlistening devicecosmetic surgerymoney countingseeing dead peopleson murders motherfeeding someonemysterious eventwoman directorimaginary personhailstormlooking glassnaked outdoorsestranged mothermother son conflictplaying accordiondisbelieving adultsetting a firetwin brothersnine year oldcult favoriteguessing gameemotionally unstablebandaged facepretending to sleepanimal masksinging alongaccordion playermajor child rolebrushing one's teethbossy mothergoogling for informationmother slaps sontv personalityabusive womanantagonist as protagonisthouse for saleviolent womanfood deliveryvacuum cleaningwet pantscrying for helpkilling a petthrowing water on someonewoman on firetagabused boyface injurytelevision presenteremotionally unstable womantied handscapgras delusionhair cuttingwoman bound and gaggedcutting one's haireating a bugfemale bondagehysterical motheridentical twinlying on the floorson killedwetting one's pantsfrozen foodlocked in a carsextonsinging a lullabytalking to a photographurinating into a bottlewoman tied to a bedcrazy boycutting someonemother hits sonpouring raincovering someone's mouthson hits mother (See All) |
Is becoming a woman analogous, in some deep psychological way, to becoming a werewolf? Ginger is 16, edgy, tough, and, with her younger sister, into staging and photographing scenes of death. They've made a pact about dying together. In early October, on the night she has her first period, which is …also the night of a full moon, a werewolf bites Ginger. Within a few days, some serious changes happen to her body and her temperament. Her sister Brigitte, 15, tries to find a cure with the help of Sam, a local doper. As Brigitte races against the clock, Halloween and another full moon approach, Ginger gets scarier, and it isn't just local dogs that begin to die. (Read More)
Subgenre: | independent filmcult filmcoming of ageblack comedydark comedycreature feature |
Themes: | murderdeathsuiciderapepregnancydrinkingtorturedrunkennessobsessionsupernatural powerdrug usecancerphotography |
Mood: | nightmaregoresatirehigh schoolsocial satire |
Locations: | woodsforestschoolbathtubschool nurse |
Characters: | policefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipboyteenage girlteenage boyfemale protagonistteachernursestudentdancerphotographersister sister relationship …witchgirl fightself cutting (See All) |
Story: | vowbodysexf ratedcharacter name in titlebloodviolencemasturbationdoggunkissfightcigarette smokingdancing …photographpartyknifepantiesbeatingcorpseblood splatterurinationwatching tvcameradrinkcondomvomitingshowdownrunningdead bodymarijuanaclassroomhalloweenflashlightcandlestabbingdrug dealerthroat slittingimpalementtoilethit by a carvanlatex glovespaincursevirginsuburblocker roomfirst of seriespoisonmissing personbaseball batflowershanginginjectionexploding bodybasementfirst partclassobscene finger gesturefireworksredheadgaragechainsawwerewolffalling down stairspot smokingwolfloyaltywoundhypodermic needlegothicinjuryvirusstabbed in the stomachwatching a moviecovered in bloodburialanimal attackmilkdrug dealingfull moonpromisejanitorsevered fingerplaygroundstabbed in the throatkickingshovelinfectionswingfamily dinnerbroken armdead boymutationhalloween partydead dogdead girlgothporn magazinemenstruationhairkilling a dogpubertypolaroidbeast16 year oldurinepiercinggreenhousewormsense of smellbleedingbiologyteethloss of sistermicroscopecureclawbechdel test passedpitchforkshapeshiftingcoughing bloodgoth girlbludgeoningx rayed skeletonbitten in the throatslide showfurdrugstoretamponflickering lighthuman becoming an animallawn moweroathdrinking bloodface ripped offdark heroineslide projectorhowlingroadkillsuicide pacttea partysilverfake bloodfake suicidefield triptailhockey stickschool lockercanuxploitationentrailsguidance counselorlearning to driveneon lightlycanthropywatching a movie on tvmenarchepactlaxativerocking horsesilver bulletboys' bathroomstdfemale werewolfsupernovableachgirls' bathroomdetoxtesticular cancerfingernaillycanthropespilled milkbelly button piercingpmslocked in a bathroomsandboxaccidental stabbinggasoline cannavel piercingcheckout clerkpicket fenceeating a wormraking leavesspinestreet hockeysuspected paedophilecrampteaching someone how to drivecanadian gothicfield hockeyhomeopathykicking a dogovulationathletic fieldmetabolismsanitary napkingrowing marijuanawhite blood cellhair curlerinjection into one's neckpawclaw markdeep freezerobsessed with deathurinating bloodbitten by an animalblood sisterdiet pillshit with a hockey stickscrewdriver the toolwolfsbane (See All) |
Director George Popov explores the dark and disturbing secrets behind three of England's most haunted villages.
Subgenre: | folk horrorsupernaturalparanormal |
Themes: | deathghostmysterious death |
Mood: | mysterious |
Locations: | woodsvillagetown |
Characters: | children |
Story: | runningnewspapernarrationkeyreadingclassnewspaper headlineserieslow budgetdiscussionhistoricalkillinspirationoutbreakhaunted …ghostscreepyspiritstheoryfolksoundtrackplayinghandsheadlinepresentationstorieslocaldiveviolenthighwaymanhistory classdeepbackgroundspectretalkingcriminalsregionalfamiliar2015effect (See All) |
A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.
Subgenre: | cult filmcreature featuresurvival horrorbritish horror |
Themes: | monstermurderdeathfriendshiprevengeinfidelitybetrayalghostdrinkingfearescapebrutalityguiltgriefpanic …cannibalismblindnessmurder of familyclaustrophobia (See All) |
Mood: | nightmaregore |
Locations: | woodsforesthospitalcarcavecave in |
Characters: | husband wife relationshipfriendfemale protagonistbest friendlittle girl |
Story: | f ratedbloodviolencetwo word titlephotographknifesurprise endingcryingbeatingcorpseblood splattercar accidentblondefalling from heightbook …vomitingliehallucinationsurvivalflashlightmountainvideo cameradeath of friendwomanthroat slittingimpalementstabbed in the chestunderwater scenecreaturenecklacesmokingbeaten to deathdolldarkisolationneck breakingfirst partunderwatercabinwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorlifting someone into the airgroup of friendsvictimskullcheating husbanddriving a cartorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandkilling spreeblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All) |
Sacrifice is the story of consultant surgeon, Tora Hamilton, who moves with her husband, Duncan, to the remote Shetland Islands, 100 miles off the north-east coast of Scotland. Deep in the peat soil around her new home, Tora discovers the body of a young woman with rune marks carved into her skin an …d a gaping hole where her heart once beat. Ignoring warnings to leave well alone, Tora uncovers terrifying links to a legend that might never have been confined to the pages of the story-books. (Read More)
Themes: | murderpregnancyinvestigationadoption |
Locations: | hospitalhelicopterboatrural settingpolice stationcar on fire |
Characters: | husband wife relationshipfather son relationshippolicedoctortattoofemale protagonistbabylawyeramerican abroad |
Story: | human sacrificebodyfolklorebased on novelone word titlepartyknifechasepistolcorpsewritten by directorsecretheld at gunpointdead bodybritish …islandstabbingstabbed in the chestcultpolice officer killedlegendringcountrysidepolicewomansemiautomatic pistolsacrificepubhypodermic needlesecurity camerapatientwalkie talkiemorguehomewoman in jeopardyscotlandstabbed in the legheartclifffemale doctorfieldpolice inspectorsurgeonfamily secretdaggermiscarriagelighthousenew jobdark secretsecret societydiggingx raycottagemarried coupleyoung womancoastmotorboathouse partycountry housefemale police officerdiabetessectfather in law daughter in law relationshipscottishpolicewoman killingfather in lawpaganexhumationultrasoundhit with a rockpaganismcancer patientnew homechildless couplecoastal towneast coastwoman in perilwanting to have childrenland roverdead horsechildlessnessfake illnessknife in the headwanting a babyinternet researchdecomposed bodydeath by fallingexcavatorcrooked lawyerruneamateur sleuthvehicular homicidefalling to one's deathsuspicious deathhuman remainsisolated communitywriting on walldetective inspectorsecret cultadoptive parentskey cardramming a carhaggisnorth eastcontraceptiveedge of a cliffcomputer hackingpeat bog (See All) |
While recovering from a tragic accident on the road, the patrolman Edward Malus receives a letter from his former fiancee Willow, who left him years ago without any explanation, telling that her daughter Rowan is missing. Edward travels to the private island of Summerisle, where Willow lives in an o …dd community that plant fruits, and she reveals that Rowan is actually their daughter. Along his investigation with the hostile and unhelpful dwellers, Edward discloses that the locals are pagans, practicing old rituals to improve their harvest, and Rowan is probably alive and being prepared to be sacrificed. When he locates the girl, he finds also the dark truth about the wicker man. (Read More)
Subgenre: | folk horrorparanormal phenomena |
Themes: | murderdeathrevengebetrayalinvestigationdeceptionmissing child |
Mood: | darknesshorror movie remakeritual murder |
Locations: | barschoolsmall townairplaneboatbicyclepolice stationfarm |
Characters: | mother daughter relationshipteachergirlpolice officerpregnant womansexist |
Story: | explanationhuman sacrificebloodflashbackgunphotographtitle spoken by characterchasesurprise endingfirecell phonecorpsecar accidentremakepunched in the face …maskletterheld at gunpointdead bodyhallucinationislandclassroomaxedisguisedinerexploding carcultdream sequenceritualpolice officer killedsearchgraveyardgravepilotdollkicked in the facefeminismunderwatersacrificepoweroccultburned alivekicked in the stomachbroken legtrappedface paintdeath of protagonistferrypigeonhiding in a closetbeesecret societyold flametavernman punching a womanroad accidentbattle of the sexesallergymotorcycle copcommunefetusfalling through the floortied to a treehung upside downseaplaneset on firehoneyrescue attemptsmall communityfatal accidentwood choppinganimal sacrificematriarchymisandrybee stingfemale chauvinismbeekeepingfoetusmouth sewn shutallergic reactionremake of cult favoritedream sequence within a dream sequenceisolated communityunintentional humorcell phone out of rangebased on cult filmfetus in a jarpagan ritualbear suitritual mask (See All) |
For the past 20 years, Frank Harrington has grudgingly driven his family to celebrate Christmas with his mother-in-law. This year, he takes a shortcut. It's the biggest mistake of his life: The nightmare begins. A mysterious woman in white wanders through the forest, leaving death in her wake. A ter …rifying black car - its driver invisible - carries the victims into the heart of the night. Every road sign points to a destination they never reach. The survivors succumb to panic, to madness; deeply buried secrets burst to the surface, and Christmas turns into a living hell. (Read More)
Subgenre: | black comedyghost storysupernatural horrorchristmas horror |
Themes: | marriagechristmaspregnancydysfunctional familybreak updeath of wifemadnessdeath of baby |
Mood: | nightmarenight |
Locations: | woodsforestcarcar driver |
Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbabypregnant womancrying baby |
Story: | female nuditybloodmasturbationfemale rear nuditycigarette smokingsurprise endingcar accidentshotgunsecrethallucinationgay slurdream sequenceshot in the leggunshotdeath of brother …death of soncabinmoonpornographysurvivormutilationloss of wifestrangervictimcelebrationfull moonwhiskeymale masturbationloss of sonunfaithful wifelostchristmas evebody countloss of brothersurprise after end creditsdead girlbarbed wirefencereference to the beatlescabin in the woodsecstasybody bagdeath of boyfriendstation wagonshockin lawsslaptime loopchristmas carolman slaps a womanman slaps womansevered earmarital crisisdead babybaby carriagegay jokegrandparentsno cellphone signalmarital discordblood on mouthdrivemarital argumentmarital strifebarbed wire fencepotato chiproad signmale wearing an earringman in blackasleep at the wheelout of gasunfaithfulgoing in circlesjingle bellsreference to marilyn mansonfractured skulldark roaddestinationchristmas vacationfalse scarepumpkin piefalling asleep at the wheel (See All) |
Five teenagers head off for a weekend at a secluded cabin in the woods. They arrive to find they are quite isolated with no means of communicating with the outside world. When the cellar door flings itself open, they of course go down to investigate. They find an odd assortment of relics and curios, … but when one of the women, Dana, reads from a book, she awakens a family of deadly zombie killers. However, there's far more going on than meets the eye. (Read More)
Subgenre: | black comedysupernaturalslasher flickteen horrorsupernatural horrorreality spoof |
Themes: | monstermurdersurrealismsuicideghostdrunkennessgamblingsurveillanceapocalypse |
Mood: | goresatireslasher |
Locations: | woodslakegas stationtunnelcave in |
Characters: | teenagerboyfriend girlfriend relationshipzombiesecurity guardwitchbabe scientistself referential |
Period: | 2000s20th century1900s21st centuryyear 2009 |
Story: | human sacrificefemale nuditybloodflashbackbare chested malesurprise endingpistoltelephone callshot to deathblood splattermachine gunshot in the chestshot in the headcar crashcollege …robotf worddecapitationmassacreimpalementstabbed to deathstabbed in the chestsevered headman with glassescreaturegravecharacter repeating someone else's dialoguevirginstabbed in the backclownperson on firediarymanipulationexploding bodymercenarydirectorial debutsevered armdismembermentsubtitled scenefreeze frametopless womanwerewolfhand grenadegrenadeathleterevelationgroup of friendsswat teamsevered handcovered in bloodend of the worldeaten alivecelebrationredneckcameostabbed in the throatdark humorfalling to deathstabbed in the headthrown through a windowtitle at the endstabbed in the eyeaxe murdercharacters killed one by oneethnic slurcellarinterrupted sexmarijuana jointvideo surveillancestabbed in the handbongstonerboy with glassesinterracial kissjapanese schoolgirlelectric shockcabin in the woodstentacleoffice workerbitten in the neckcarnagescarecrowjocksawgoblinstabbed in the shoulderfilmed killingtwo way mirrormusic boxwoman in a bikinimasked villainrecreational vehiclepsychological tortureku klux klantrapdoorlocked in a roomforce fieldevil clownhatchetunicorngiant spiderinternno survivorsbear trapgas station attendantdyed hairkiller clowngirl stripped down to pantiescyclopstorture chamberdirt bikezombie childtruth or darebody torn apartdead teenagerfilm reelcocktail partyscholarcubepuppeteerkilled in an elevatorgiant snakehorror icongrappling hookblonde stereotypeno cellphone signalblobevil godcontrol roomunderground bunkerpushed into waterritual sacrificestrange behaviorlovecraftianravinechasmanimate treemermantorture victimbulletproof glassspeaker phonedeconstructionswimming in a lakebloody hand printmountain roadyear 1903alpha maleboat dockpheromonesmounted animal headgroup of fiveconchgiant batharbinger of deathgiant handtrowelfalling into a lakebetting poolcaged monster (See All) |
New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a … family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)
Subgenre: | folk horrorindependent filmsuspenseconspiracyamerican horrorbritish horror |
Themes: | murderdeathkidnappingreligionghostfearmagicdeath of fathersupernatural powerdeath of motherredemptionguiltinsanityillnessevil …dyingdevilmadnesswildernessfather love (See All) |
Mood: | goreraindarkness |
Locations: | woodsvillageforestchurchrural settingfarmenglandcampfirenew englandbackwoods |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrensingerbrother brother relationshipboybrother sister relationshipteenage girlbabysister sister relationshipchristian …reference to godlittle girllittle boyvillainbiblewitchterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All) |
Period: | winter17th century1600s |
Story: | female nuditynuditybloodmale nudityviolencefemale frontal nuditymale rear nuditydogbare chested malekisssingingknifecryingsongblood splatter …foodhorseundressingsecretlierifledemonhallucinationreference to jesus christprayersubjective cameracandlestrangulationaxestabbingwomaneatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessionrabbitdeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickendirectorial debutsleepingtwinwolfmass murdergothiceggwitchcraftcrying womancrying manburialanimal attackgoatapplepromisetensionhypocrisysonhungerbutchershovelpridemurder of a childslaughterlanterndead boydemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismslashingwhisperingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All) |
Something stalks the Pine Barrens of New Jersey. A demon said to inhabit the dark forests of these lands has stalked and terrified the locals for centuries, but what is the story behind its dark origin?
Subgenre: | silent film |
Themes: | monsterpolitics |
Mood: | non fictionreligious |
Locations: | woodsmuseum |
Characters: | mythical creature |
Period: | 1980s80s |
Story: | explanationfolklorefilm setbloodcreatureparklegenddragonbankdarkaddictioncophidingwitchcraftstranger …birthteamdiscussionfeudblack and whitehockeyfilm crewsilentblackkidpopularitymissingcompanyreturnfictiontabloidbluefakepossecreepyculturalpark rangerrangerdisputewhiteurbanmethfleshlegendsfilmmakerstalking headsscareddramatizationcolonialsociologicalperspectivesegmentsoriginsrangetalessepiacaughthockey teamtalkingexcerptsrobbersdebunkingsightingcresturban mythsecret historymeth addictiondark historycolonial erareal storyproduction companythe secret (See All) |
A group of college friends reunite for a trip to the forest, but encounter a menacing presence in the woods that's stalking them.
Subgenre: | folk horrorcreature featuresurvival horror |
Themes: | monstermurderdeathfriendshipfeartortureescaperobberytheftsupernatural powerguiltgrieftraumanorse mythology |
Mood: | nightmare |
Locations: | woodsvillageforestwaterstorm |
Characters: | husband wife relationshipfriendreference to godinterracial relationshipwitch |
Story: | pagan culthuman sacrificenuditybloodmale nudityviolenceflashbackmale rear nuditybondagetwo word titlebare chested malecigarette smokingphotographchasefire …cryingbeatingdreamcorpseshotgunpunched in the facewatching tvrunningdead bodycollegehallucinationreference to jesus christcriminalf wordsurvivalflashlightaxestabbed to deathmapcultritualcreaturevanold womanargumentfantasy sequencemissing persontentkicked in the facescreamringcountrysidestalkingtied upcabinsacrificepubbreaking and enteringwoundfriendship between menlistening to musictouristsurvivorcaptivewitchcraftbarefoot malecommunitycrying mantorchinterracial friendshipfull moonredneckconvenience storehungerdelusionimmortalityhit on the headswedenrainstormwedding ringlanternblack magictripmale objectificationabandoned buildingtaking a photographdead animalrepeated scenesenior citizenhikingmale friendshipabandoned housebroken windowanimal crueltyblood staininterracial marriagelanguage barrierwetting pantscabin in the woodscriminal gangheld captivedripping bloodscandinaviamale protagonistkicked in the headlighting a cigarettetitle same as bookbriton abroadawkward situationshape shiftertied up while barefooteastern europespitting bloodsole survivorpsychotronic filmwet clotheshouse on firemurder spreeman hits a womanfinding a dead bodyleg injuryliquor storelong haired malecrying malediscovering a dead bodybloody facecar wreckbechdel test failedscreaming in fearposing for a photographpaganoverheard conversationman punches a womanbolt action rifleguilty consciencelost in the woodscaught in the rainscreaming in horrorhands tied behind backtaking off shoesfantasy scenescreaming mantaking a selfiedragging a dead bodyshallow gravewetting oneselfevil godsleeping nudeknee injurymysterious eventc wordshape shiftingupside down camera shotsetting a firefriends falling outplush toyviolent mancultural differencessurvivor guiltlimping manembarrassing nudityembarrassing male nuditymissing friendrunning into a treesleeping nakedwaking up nakedmale bondagemale star appears nuderunning barefootface slashedmissing manrunning in the darktraumatic memoryguts ripped outpagan ritualreference to amelia earhartbritish touristconflict between friendseye sockettied handscollege friendshiding behind a treecamp sitefriend murderedinjured womanlying on the floormummified bodyritual killingsmelling clotheswetting one's pantssleeping in a tentabandoned cabinhiking trailhung from treemysterious soundpouring raintied manhiding in the forestreference to odinsetting a house on firetied up man (See All) |
3 couples go to Ireland woods to collect magic mushrooms and trip out. On their way they meet some strange inhabitants of the woods and it doesn't take long until a creepy story is being told at the campfire which might be more than just a story. So strange things happen, people start disappearing, …silhouettes move through the woods and the creepy story starts to melt into reality. The horror kicks in along with the effect of the mushrooms. (Read More)
Subgenre: | martial artsghost story |
Themes: | murderdrugscamping |
Locations: | woodsforesthelicopter |
Characters: | friend |
Story: | one word titleflashbacktitle spoken by characteraxeambulancehangingtalking animalcampbroken legaxe murderself defensemushroomdrug tripsnorricampsychedelia …steroidcautionary taletrippingpoisonous mushroomchild torturetalking cow (See All) |
Ledoyen and Considine play a young married couple at the end of the 1970s, who come to visit a friend (Oldman) who now lives in the Basque region because he has married a woman from there (Sanchez-Gijon). Their tranquil summer turns to horror when they discover a girl with horribly mutilated hands i …n the forest. They try to help her by taking her away from the home in which she is locked, but the local villagers, who have to protect the girl, start a pursuit in the forest they know much better than the visitors. (Read More)
Themes: | murderrevengeexecutionhunting |
Mood: | rain |
Locations: | woodsvillageforestspain |
Characters: | husband wife relationshipgirl |
Period: | 1970s |
Story: | violencefemale frontal nuditydogshot to deathshotgunrescuebritishvacationrabbitcabincoupletouristmanhuntwoodfarmhouse …married coupleknocked unconsciousweekenddeformitythreatened with a gunculture shockrape attempthandsferal childwoodland (See All) |
In the small village Goksung in South Korea, police officer Jong-Goo investigates bizarre murders caused by a mysterious disease. His partner tells a gossip for him that a Japanese stranger that lives in a secluded house in the mountains would be an evil spirit responsible for the illness. Jong-Goo …decides to visit the Japanese with his partner and a young priest that speaks Japanese. They find an altar with a goat head and pictures of the infected people that died on the walls. However they are attacked by the guard dog and they only can leave the place when the stranger arrives. Jong-Goo finds one shoe of his beloved daughter Hyo-jin in the house of the stranger and soon she becomes sick. His mother-in-law summons the shaman Il-gwang to save her granddaughter while a mysterious woman tells Jong-Goo that the stranger is the responsible. Who might be the demon that is bringing sickness to Goksung? (Read More)
Subgenre: | folk horrorsupernatural |
Themes: | murderdeathrapeghostinvestigationsupernatural power |
Mood: | nightmare |
Locations: | villagehospitalrestaurantsmall townrural settingpolice stationpolice cargas stationsex in carsex in a carfire truck |
Characters: | husband wife relationshippolicefather daughter relationshipteenagermother daughter relationshipdoctorteenage girlzombiepolice officerpolicemanpriestlittle girljapanesedaughter |
Story: | male nudityone word titleflashbackdogtwo word titlesex scenecigarette smokingphotographknifewritten by directorvomitingdead bodydemonold manwhite panties …dream sequencedrawinghit by a carritualcursepossessionnosebleedstrangerdead womanfull moonwatching televisionpower outagescissorsthunderstormfat manexorcismlocation in titledead dogserial murderbarking dogdead animalkilling a dogblood stainrumorshoeshamanbaseball capsouth korearainingreading a newspaperdead birddead wifeshrinepsychotronic filmdog attackhouse on firestabbed with scissorswhite coatpolice partnerrearview mirrorrestaurant ownerchild's drawinghaving sex with skirt hiked uppolice protagoniststruck by lightningacupuncturemotorcycle helmethanged womanpolice badgegluttonybiblical quotewashing clothesbloody handjapanese mandriving in the raindead deerscreaming girlwashing a carpower cutfishing rodsleeping on the floorpolice uniformrashwalking in the woodspolice taperolling down a hillphotograph on wallattacked by a dogattacked by dogsleeping on the groundstone throwingthrowing stonesdivinationkorean womanblack dogcross necklacehanging from a treehouse in the woodsbreaking a lockhitting one's head on a rocktest resultthrowing a stonebiblical quotationhearing parents have sexreference to religionsoy sauceburned out housecorner storemysterious figurepouring rainsick girlsouth koreanthrowing rockskorean girlkorean manneck scarremote housescreaming child (See All) |
Trying to escape her broken past, Sarah O’Neill is building a new life on the fringes of a backwood rural town with her young son Chris. A terrifying encounter with a mysterious neighbour shatters her fragile security, throwing Sarah into a spiralling nightmare of paranoia and mistrust, as she tri …es to uncover if the disturbing changes in her little boy are connected to an ominous sinkhole buried deep in the forest that borders their home. (Read More)
Subgenre: | folk horrorfairy talebody horror |
Themes: | monsterescapeparanoia |
Mood: | nightmare |
Locations: | woodsforesttowntrying to escape |
Characters: | boysingle motherlittle boy |
Story: | creatureoverallshomesonbuildingpsychotronic filmruralnew lifeonly childmistrustsinkholeyoung son |
Getting lost, wandering home whilst on leave from his seminary, novice monk Khoma stays in the barn of an old woman. A scuffle breaks out. Later, he is summoned to stand and pray over a young dead woman, in the local church, for three nights. It is here that, while in the long, dark nights of the lo …cked doors, the dead regain life, the souls of Hell taunt the young monk to near terrifying insanity, and the test of Faith will be as powerful as the witches, monsters and the mighty demon Viy who haunt his every step and bay for his very soul. (Read More)
Subgenre: | folk horrordark fantasy |
Themes: | monstersurrealismdrunkennesssupernatural powerdeath of daughter |
Mood: | poetic justice |
Locations: | villagechurchrussia |
Characters: | priestwitchevil witchdeath of student |
Story: | one word titlecorpsedead bodydemonold manbased on short storypigchickenundeadmudukrainepeasanttormentphilosophergargoyle …evil deadfolk taleukrainianhorror movie remadefilm starts with quotecirclekiev ukrainewhite hairbegins with a quotecossackvigilseminarianwicked witchdemonic undeadrooster crowingopening quotedefying gravitytheology studentflying witch (See All) |
In the XVIII Century, in the countryside of England, the landsman Ralph Gower finds a skull with one eye and fur on the field. He summons the local judge to see his finding but it has disappeared. Meanwhile the local Peter Edmonton brings his fiancee Rosalind Barton to his aunt's house to marry her …on the next day. However during the night Rosalind becomes insane and in the morning she is sent to an asylum and Peter sees a claw that has replaced her hand. Then Peter wakes up with a claw attacking him and he cuts it out, but he finds that he has hacked down his own hand. The local children have a strange behavior under the command of Angel Blake and they rape and kill others. In common, they have a strange fur on their skin. The judge returns from London and concludes that evil has possessed the children. What will he and his search party do? (Read More)
Subgenre: | folk horrorindependent filmbritish horror |
Themes: | murderrapefuneralincestdevil |
Mood: | gore |
Locations: | forestcemeteryrural settingenglandshed |
Characters: | doctorself mutilation |
Period: | 17th century1600s |
Story: | human sacrificefemale frontal nudityswordinterrogationstrangulationfalse accusationjudgestabbed in the backfarmersurgeryoccultwitchcraftsevered handministerloss of son …reference to satanatticdemonic possessionloss of brotherauntruinsdead childrenloss of daughtersatanismclawbonefurblond boybody part in titleskinanimal trapboy stranglingplowkilled with a forkdemonic cultcostume horrorparochial schoolpushing someone into waterblind man's bluff game (See All) |
When bears are found dead in Norway, students from Volda University, Thomas, Johanna and cameraman Kalle, decide to investigate. They stalk the trail of the mysterious hunter Hans expecting to find an explanation for the killings. The reluctant Hans tries to flee from the youngsters, but then agrees … to let them film him in action, provided they follow his orders. Soon the trio of students learns that Hans is actually a troll hunter working for a secret government agency. Further, several dangerous trolls have escaped from their territory and Hans is assigned to eliminate them. (Read More)
Subgenre: | mockumentaryfound footagecreature featuredocumentary filmmakingvideo documentary |
Themes: | monsterhunting |
Locations: | woodsfarmcave |
Characters: | christianmuslimhunting party |
Period: | year 2010 |
Story: | explanationbloodone word titleaxedeath of friendbridgetreecover upcollege studentscarwaterfallbearrocksyringefainting …hunterflatulencesheepgoattrappedtrailerferryatheistprime ministernorwayarmored cargiant monsternight visiontrailer homecameramanactress shares first name with charactertrollbiologyclimbing a treevideo footagepsychotronic filmpolishslimefootprintcamperbegins with textsuit of armorferry boattireturned to stoneabandoned minegovernment coverupbaitblood testsledge hammernorwegianblood sampletaildriving in the raintanning bedgovernment officialclandestineanimal bitesecret government organizationrabiesultraviolet lighthand heldthree headed creaturewrecked carno trespassing signreference to michael mooregovernment secretleg hold trapbinocular microscopesecret government agencythree headed monstermythological creaturemicroscope slidethymelive baittetanus shotbucket of bloodelectrified fencegovernment scientistduct tape bandagemysterious footprintstrapped in a cave (See All) |
Long ago in the Iron Age, a shadow loomed over a lonely village. For generations, the village youths are stolen from their families and delivered as sacrifice to a mythical beast - the Minotaur that dwells beneath a great palace. Theo, haunted by the loss of his love in an earlier sacrifice is convi …nced that the beast isn't real, and that his girl still lives as a slave within the palace. His father, Cyrnan, the village leader, tries to reason with Theo not to go, but Theo is driven by blind rage. He devises a plan and is taken with the other youths who are dragged screaming from their families. (Read More)
Subgenre: | sword and sorcery |
Themes: | monstermythologydeath in childbirth |
Locations: | villagecampfirecave in |
Characters: | tattoosoldierterror |
Period: | winter |
Story: | human sacrificefemale nuditybloodlesbian kissvoice over narrationmaskimpalementvirginscreamskeletonratqueenwolfspearsheep …torchshieldbananasign languagewhisperingbullempirerock climbingsailing shiplabyrinthpokieshowlingcaught in a netincenseminotaurtaxnose ringgrapescry for helpchild sacrificelong fingernailsfalling into a pitpolytheismpool of water (See All) |
When plans for a weekend vacation hit a dead end, a group of close-knit friends find themselves stranded in unfamiliar territory, pursued by a menacing, blood thirsty predator. Holed up in an isolated cabin, tensions mount as long-buried secrets are revealed. As the body count rises, the group must …put their differences aside and fight for survival. (Read More)
Subgenre: | monster movie |
Themes: | monsterwilderness |
Locations: | woodsroad tripsuv |
Characters: | husband wife relationshipafrican americanboyfriend girlfriend relationshipgay friend |
Story: | bodyone word titlecreaturecoming outvacationcabinblood spattersplattercloseted homosexualgroup of friendswalkie talkieloss of loved oneloss of wifeanimal attackinterracial friendship …backpackloss of brotherhikingflarecabin in the woodsroadblockweekendposing for a photographreference to david bowietrapped in a buildinginterracial love relationshipfinal girlreference to freddie mercuryboarded up windowcreature horror (See All) |
When a group of young friends take a trip to a remote mountain to get away from their families for Christmas, their stress-free getaway turns into a nightmare. Trapped in a cabin by a supernatural creature, their fight for survival puts their fracturing relationships to the test as it becomes increa …singly clear that all of them won’t be surviving the holidays. (Read More)
Subgenre: | supernaturalfound footage |
Themes: | monster |
Mood: | nightmarenightdarknessatmosphere |
Locations: | woodsforestsmall town |
Story: | folklorehousecreaturecabiniceanswering machinegroup of friendsguardice hockeysurprisemental breakdowneyewalldivorced parentscold …scareyoung adultsyounggetawaycreepydisturbingfrozenhiddenholidayshorror filmleavescaughtbackgroundsecluded cabinweekend getawayradio personalitysupernatural creaturelong waitfairy lighthorror movievacation gone wrong (See All) |
Jim and his girlfriend Kelly are visiting the infamous Willow Creek, the alleged home of the original Bigfoot legend - the tale of huge ape like creatures that roam the forests of North America. It was there that in 1967, the legendary beast was captured on film and has terrified and mystified gener …ations since. Keen to explore more than 50 years of truth, folklore, misidentifications and hoaxes, Kelly goes along for the ride to keep Jim happy, whilst he is determined to prove the story is real by capturing the beast on camera. Deep in the dark and silent woods, isolated and hours from human contact, neither Kelly or Jim are prepared for what is hidden between the trees, and what happens when the cameras start rolling... (Read More)
Subgenre: | mockumentaryfound footagefake documentarycreature feature |
Themes: | campingcamping in the wilderness |
Locations: | woodsforestbarsmall townmotelgas station |
Characters: | boyfriend girlfriend relationshipmusicianactressfilmmaker |
Story: | folklorenuditymale nudityinterviewmale frontal nuditymale rear nuditybare chested malekissmale full frontal nuditysurprise endingmale pubic hairsubjective cameraflashlightvideo camera …marriage proposaltalking to the cameraskinny dippingtentlong takemale underwearredneckrejectionhandheld cameranude swimminghikingbigfootsasquatchproposalno endingscreaming in fearcreekman undressinglost in the woodsrangerunsolved mysteryhand camerahearing noisesboxer briefsraw footageno background scorebig footchaos in the darknational forest (See All) |
Estranged friends Leo (a crime-scene cleaner) and hired-hand Elvis are cleaning up a particularly messy casualty deep in the Norwegian woods. When Elvis accidentally finds a secret passage that leads to a subterranean living space, he also encounters Thale, a beautiful young woman who sings, but doe …s not speak. Though they are intrigued and concerned for her, they are ill-prepared when others, tracking Thale, finally catch up to her. (Read More)
Locations: | woodsforestsnowbathtub |
Story: | folklorefemale nuditycharacter name in titleone word titleflashbackcreaturegas maskm 16telepathyvomitaudio cassettetailhorseshoeold friends reunitedcrime scene cleanup |
Scottish archaeologist Angus Flint discovers an odd skull amid the ruins of a convent that he is excavating. Shortly thereafter, Lady Sylvia Marsh returns to Temple House, a nearby mansion, far earlier than expected. At a party in the village, Angus meets Lord James D'Ampton, who has just inherited …his family's land right next to Temple House. Angus learns of the D'Ampton Worm, a huge dragon-snake that an earlier D'Ampton killed by cutting it in half. (There's a pretty catchy rock-folk song that tells the D'Ampton Worm legend.) As people begin disappearing and acting strangely over the next few days, the skull is stolen from Angus's room, and the watch of a missing person is found in a cavern that was the legendary home of the D'Ampton worm. Angus and James discover that there was an ancient cult that worshiped the worm as a god, and they theorize that the creature somehow survived its destruction, but it was trapped inside the cavern. The remainder of the movie shows Angus, James, and Mary Trent attempting to stop Lady Marsh from freeing the creature.... (Read More)
Subgenre: | independent filmcult filmchristian horror |
Themes: | surrealismrapedrinkingseductioninheritance |
Mood: | nightmareraindarkness |
Locations: | villagehospitalairplanebathtubfarmpolice carenglandcastlecavesex in a bathtub |
Characters: | policefather daughter relationshipmother daughter relationshipsingerteenage boynursepolicemandancersister sister relationshipvampirereference to godairplane stewardess |
Story: | pagan culthuman sacrificesexfemale nuditybased on novelbloodfemale frontal nuditymale frontal nuditymasturbationkisscigarette smokingdancingexplosionsinging …partyknifesurprise endingpantiestelephone callcryingsongdreamunderwearwatching tvdrinksworddead bodyhallucinationreference to jesus christbrabound and gaggedbandstrap on dildomansionimpalementtied to a chairsnakenungarter beltritualsearchfemme fatalepilotvirginpossessiondragondisappearancecult directorrecord playergrenadehypodermic needlegothiccrucifixtempleeccentricsevered handskullvirginityhitchhikerdinosaurreincarnationmobile phonehypnosissculpturecigarette lighterbutlerdead boydaggersymbolismcointorso cut in halfbatceremonymysticismparalysisgateblue pantiesestatevillaconventharmonicapocket watchelectric shockwormfatal attractionboard gamevampirismbagpipessnake bitecavernbroken neckpitbiteexcrementscotmosaicantidotecrossword puzzlearchaeologistlordfossilpagancigarette holderhermaphroditekiltserumserpentboy scoutworshipbasketreptilegiant snakevenomcatatoniaphallusroman soldiertanning bedscotchfangloch ness monstergiant wormarthritiscave drawingknickerssnake charmerflagellationancient templedioramanunnerydragonslayerfour poster bednun rapedblack nylon stockingsfolk rockmongoosepagan ritualscutting off a handlesbian innuendosnake in mouthyouth hostelsucking venom from snake bitepaganism vs. christianitypicture comes to liferoman generalsnakes and ladders (See All) |
An artist in crisis is haunted by nightmares from the past in Ingmar Bergman's only horror film, which takes place on a windy island. During "the hour of the wolf" - between midnight and dawn - he tells his wife about his most painful memories.
Themes: | murdersurrealismjealousyfearfilmmakingvoyeurismmemoryextramarital affairangerguiltinsanityhumiliationmadnesschildhood trauma |
Mood: | nightmaregoremysterious |
Locations: | woodsforestwaterseacastlecorpse in water |
Characters: | husband wife relationshipmusicianartistpregnant woman |
Story: | female nuditynuditybloodflashbackbare chested malegunnipplestitle spoken by charactertopless female nuditycryingbeatingdream …corpseblondeface slappaintingdemonhallucinationislandoperacandledinnerchild abusebirdpainterfishingsearchgunshotattackpossessionvacationdiarypursuitisolationhandguncross dressingapplausegothictimeaudiencerealityguestrowboatlaughtermurder of a childexistentialismlaughingpigeonsymbolismcrowillusionsunsetwifeapparitiondinner partynecrophiliamake upmetaphorsubtitlesold flameponytailinsomniacottageold ladyhusbandhosteyeballhouse partypsychological torturehomosexual subtextinvitationintellectualmob violencestreamswedishyoung boyremotepuppet showface ripped offsubconsciousbaronunhappy endingmost dangerous gameoil lampambiguityhit with a rockreminiscingsketchingnylonscaningclotheslineruseintrospectionpatternoneiricbraidspsychological tormentreference to mozartwater pumpdeath trapshorelineopera ariadisintegrationtripodcanvasfantasy versus realityyoung wifesanityfemale demonpsychenaked female corpsepersonal diarydriven madwalking on the ceilingdreams vs realitybirdmandemon in human formgoing insanehusband shoots wifethatched roofevil rich manwitching hour (See All) |
In the small English village of Midwich everybody and everything falls into a deep, mysterious sleep for several hours in the middle of the day. Some months later every woman capable of child-bearing is pregnant and the children that are born out of these pregnancies seem to grow very fast and they …all have the same blond hair and strange, penetrating eyes that make people do things they don't want to do. (Read More)
Subgenre: | paranormal phenomena |
Themes: | murdermarriagepregnancyfearinvestigationmilitarysupernatural powerparanoiaself sacrifice |
Locations: | villageschoolsmall townenglandouter spaceairplane accidentbus accident |
Characters: | husband wife relationshipdoctorchildrenbrother sister relationshipteachersoldierpolice officernursealienbabylittle girlsingle motherlittle boyprofessormilitary officer …pregnant wifesuicide by gunshotofficerdog actorevil children (See All) |
Story: | based on novelexplosionface slapcamerabombcar crashclassroommapfirst of seriesknocked outpianistchildbirthpubrecord playerfireplace …faintingeccentricmobsheepbirthtorchgas maskalien invasiondamsel in distressinvasionenglishdynamiteairplane crashtelepathygiving birtheyephysicianbicyclingx rayroadblockreference to albert einsteinkiller childshockmicroscopepsychic powermetal detectorshepherdmind readingglowing eyesexpectant motherinfanticideevil childphonograph recordextrasensory perceptionvicardemonicforced suicideremadedartsends with deathhorror movie remadeimpregnationembryodeliberate crueltygeiger countercontemporary settingchild rearinginquesthome birthdiscovering one is pregnantwhite eyesenglish villageweird pregnancyanimal senses evil (See All) |