Please wait - finding best movies...
South African enfant terrible filmmaker and artiste-cineaste Manus Oosthuizen meets with Rotten Tomatoes-approved indie film critic Babette Cruickshank in an Echo Park sound studio. With key members of Manus's crew joining, they record an audio commentary track for his new elegiac feature documentar …y Razzennest. But the session goes down a different path... cazzart! The ultimate elevation of arthouse horror, just not as you might expect. (Read More)
Themes: | art |
Characters: | filmmaker |
Period: | future |
Story: | commentary trackstock footagereal worldeffectfamiliarquestionsprogramstockcomplainingcuratorshowcasetrackstalkreasonbloody …humourquoteconcretelocalstoriesconflictmetahearingfunpremieredirectionlaughcheckegotrackcollectioncommentaryruntrashchaoseccentricrecordingcinemainterview (See All) |
A group of young filmmakers, led by neophyte producer Alex Romero (Christina Krakowski), venture out on a location scout in rural Pennsylvania. Deep into the back country, it quickly becomes apparent they have stumbled onto a family of werewolves and must now survive the night.
Subgenre: | indie horror |
Themes: | moneypolitics |
Mood: | gore |
Locations: | police stationtownbackwoodsstationback country |
Characters: | policewriter directorthe family |
Story: | familiarbloodylocalconflictfunpremiererunshotgunrunningtransformationwerewolflow budgetproducerfilm setmeeting …bonfirebodyfilm crewplaguesuitassistantkickrunning gagdivaindiewaitinggagbitesittingheadmayhemlocationruralpropertyarmfilmmakershorror filmblastbody transformationgearwantedhamlettheatricallosingco productionspecialistwolvesone shotfast pacedshotgun blastcharacter developmenthorror movie (See All) |
Two actors, as their make up is applied, talk about the size of their parts. Then into the film: Laurence Sterne's unfilmable novel, Tristram Shandy, a fictive autobiography wherein the narrator, interrupted constantly, takes the entire story to be born. The film tracks between "Shandy" and behind t …he scenes. Size matters: parts, egos, shoes, noses. The lead's girlfriend, with their infant son, is up from London for the night, wanting sex; interruptions are constant. Scenes are shot, re-shot, and discarded. The purpose of the project is elusive. Fathers and sons; men and women; cocks and bulls. Life is amorphous, too full and too rich to be captured in one narrative. (Read More)
Subgenre: | mockumentary |
Themes: | pregnancy |
Mood: | behind the scenesbreaking the fourth wall |
Characters: | boyfriend girlfriend relationshipdoctorbabyself referential |
Story: | trackstalkmetaegointerviewbased on novelfemale rear nuditytitle spoken by characterbattleanimal in titlescene during end creditssplit screenfilm within a filmactor playing himself …birthbootsmakeupfilm setvodkagiving birthnarratorfilm crewassistantteethcircumcisiondiapermidwifemovie makinghorny womanmeta filmmelonfilm buffwombupside downinterruptionparallel narrativebragging (See All) |
Bristling with equipment, two enthusiastic local access cable TV producers recruit an assistant and venture into a forest in search of the mythical and horrifying Jersey Devil. Days later, only one of the trio emerges. He becomes the prime suspect in the disappearances of the other two. However, a l …ocal filmmaker examines extensive footage found at the scene and arrives at a different conclusion. (Read More)
Subgenre: | independent filmfound footagefake documentary |
Themes: | murderdeathinvestigationmagicevilmysterious death |
Mood: | nightdarkness |
Locations: | forestsnowwoodsbackwoodsblood on snow |
Characters: | filmmakerdetectivemysterious killer |
Period: | winter |
Story: | localeccentricinterviewviolencesurprise endingcomputercamerasecretsubjective cameravideo camerainternetlooking at the cameratalking to the cameramicrophonedanger …film within a filmdarksuspicionkillingrecord playerlive broadcastrevelationvideotapephone boothcamppsychopsychologisthomicideevidencesurprisehandheld cameralandlordvideo tapesuffocationmysterious mandark secretblood stainvhsroadtapedocumentary crewlong haired malecard trickdocumentary filmmakerplastic bagtelevision broadcasthidden truthlost in the woodsquestioningforensic evidenceobscuritycamera crewfake news reporttelevision crewear piercingyoung filmmakerjersey devilinternet broadcastarrest recordforensic psychiatrist (See All) |
A sleep study goes awry when participants start to go missing.
Themes: | divorcedepressionevil |
Mood: | gorenightmaremoving |
Locations: | carflat |
Characters: | terrorwriter director |
Story: | effecttalkreasonlocaltrackrunsexdemoninternetcreatureprologuekeystalkingtraphaunting …sleepingcouplesisterexperimentvictimanxietycartoonsatellitealleyparalysisloud sexblacksleephusbandfallinguniversemissingteethrugbycrossoverjetclawrecordeyesjumpkeysdevelopmentexecutivebluecar keyscreepydisturbingcablecrawlingdreamsstudyplayersupporthorror filmlinkrugby playerterritoryepisodesleep paralysisblack eyesprocessrubberreversesparksmomenthagsound effectsideaincomedevicesightinghelplessluckystrong (See All) |
When Andrew unexpectedly shows up on Ben's doorstep late one night, the two old college friends immediately fall into their old dynamic of heterosexual one-upmanship. To save Ben from domestication, Andrew invites Ben to a party at a sex-positive commune. Everyone there plans on making erotic art fi …lms for the local amateur porn festival and Andrew wants in. They run out of booze and ideas, save for one: Andrew should have sex with Ben, on camera. It's not gay; it's beyond gay. It's not porn; it's an art project. The next day, they find themselves unable to back down from the dare. And there's nothing standing in their way - except Ben's wife Anna, heterosexuality, and certain mechanical questions. (Read More)
Themes: | artfriendshipdrinkingdrunkennessmemorydrug usesexuality |
Locations: | kitchenmotelmexicomexico city |
Characters: | husband wife relationshiphomosexualfriendtattoodancerartistgay kisshomosexualityold friendtrying to get pregnant |
Period: | 2000s |
Story: | questionslocalrunsexfemale nudityf ratednudityone word titlethreesomebare chested malekissfemale rear nuditycigarette smokingdancing …partylesbian kissshowertelephone callcell phoneunderweartesticlesfoodmirrorslow motion sceneundressingbare buttliebedmarijuanabathroomguitaralcoholbisexualcookingwinecandlevideo camerabasketballeatingdinnercoffeeconfessionprologuesex toyhuggingpot smokingfriendship between menhatmale bondingbeardimprovisationbuddylesbian couplemale male kissseattle washingtonfemale female kissbongmotel roomhangovercellomumblecorepillowspoonintimacysexual identitydressingsugarbromanceadult filmmakingdareheterosexualitysleeping baggeneration xpolyamoryheadbandsexual orientationdoor bellcollege friendmilkshakeamateur pornographyhookahscotch whiskeysex with someone sleepingart projectpornography filmmakingtestimonialsex while asleepgarglingreference to frank lloyd wrightclothes hangerreference to jack kerouacovulationpork chopreference to dionysus (See All) |
A supernatural thriller that addresses questions of life, love and belief against an apocalyptic backdrop. A group of close friends gather for a wedding, but the celebration is shattered by a series of cataclysmic events and enemies foretold by biblical end-times prophecies. The survivors face a hor …rifying, uncertain future as they scramble for safety, but as their world collapses around them in chaos and terror will they choose real life through faith, or just try to survive? (Read More)
Subgenre: | found footageparanormal phenomenadisaster filmdisaster movie |
Themes: | religionweddingdeath of fatherdeath of motherfaithdeath of wifepanicapocalypse |
Locations: | hospitalchurchstorm |
Characters: | boyfriend girlfriend relationshiplove trianglechristianitybiblepregnant woman |
Period: | future |
Story: | questionschaosblooddead bodydemonlibrarydeath of childbasementwoundcrying womanchristian filmend of the worldpower outageprophecybible quote …infectionhandheld camerawedding dresswoman cryingplagueraptureexploding airplanebible prophecydead babyloss of faithmass deathcrisis of faithbook of revelationrapture aftermathhailbiblical plague (See All) |
The story of a humiliating high school mishap from 1992 that sends the Impractical Jokers on the road competing in hidden-camera challenges for the chance to turn back the clock and redeem three of the four Jokers.
Themes: | cruelty |
Mood: | high school |
Locations: | schoolcarroad trip |
Characters: | writer director |
Period: | summer |
Story: | real worldreasonfunlaughruncinemainterviewsongcameraconcerteatingon the roadproduct placementprankgold …rapvisitstrangerhomeclockembarrassmentseriesfanjob interviewlaughterroomtripschemesocial mediasecurityemergency roomshocksocialroadkidsfairticketblogcandid cameraemergencyfakedrive ineulogylazinesspranksterpopchancehiteditingfeature filmimprovisedplayingquartetwinkhiddendrivepresentationrap songprofessionalthinkingpatiencemishappersonepisodepricesharingbuddiesforgottenautohavocsneakideaguardsbiscuitscamera footageone personreal peopleshow offpeople watching (See All) |
Focusing on a ghost who knows karate
Subgenre: | martial artswuxia |
Themes: | artrevengeghostobsessioncelebrity |
Mood: | gore |
Characters: | artistvillainfathergirlfriend |
Period: | 80s90s |
Story: | familiarhumourlaughcheckbloodfightkung fugravekaratemartial artistbrotherpowermartial arts mastervictim …monkrealityvisionfandrunkbodynarratorchoreographyblackmessagemasterhandmatchbelthoboblack beltdefeatdojoartsinformationmemoriesskinsadisticeditingwanderingstickhandsfight choreographytraditionalrematchdubbedhittingintentionally baddeadlyavengephysicalgagsmartialarts films (See All) |
Jeff, who has been diagnosed with AIDS, decides to get his revenge on the world by attacking people with hypodermic needles filled with his blood.
Subgenre: | black comedyvideo |
Themes: | artdeathrevengesuicideexploitation |
Mood: | slasher |
Characters: | policepsychiatrist |
Period: | 1980s2000s |
Story: | familiarquestionstalktracknuditybloodviolencesuicide attemptcultdomestic violencehookerfallpostershot on video …blackcrazyno budgetmindboom boxvintageobscurityfansmicro budgetshootinfecteddomesticscannerpitchbootlegfailed suicidehypodermicreactionmashupneedlesboomstickerextrasideanotesfailed suicide attempt (See All) |
Each year dozens of encounters with upright canids are reported in North America. These beings often behave in similar ways with many reports recounting a creature that is aggressive, ghastly, and disturbing. While many theorize that the Dogman is some sort of unidentified species of animal, many be …lieve that what they were confronted by was something else. Something more. (Read More)
Subgenre: | video |
Themes: | faithhunting |
Locations: | carwoodscampfire |
Characters: | police |
Story: | tracksbloodystoriescheckrunrecordingbloodtearsrunningnewspaperanimalcreatureparkwolflaw …homeburialeaten alivediscussionevidencehandclothingclothesfacevoiceyounglaw enforcementinformationspiritsdisturbingpark rangerrangerjudgmentfleshunknownbizarrelegendsspeciesexcuseeyewitnessproofcreaturesincidentscary storytalkinglack of evidencetireskilledaliveideaprotectaggressiveminutehorror movie (See All) |
This is a horrific tale filled with twists and turns in a world where nothing is as it seems. A couple find themselves imprisoned by a serial killer driven by the demands and depravity of individuals finding a community on the dark web.
Themes: | murderdeathmoneytortureinvestigationnatureevil |
Mood: | gore |
Characters: | writer director |
Story: | questionsbloodypremierechecktrackviolencekniferunningkillingcouplecopsurprisediscoveryhusbandwaiting …publicitytriomoralwebmoral ambiguitydamageprivatedisturbingambiguityfanshiddendentalstomachstringkillingsbrutalhappyedgehidden agendaagendakilledhypestrapped down (See All) |
Held down by restrictive rules, an embattled cheerleading squad seeks the freedom of a creepy, closed school gym to practice for regionals, but when members of the squad start to disappear, the cheerleaders must unmask their assailant to save themselves.
Themes: | deathwriting |
Mood: | slasher |
Locations: | school |
Characters: | killer |
Story: | familiartalkbloodyfuncheckbloodsequelcamerasecretstrangulationdrawinganthologythreatstagecouple …communityseriessafecrownchangepyramidcreativityweekendrisktargetlockhumanmascotfranchisestuntsrebootpressurecuttingdirectingpracticewanderingtrianglefilmmakersblood pressurelightingstrawsurviveclassicpreparationwantedterritorybehind the cameracheerleading squadsquadhorror anthologywinidealeavepaycheckcheerschool gymhigh riskhuman pyramid (See All) |
Because of his eccentric habits and bafflingly strange films, director 'Edward D. Wood Jr. (I)' (qv) is a Hollywood outcast. Nevertheless, with the help of the formerly famous 'Bela Lugosi' (qv) and a devoted cast and crew of show-business misfits who believe in Ed's off-kilter vision, the filmmaker … is able to bring his oversize dreams to cinematic life. Despite a lack of critical or commercial success, Ed and his friends manage to create an oddly endearing series of extremely low-budget films. (Read More)
Subgenre: | gay interestcult filmb movie |
Themes: | lovefriendshipfuneralfilmmakingwrestlingcelebrityhollywooddrug addiction |
Mood: | behind the scenesbreaking the fourth wallaffectionbiographical |
Locations: | barrestaurantchurchcemeterylos angeles californiabustaxiapartmentghost train |
Characters: | filmmakerfriendboyfriend girlfriend relationshipactoractressdirectorfilm director |
Period: | 1950s |
Story: | stock footageeccentriccharacter name in titlecigarette smokingtitle spoken by characterhalloweengay slurdeath of friendsuicide attemptcoffincigar smokingtalking to the camerabartenderconfessiondrug addict …lightningfilm within a filmhandguncult directornewspaper headlinetransvestitewhat happened to epiloguegothicheavy rainfriendship between menhollywood californiamovie theaterphone boothblack humoramusement parkblack and whitefilm setfilm producerdressing roomwar veteranwrestlergothbaptismhomagebus stopstage playmisfitsex changehollywood signmovie studioreverendtransvestismfuneral homeslaughterhousemorphineshowbizloudspeakerguillotinemovie posterfunfairman wearing a wigcigarette holdergender benderreference to frankensteintrick or treatfilm reelfilm premierereference to draculadumped by girlfriendmariachi banddentureschiropractordrug rehabreference to orson wellestheremindirector actor relationshipreference to charlton hestonreference to boris karloffwashed outjacobs ladder (See All) |
A government agent cursed by lycanthropy goes on a dystopian fueled adventure to find his son, who has parted ways with his father.
Subgenre: | dystopian future |
Themes: | revenge |
Mood: | behind the sceneshigh schoolmoving |
Locations: | schoolcar |
Characters: | soldierfatherwriter director |
Period: | future |
Story: | tracksreasoncheckcommentarybattlebombrunningbandtransformationgovernmentwerewolfwolfagentnostalgiason …cannibalgovernment agentposterintestineswifekillshot on videostuntmastershockgeneticsdigitalwaitingcutdealyounginterviewssuper soldiertrailkidnappedmorphingsoundtrackartworkbountylycanthropytroopsbonusfilmmakerscursedheadquartershorror filmsellingsuperscalekilledstickerextrasnotesyoung sonmovie soundtrackbounty huntersunwilling participant (See All) |
After a surprise phone call interrupts his daily workout, beefy body builder Naoto agrees to meet his photojournalist ex-girlfriend to help with her research on haunted houses. Accompanied by a professional psychic, they visit an abandoned house once owned by Naoto's father. But inside the house a d …ark secret lingers and they find themselves trapped and tormented by a relentless ghost with a 30 year grudge. (Read More)
Subgenre: | b moviestop motionvideoasian horrorjapanese horror |
Themes: | loveghost |
Mood: | gore |
Locations: | old school |
Characters: | fathergirlfriendlove letter |
Story: | commentary trackbloodyfunchecktrackbloodsecrethousecoming outhaunted housepsychiccouplespirithometrapped …special effectstruthvideo artbodyset updark secretvideo storesubtitlesabandoned housemasterhome videophone callbodybuildergrudgeworking outhauntedheadevil deadfansvideo nastybody buildingvengeful ghostbody partsprofessionalmurdered womanheadless corpsecallwoman killedmusclescannon fodderfilm historianaudioeye socketmotionold fashionedkilled by evil deaddeserted househuman being (See All) |
Strangers awaken in individual holding cells with no memory of how they arrived. They realize if they don't acquire enough online "likes" in a timely manner, they'll die horribly at the hands of a sinister executioner.
Subgenre: | sword and sorcery |
Themes: | prisontorturememorynature |
Mood: | gore |
Characters: | policevillainself mutilation |
Story: | talkbloodystoriesfuncheckbloodviolenceswordsurvivalinternetsacrificegamemutilationhammerskull …trappedexplosiveteamfanwhipmakeupexploding headattractionbodycastingsocial mediacluesocialmenacecellcinematographersorceryeyessnuffhooded figurefranchisecontestantheadgruesomerulesbody partstoolboxclaustrophobicgoryoutfitcheapsound effectsaliveideadevicefeelingfigurebad decisionsburnt alivetorn apart (See All) |
Director George Popov explores the dark and disturbing secrets behind three of England's most haunted villages.
Subgenre: | supernaturalparanormalfolk horror |
Themes: | deathghostmysterious death |
Mood: | mysterious |
Locations: | villagewoodstown |
Characters: | children |
Story: | effectfamiliarlocalstoriesrunningnewspapernarrationkeyreadingclassnewspaper headlineserieslow budgetdiscussionhistorical …killinspirationoutbreakhauntedghostscreepyspiritstheoryfolksoundtrackplayinghandsheadlinepresentationdiveviolenthighwaymanhistory classdeepbackgroundspectretalkingcriminalsregional2015 (See All) |
A gathering of friends is thrown into chaos by the opening of a mysterious fiery sinkhole near their secluded holiday home.
Themes: | artfuneral |
Mood: | mysterious |
Locations: | snow |
Characters: | detective |
Story: | talkconflictfunchaosfirerescuepaintinginterrogationtreeargumentcountrysideglassesbrotherclasskilling …holidaysisterlawno dialoguewatching a moviehomeappleroomstruggleset upwoodfarmhousemissingbackyardchaineddoorpitnoisebrother in lawcutbitingblockfilm makingquestioningeditinghiddeninterrogation roomstudentsarrestedin lawsinkholepuddleframeexperienceoppositiongatheringdeepsavesmashfailheightalivesightimmersiveholiday homesecludedsound designfire pitsnow covered (See All) |
Juliet lives in a beautiful house by the ocean. Her sisters, and especially her Mother overshadow her with their beauty. She is a spiritual, superstitious and naive woman. She visits a psychic seer who tells her she must follow the sex trade in order to be happy. Not long after she meets her eccentr …ic and sexy neighbour, Suzy, who, by all counts appears to be a high class prostitute and encourages Juilet into sexual acts which make her guilty and nervous. A rare night when her husband is at home she wakes up to catch him talking to another woman on the phone. He calls out the name "Gabriella" while sleeping, but when she questions him he lies his way out of it. She finds out who Gabriella is and fears her husband will leave her. Juliet begins having visions who accuse and terrorize her. The pinnacle of the visions comes at the end where it is implied she realizes she would be better off without her husband and is ultimately emotionally emancipated. (Read More)
Themes: | artsurrealismmarriageinfidelityreligionweddingmemoryextramarital affairdivorcedrug usesexualitywealth |
Mood: | nightmare |
Locations: | beachswimming pool |
Characters: | husband wife relationshipmother daughter relationshipfemale protagonistlawyersister sister relationshipgrandfather granddaughter relationshipreligious symbolism |
Story: | questionseccentricsexcharacter name in titleflashbackpartyneighborhallucinationnonlinear timelinepantyhosecostumespiritualitywigpsychic …strong female characterprivate detectivecircuseavesdroppingfemale stockinged legsgamepsychologiststrong female leadvisionattempted suicidegrandfatherhypnosissuperstitionactress playing multiple rolesseancecatholicismmediumrepeated linetreehousevisitorcolorguruwedding anniversaryabsurddomineering fatherspiritualismandrogynysex gamehermaphroditecircus performerrealizationfidelityanniversary partywhite pantyhose (See All) |
In this Christmas-Horror Anthology, a family's movie night on Christmas Eve is interrupted by a stranger, insistent on making the next Christmas 'classic' film himself.
Subgenre: | found footage |
Mood: | night |
Locations: | old school |
Story: | storiesfuncollectionhouseanthologyhaunted housestrangerseriestableshortskidsnew housework outtalefans …aspiring filmmakersegmentsrangekiller scarecrowhorror anthologyco productionshort stories (See All) |
After accepting a job at a low-rent pornographers, a feisty young woman must fight to survive against an ancient evil intent on killing everyone in its path.
Subgenre: | suspensesupernatural |
Themes: | fearfilmmakingevilthe devil |
Mood: | parodyslasher |
Characters: | filmmakergirlfather |
Story: | familiarfunpremiererunsexbloodmaskshootingdecapitationcurseprologueattackbusinessdark …generalheroinemacheteskulllow budgetmovie setboyfriendnotebody counttrippresentbodyyoung womanno budgetclothesjumpfranchiseworkingcountorderancientplayingenthusiasmbondtribalfilmmakerscurseddreadhorror filmstealrangestolenfinal girlimpressionproofsacreddeepporn businessdierootleaveoddballpresent daybackstory (See All) |
Edward Walters, an auto mechanic, falls for the intelligent and beautiful Catherine Boyd. It is love at first sight. There is however a problem, she's engaged to jerk James Moreland. Fortunately, Catherine's uncle likes Ed, and with his friends they scheme to make Catherine fall for Ed. The comedy i …n this movie stems from the fact that Catherine's uncle is none other than Albert Einstein, who's portrayed as a fun loving genius, as are his mischievous colleagues, Nathan, Kurt and Boris. (Read More)
Themes: | cheatingphilosophy |
Mood: | rain |
Locations: | hospitalrestaurantcarmotorcycleboatrural settingpolice carouter spacegas stationlaboratoryschool bus |
Characters: | police officerphotographerwaitressprofessoruncle niece relationshipbabe scientist |
Period: | future1950s |
Story: | funcinemadancinghorseface slapcameracaferiverscientistreportercandleold mandinerdinnerman with glasses …acronym in titlemicrophonelightningu.s. presidentconvertiblespeechpresidentratmonkeygarageheart attackrecord playerflirtingexperimentapplausemousewatching a moviepress conferencetimeaudienceladderrealitymechanicmovie theatretelescopethunderpastnewsreel footagelove at first sightsports carpipe smokinggeniusviolinistenglishman abroadtitle ends with periodpresentnotebookgolf clubfilm clipjukeboxmathematicsintelligencesailboatwatchpopcornsailingnewspaper articlelistening to radioblackboarduniversetestphysicspressskydocumententire title is capitalized acronymstarsmotorcycle copcometcompasscity parkbedriddenphonograph recordmatchmakinggravitynewsreelreference to marlon brandotheoryparadoxchalkboardreference to isaac newtonspeakermotorcaderuseboat ridescreenauto repairreference to mozartlab ratlab monkeybadmintonpolice escorttransmittertripodhuman guinea pigprojectoriqlab mouseatomic energynuclear scienceprincetonsymposiumhi fiprotonracquetsimianscope (See All) |
On Halloween Eve in Brooklyn, an average Joe loser named Chris finds an invitation to a costume party. Arriving at the "party", Chris discovers he's fallen prey to the lethal trap set by deranged artists. As the night wears on, rivalries within the group flare up. A body count accrues, and Chris mus …t take advantage of the ensuing chaos if he's to survive the night. (Read More)
Subgenre: | cult filmb movieb horrorscrewball comedy |
Themes: | artmurderdrugsdrunkennessescapeunrequited love |
Mood: | goresatireone night |
Locations: | new york city |
Characters: | gay sexartist |
Story: | chaoseccentricsexblooddogguncigarette smokingfirecell phoneshot in the headcatcamerasecretfalling from heightmask …paintingalcoholhalloweenbisexualaxedrug dealercocaineanti heroracial slurperson on firebaseball bathalloween costumeinjectionglassespizzachainsawsyringemass murdercakesociopathcaptiveaccidental deathimpostorironyracistloneraxe murderpumpkinnude woman murderedhalloween partyneedleschemevhsallergyinvitationhipsterchainsbreast implantjack o'lanternbody paintcomeuppancefalling off a roofpainted facevampire costumemovie referenceintoxicationparking ticketpassed out drunkreference to edgar allan poeaxe murderersketchbookbeer kegsideburnstruth serumlonely manpretensioncrankknight costumecheerleader costumevinegardog wearing a costumebutt cracksilent manhidden bodyburn markskilled with a chainsaw (See All) |
The story of how an eccentric French shop-keeper and amateur film-maker attempted to locate and befriend Banksy, only to have the artist turn the camera back on its owner. The film contains footage of Banksy, Shephard Fairey, Invader and many of the world's most infamous graffiti artists at work.
Subgenre: | fake documentarydisneyalternate historymock documentary |
Themes: | artcelebrityfashion |
Mood: | satiresocial satire |
Locations: | los angeles californialondon england |
Characters: | artist |
Story: | eccentricinterviewvoice over narrationpaintingf wordjournalistpainternarrationvoice overprankgraffitifamefraudart galleryconsumerism …art exhibitionnews footagereference to madonnamodern artsubcultureexhibitiongallerydisneylandart collectorstreet artcivil disobedienceconsumptionreference to andy warholfilm essayart showart exhibitwest bankbrandmovie reality crossoverstreet artistcommercialismgraffiti artistanti consumerismart movementpolitical artart marketpolitical statement (See All) |
Determined to prove the possibility of alternate dimensions, a graduate student unknowingly unlocks a gateway to unimaginable horror. Based on the H.P. Lovecraft's short story The Dreams in the Witch House.
Themes: | memorynatureexploitation |
Locations: | town |
Characters: | girlstudent |
Story: | familiarstoriesmetacheckrunblooddancingchasefireshootingrunningbedhousefishritual …on the runreadingbusinessfirst parthaunted housearchitecturewitchcraftservantrealityresearchatticcaptureroomsmokeeyesorcerercoincidencesalvationexploitation filmsinisterfacehumanadaptationhauntedstakeheadgraduate studentskincreepyfemalelocationworkingthesiscuttinggraduatefleshunknownbizarregruesome70strippybeatlightinggeometryrashwitchesburnedcreaturesartifactsdimensionseeriefloorboarddrinkslovecraftrevelationsaudiocultistlightsminuteservant girlloose adaptationshort stories (See All) |
Sequel to the 2018 horror anthology Dead by Midnight (11PM Central).
Themes: | wrestling |
Locations: | school |
Characters: | vampiremotherdaughter |
Story: | real worldstoriesfuncreatureanthologyold womangymkillingdrugevidencewrestlerwifewrathtalecleaner …first filmsegmentspublic servicefollow upfast forwardhorror anthologycheerleaderspro wrestler (See All) |
Five estranged friends play a seemingly innocent game that spawns into something far more sinister than they ever could have imagined.
Subgenre: | supernaturalhardcore horror |
Themes: | loveghostfuneraldying |
Locations: | hotel |
Characters: | lawyerlust |
Story: | familiarreasoncollectionrunsexbloodsequelblood splatterbedhouseritualtreereading …splattergamesurprisecareerplaydeadkillweedtemptationfallingwarningredsinisterjumprebootinvisiblefansclichewalkinnocentunintentionally funnysecretsfreelearnextraflashbackstalkingintersectionrevelationsdraggedstrongunder the bed (See All) |
After committing check fraud, Preston Waters begins to live out his 12 year old fantasies by spending a million dollars in six days. But when it came to being an adult, he quickly realized that he didn't quite fit the bill. Miguel Ferrer and Brian Bonsall star in this 1994 kid classic that will leav …e you asking the question "why didn't this kid get grounded?" (Read More)
Themes: | moneygangstertheftregret |
Locations: | restaurantbicycle |
Characters: | father son relationshipboypolicemanbully |
Story: | checkcar accidentslow motion scenecomputerbirthdaycriminalsubjective cameramansionhousebirthday partyparklimousineorganized crimevacationbank …dateloyaltylifting someone into the airice creamfbi agenttennisimpostormillionaireamusement parkinjusticechauffeurpedophiliaintelligencebankermoney launderingforgeryvillain arrestedmaterialismsittingrich kidpressurebank tellerlifting a male into the airspendthrifthouse seller (See All) |
Dennis is a clueless and slightly overweight guy, who left his pregnant fiancee five years earlier. Every day, Dennis tries to persuade the woman he loves to accept him back into his life, but everyday he fails. When he discovers that Libby has found a partner in the form of American Whit, frustrati …on grows, and Dennis vows, that for once in his life, he will finish something. This something ends up being a Nike River-run in London. With his friends Gordon and Mr. Ghoshdashtidar by his side, Dennis begins training for the marathon he must finish. (Read More)
Themes: | friendshippregnancyweddingredemptiongambling |
Locations: | london englandengland |
Characters: | family relationshipsfather son relationshipboylove trianglebest friendinterracial relationshiplittle boycousin cousin relationshipfiance fiancee relationship |
Story: | runmale nuditymale rear nuditybare chested malephotographtitle spoken by characterbare buttrunningbirthdaymontageboxingbirthday partyspankingmarriage proposaltraining …smokinglocker roompassiongymeggfriendship between menrepetition in titlemale bondingcrushtowelbreakfastinterracial romancecameobetlandlordunderdogimperative in titleponytailhospital bedbakerysecond chancecathedralslappingbiracialweight lossdeterminationmarathontrainerwhite male black female relationshipendurancejumping ropetv crewtraining montagebiracial childfirst crushirishmanfat boydirected by an actortower bridge londonpregnant brideblistertrippingankle injurysports announcerfinish linecold feetniketree climbinghuman spiritpratfallrenewalrunaway groomeating raw eggjilted at the altarnicotine patchjilted bride (See All) |
Luciano Onetti and Nicolas Onetti, collectively known as The Onetti Brothers first came to wide attention in 2015 with their modern giallo Francesca. They've since followed it up with the TCM inspired What The Waters Left Behind and another giallo Abrakadabra.. Now they're trying their hand at the a …nthology film. They provided the wraparound sequence and helped select the shorts that make up A Night of Horror: Nightmare Radio. The idea was to collect the best of the short films making the rounds and assemble them into a collection. Then bind them together in a framework of stories told by a radio DJ Rod Wilson (James Wright). As he tells his tales, he finds himself caught in his own horror story.. The idea of a DJ or their callers yelling scary stories has been used before, most notably in A Christmas Horror Story. As has an anthology made from existing shorts. Shevenge being a recent example. Where both differ from A Night of Horror: Nightmare Radio is they have a theme to unify them. Here there's no central theme just a lot of stories of varying ideas and quality.. And they are all over the map thematically. In The Dark, Dark Woods by Jason Bognacki (Mark Of The Witch) is a tale of an invisible woman, and of female repression. Post-Mortem Mary from Joshua Long is a creepy tale of post mortem photography. Into The Mud from Pablo S. Pastor is a twist on hunting and fishing. And Matthew Richards' The Disappearance of Willie Bingham is a tale of commercialized punishment that m… (Read More)
Subgenre: | allegorybody horror |
Themes: | fearmonsterincestabusephotographyjusticehunting |
Mood: | night |
Characters: | killer |
Story: | showcasereasonstoriesfunpremierecheckcollectionrunrecordingbloodsecretrunningbedinternetmap …jokeradiofishingcreatureanthologystorytellingdarkcouplerealityshadowhairdresseryellingbodydark secretshortschild molestationrepressionradio showhandhold upbaggiallomolestationmortalitysinisterjumpwebblockghostsannouncercreepydonationsearchingfemalelocationtaleinvisiblesoundtracksupportplayinghiddencaseopinionaround the worldfilmmakersbad jokepost mortemhorror filmbrandopportunitywraparound storyhorror storysegmentsexperiencetrendrangetalesdownfallhideprocessuglycreaturesinvisible womancaughtoutingrecording boothhorror anthologycenterfitboothideaincome2015strongthemeunder the bed (See All) |
Single father Paul Henson purchases a newspaper in the small town of Copperton, Ohio and moves there with his teenage daughter Christina. The two soon come to realize the townsfolk, led by the evil Reverend Donovan, are actually Satanists.
Subgenre: | conspiracyvideoindie horror |
Themes: | art |
Mood: | gorebehind the scenes |
Locations: | small townwoodstownthe office |
Characters: | sheriffdaughter |
Period: | 80s90s |
Story: | localhearingfuncommentarybare breastscell phonelow budget filmreporternewspaperimpalementdruglow budgetnostalgialost …suspectvideo tapespecial effectsmarketshot on videoblackmessageindiedigitalfairfleeingquestionhandssatanicpicturesdangerouslost filmmaternitymaternity wardwantedhappydemandcaughtreactionwardfinancingdigital effectsextrassense of humorone personstrongb gradepost productionpromotional videolong time agoinverted cross (See All) |
Oil billionaire Happer sends Mac to a remote Scotish villiage to secure the property rights for an oil refinery they want to build. Mac teams up with Danny and starts the negotiations, the locals are keen to get their hands on the 'Silver Dollar' and can't believe their luck. However a local hermit …and beach scavenger, Ben Knox, lives in a shack on the crucial beach which he also owns. Happer is more interested in the Northern Lights and Danny in a surreal girl with webbed feet, Marina. Mac is used to a Houston office with fax machines but is forced to negotiate on Bens terms. (Read More)
Subgenre: | independent filmcult filmfish out of waterdeadpan comedy |
Themes: | friendshipmoneydrinkingdeceptiontravel |
Mood: | affection |
Locations: | beachchurchhotelhelicoptersmall townvillagesea |
Characters: | husband wife relationshipboyfriend girlfriend relationshippriestamerican abroadmermaid |
Story: | localeccentrictwo word titledancingsingingpartysurprise endingtelephone callkissingrabbitpubstrong female charactereavesdroppingculture clashwhiskey …telescopeecologyscotlandmillionaireoilfogaccountantreal estatefighter jetscuba divingporschehouston texaspsychotherapybritish renaissancefemale bosscometmopedshacksweaterbrandygeneral storesealstar gazingcross culturaltelephone boxseashellpunk girlmeteor showeraurora borealisshrinkplanetariumscale modeloil businessoil tycoonnorth sea oilbeachcomber (See All) |
Three college students stumble upon a secret television broadcast of a deceased serial killer and search for its location.
Subgenre: | found footageparanormal activity |
Themes: | deathprisonobsessionchildhooddying |
Mood: | slasher |
Locations: | carwoodspolice stationstation |
Characters: | policeserial killerpolicemankiller |
Story: | familiardirectiontrackruninterviewgunknifeshootingbookrunningbedinterrogationcollegesearchclown …businessdarkclasscopcrime scenefandeadcameramandeath penaltycellprotectioncardsjumpdecisiondealinformationpocket knifecreepytelevision broadcastlocationwastetrailpublishingabandonedgrotesquewanderingbroadcaststudentsstretchinghorror filmroutekillersserialcooperationsegmentscollege studentslivingcluespassmomentkilledserial killerstitle cardsdecision makingpenaltybreakpost credits scene (See All) |
Wrongfully executed 100 years earlier, brothers Thomas and Meeks Griffin rise from the grave to exact vengeance on the descendants of those responsible.
Themes: | murderrevengeracismbrutalityexecutionpolice brutality |
Locations: | farmtownthe office |
Characters: | policebest friends |
Story: | bloodylocalfuncommentaryjudgegravecouplesocial commentarycrime sceneveteransexual harassmentone daydeadharassmentblack …messagehate crimewrongful convictionlandreturnsocialwalking deadworkplacelynchingsouthdealdevelopmentvisual effectsover the topracial injusticereal lifehorror filmconvictionsit inco productionmodern daypresent dayworkplace harassmentdeath listgreat unclebody shotcharacter development (See All) |
A devout priest welcomes a struggling couple into his house at Christmas time. What begins as a simple act of kindness quickly becomes the ultimate test of faith once the sanctity of his home is jeopardized.
Subgenre: | music videoblack comedydark comedyvideopsychological horrorindie horror |
Themes: | murderdrugschristmaspregnancyinsanityfaith |
Mood: | behind the scenesnight |
Locations: | church |
Characters: | priestwriter director |
Story: | familiarhumourpremierecommentaryhousecrosscoupleholidayblack humorhomehomelessproducerfilm setdrunkplay …sodomydead mothershortsblacktestkindnessunplanned pregnancymenaceskindrinking gamegrotesquesmall castplayingcharacter drivenreal lifehorror filmbrandfirst featureantagonistscalemisfortunevisual essaystrongholiday filmwriter producer (See All) |
The Maysles brothers pay visits to Edith Bouvier Beale, nearing 80, and her daughter Edie. Reclusive, the pair live with cats and raccoons in Grey Gardens, a crumbling mansion in East Hampton. Edith is dry and quick-witted - a singer, married but later separated, a member of high society. Edie is vo …luble, dresses - as she puts it - for combat in tight ensembles that include scarves wrapped around her head. There are hints that Edie came home 24 years before to be cared for rather than to care for her mother. The women address the camera, talking over each other, moving from the present to events years before. They're odd, with flinty affection for each other. (Read More)
Subgenre: | independent filmcult film |
Themes: | filmmakingmemoryparanoiafashionregret |
Locations: | beachairplanebicycleshipocean |
Characters: | filmmakermother daughter relationshipsingerfemale protagonistartistfather |
Story: | checkeccentricinterviewtwo word titledancingphotographtitle spoken by charactersingingtelephone callsongmirrorcatcamerapaintingbook …swimmingnewspapernew yorkmansionmodelbirthday partyold womantalking to the cameraargumentbinocularsportraitamerican flagbrothercharacter says i love yougardenrecord playerbirthday cakecaketape recorderice creambreakfastfull moonguestheadphonesatticnewspaper clippingphoto albumskirtgardenerhusbandnewspaper articlelistening to radioquarrelwindmillwashing machineholemagnifying glasshandymanreclusemovie cameradelivery manold houseraccoonradio broadcastscrapbookspinsterportrait paintingphonograph recordlawnmowerbathing suitlong island new yorkalliterative titlehead scarfreminiscingbadgerwalking canehoroscopepet foodeccentricitypatiofifty somethingrecord albumchequememorabiliareference to marlene dietrichfleaseventy somethingcrackermaintenance manscalecorn on the cobdilapidated housegardnermalapropismslipperwedding photoco dependencyhamptons long island new yorkmaintenancedependencypossumsun tanningpaper cupice boxtrip down memory lane (See All) |
Late night lab technician Tina warns viewers of five tantalizing tales of terror and cautions them before watching. Little does she know a shadowy menace prowls the dark office halls, closing in on her as the witching hour fast approaches. Will she survive the night?
Subgenre: | video |
Themes: | love |
Locations: | apartment |
Characters: | singergirlin love |
Story: | humourstorieshearingfuncollectiondreamcatcamerarunningsciencehousemapanthologyflowersdark …managercouplegamedrugstealinghomefatepartnerco workerfallbuildingnoteplayworkershortsmarketmajorchangehearing voicesgamingwarningmistakefictionchoicescience fictionvideo gameclothesnoisegameradaptationyounghome alonecreepytalefansflea marketconnectiondealeronline gamingfleawraparound storyexithorror storysegmentsrangeintermissionleavingchild's playfive storiesmeltdownhorror anthologyinspirationalfeelingrarefigurelightsstrongapartment manager (See All) |
When a San Francisco exec wins a New Zealand inn, she ditches city life to remodel and flip the rustic property with help from a handsome contractor.
Subgenre: | romcomromantic comedy |
Locations: | citytownnew town |
Characters: | interracial relationship |
Story: | familiarlocalconflictfunkisscell phoneoverallspromisetensionlostheartsurpriseboyfriendnew zealandfirefighter …storeset upfallingvolunteercompanyinnnew wavehardware storerenovationchemistryworkingorderbreaking upfanscontractorbeekeepercomforttown meetingformulastore ownerfinewhite winetheatricalfinish linerealmschedulefliphappily ever afterhome designuncertain futurecity life (See All) |
When you are a filmmaker and you are not allowed to direct movies any more, you have to retrain. So why not become a taxi driver? Or better, why not pretend you are a taxi driver and make a film despite everything? This is what Jafar Panahi has done. Now he invites you to get into his cab for the pr …ice of a cinema ticket, to ride through the streets of Tehran and discover its people in the persons of his various passengers. (Read More)
Themes: | poverty |
Locations: | cartaxitaxi drivermotorcycle accident |
Characters: | filmmakerfilm directoruncle niece relationship |
Period: | 2010s |
Story: | metacinemaone word titlecamerasubjective camerafishno opening creditslong takelifebrideirancensorshipblood on faceaquarium …superstitiondirector cameohead woundlast will and testamentmetaphorfilm in filmfemale lawyergoldfishpassengertehran iranchatnieceno creditshunger strikereference to woody allensharia lawpetty theftreference to akira kurosawaracketeeringpirated dvdwater springwoman in prisonstudent project (See All) |
The roguishly charming and endlessly troublesome Fletch becomes the prime suspect in a murder case while searching for a stolen art collection. The only way to prove his innocence? Find out which of the long list of suspects is the culprit - from the eccentric art dealer and a missing playboy to a c …razy neighbor and Fletch’s Italian girlfriend. (Read More)
Subgenre: | murder mysteryfamily drama |
Themes: | artmurderinvestigationdrug use |
Mood: | murder case |
Characters: | girlfriend |
Period: | 21st century |
Story: | funcollectionchaoseccentricsex scenedead bodyneighborreporterdrugseriessurprisesuspectplaydeadbody …strandedlanguagemissingmurder suspectensembleinvestigative reporterfranchisesexualart dealerrebootfeature filmplayingart collectionprime suspectstolen paintingpresentsstolenbehind the camerahot waterstolen artjokesremainsstraight manleading manslam dunk (See All) |
A celebrated author takes a journey with some old friends to have some fun and heal old wounds. Her nephew comes along to wrangle the ladies and finds himself involved with a young literary agent.
Subgenre: | comedy of errors |
Themes: | friendshipfilmmakinghopefreedomwriting |
Mood: | night |
Locations: | shipocean |
Characters: | writeraunt nephew relationship |
Story: | questionstalkreasonfuncollectionsequelbookdrawingjourneyauthorexerciseagentlandscapeplot twistaward …playlighttripjoyauntset upsuccessdoubtlate nightfemale friendshiplanguagechangeflyworkshopconversationvehiclewalkingcruise shiphandyoung mancinematographerignorancespringeyesblogcruisevoiceyoungnephewworkinghitstudywinningocean linerpseudonymsupportworryingplayingclichehandsold friendscareknowledgecraftliterary agentrideshallowfamousreal lifetraditionalfilmmakersexpectationliteraryboardexperienceorbitretailfamous authorhouseholddeepadvocateconversationsmeaningdissatisfactiondeckcraftsmanshipolder womenrareanother worldhang outocean crossingthree people (See All) |
An ensemble cast telling 10 stories with intertwining characters. One story is about a father and son who are dating the same woman . Another features a woman who long ago gave her baby up for adoption but is now being blackmailed by a documentary filmmaker who claims to know the now-grown child's w …hereabouts. (Read More)
Subgenre: | documentary filmmaking |
Themes: | deathfriendshipmarriageinfidelityadulterypregnancydrinkingfilmmakingseductionextramarital affairdeath of motherdrug useunfaithfulnesssurveillancehomophobia …adoptiondeath of wifeabortion (See All) |
Locations: | hospitalrestaurantswimming poollos angeles californiamotel |
Characters: | filmmakerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipteenagerfriendboyfriend girlfriend relationshipdoctorsingerbrother brother relationshipbrother sister relationshipteenage girldancer …musicianbabyjewishinterracial relationshipcatholicolder man younger woman relationshipcousin cousin relationshipex husband ex wife relationshipuncle nephew relationshipgay teenagergay relationshiplesbian relationshipgay fatherboyfriend boyfriend relationshiplesbian motherstepbrother stepsister relationshipstepmother stepson relationshipbaby boyhomosexual kiss (See All) |
Period: | year 1983 |
Story: | storiesinterviewsexfemale nuditybloodflashbackmasturbationdogtwo word titlegunkisscigarette smokingdancing …nipplesphotographtitle spoken by charactersinginglesbian kisserectiontelephone callcell phonesongwoman on topunderwearcar accidenturinationface slappunched in the facecomputerdrinkundressingliebeerrunningbirthdaycafemarijuanabandvideo cameramontageimmigranthit by a carnecklacemicrophonevirgincoming outmassagemanipulationcrosssplit screenobscene finger gesturegay coupleteenage sexpizzabirthday cakecloseted homosexualshavingwhat happened to epiloguebreaking and enteringloss of virginityarchitectgay parentswimsuitcrushstupidityrear entry sexcynicismkaraokedrummerensemble castlesbian couplegay sonwedding ringillegal immigrantphoto albumvideo tapeteenage pregnancymultiple storylinebongevictionepisodic structuretombstonegay crushpopcornmasseuseadopted sonplaying a video gamednaepilogueunplanned pregnancyscholarshipmarriage engagementartificial inseminationsex workerunwanted pregnancyhappy birthday to yougay man has sex with a womansperm donorinner title cardphoenix arizonabiological fatherblowing out candleheadstoneman dancing with manbirth mothergay porncounsellormexican immigrantabortion clinicbiological mothergreen cardfather and son have sex with the same womansterilitygolddiggerfilm editinggay man impregnates womanstoryboardprenuptial agreementvasectomyafiincurable diseasesexual innuendo in titleurologistwest highland white terrierreference to kentucky fried chickentivoeating cerealpool houseinherited disease (See All) |
Subgenre: | experimental film |
Themes: | surrealism |
Mood: | avant garde |
Characters: | filmmaker |
Story: | cinemaf ratedtitle directed by femaleanthologycult directormovie theatrelong titlehomagecollection of short filmsdirected by several directorsportmanteauhommagemultiple directorsauteur filmmaker |
Set over the course of a weekend tournament for chess software programmers thirty-some years ago, Computer Chess transports viewers to a nostalgic moment when the contest between technology and the human spirit seemed a little more up for grabs. We get to know the eccentric geniuses possessed of the … vision to teach a metal box to defeat man, literally, at his own game, laying the groundwork for artificial intelligence as we know it and will come to know it in the future. (Read More)
Themes: | moneydrinkingtechnology |
Locations: | barhotel |
Characters: | husband wife relationshipmother son relationshipafrican americancomputer dating |
Period: | future1980s |
Story: | eccentricrecordingfemale nudityfemale frontal nuditytwo word titlemirrorcomputercatdrinksubjective cameraold womanhotel roommicrophonescene during end creditssplit screen …black americanrecord playerchesseyeglassesnerdapplauselooking at oneself in a mirrorexistentialismtrophyhandshakebreadcrowncameramanfilm cameraknocking on a doorlsdawkwardnessallergygurupentagonconferenceblack and white segues into colorgraduate studentcomputer programmerman versus machinereference to benjamin franklinreference to napoleon bonapartemassachusetts institute of technologychess tournamentpanel discussionoverhead projectorcomputer chessalgorithmencounter group (See All) |
The Cardiff club scene in the 90's: five best friends deal with their relationships and their personal demons during a weekend. Jip calls himself a sexual paranoid, afraid he's impotent. Lulu, Jip's mate, doesn't find much to fancy in men. Nina hates her job at a fast food joint, and her man, Koop, …who dreams of being a great hip-hop d.j., is prone to fits of un-provoked jealousy. The fifth is Moff, whose family is down on his behavior. Starting Friday afternoon, with preparations for clubbing, we follow the five from Ecstacy-induced fun through a booze-laden come-down early Saturday morning followed by the weekend's aftermath. It's breakthrough time for at least three of them. (Read More)
Subgenre: | independent filmstand up comedyteen movieurban comedy |
Themes: | lovefriendshipdrugsjealousydrinkingdrunkennessparanoiadrug useunemployment |
Mood: | hip hop |
Locations: | barnightclubbicyclerooftop |
Characters: | father son relationshipmother son relationshipfriendboyfriend girlfriend relationshipsingerbrother sister relationshipteenage girlprostituteteenage boydancercomedianemployer employee relationshipuncle nephew relationshipuncle niece relationshipparty girl …party boy (See All) |
Period: | 1990s |
Story: | funchaosrecordinginterviewsexfemale nuditymale nuditymasturbationkissdancingsingingpartyerection …telephone callvoice over narrationsongunderwearwatching tvdrinkbeermarijuanabathroomprostitutionhallucinationcocainehousenonlinear timelinetalking to the cameratwinpubheroinrecord playertwenty somethingriotpot smokingdiscowarehouselistening to musicdrug dealingremote controlrap musicfamily dinnerdjmarijuana jointimpotencephone sexamsterdam netherlandsdance clubravewaleshouse partyweekenddecadencestresscrack cocaineopiumcocaine snortinghedonismfast food restauranttechno musictrancedrug triprecord storevinylparliamentgeneration xmethamphetaminehashishmayhemclubbingbreakdancingdance musicpartyingnational anthemriot policedrug pusherwelshmultiple narratorsecstasy the drughouse musicrave partyfriendship between teensamphetaminetrance musicbritish youthclub djreference to mcdonald's restaurantscratchinghallucinogenic drugacid the drugrave culturereference to jerry springerfridayclub musichardcore musicexcessravertechno ravecardiff walesdrum'n'basshedonistclubberparty lifestylestreet partyspeed the drugclubweartrainspottinghard house musicrowdiness (See All) |
Wei Chenggong, a working actor with big dreams, finally appears to get his big break when actress Milan invites him to play the lead role of "Killer Karl" in a new play. Little does Wei Chenggong know, he has fallen into a perilous conspiracy where all the villains are real, and only through his act …ing skills and good deal of luck will he be able to make it out alive. (Read More)
Subgenre: | conspiracyvideoslapstick |
Themes: | lovedrinkinggangsterfilmmaking |
Mood: | behind the scenes |
Characters: | hitmanwriter directorlove letter |
Story: | humourfunchecktrackrunremakelettergiftsistergamemobsterhomepuzzlerealityculture …drunkplayposterstudiohomagesubtitleswallluckhome videosiblingrecordeyespooraspiring actordealvintagedrinking gameworkingwardrobedreamsimprovisedhiddentaskvisualcarsproduction designstringopportunityforeigntransferconclusionfinancingbad actorclipsphysicalalivebig breakgagsideabreaklightsthe wallbig dreams (See All) |
A survivor in an Apocalyptic world tells stories leading to the end of the world.
Subgenre: | post apocalyptic |
Themes: | traveltime travelapocalypse |
Mood: | apocalyptic |
Locations: | country |
Characters: | pregnantpregnant wife |
Story: | familiarstoriescheckviolencefoodbombscientistreadingbankpresidentsisterinjuryvirusplanetfate …dead womanserieslostlonerinsultdeadenergywifefighternotebookshortsnarratorgascleaningholeorganfairshelterpoorfathumanityinformationmayhemnumberbomb shelterorder666scavengermotivationtaskmankindservicegruesomeback in timesystemsegmentsthoughtlivingdigprimitivesharingconvictionpopulationrantingtouchimmune systemsavechroniclesideaconditioningprotectstrongthemecleaning service (See All) |
In darkest corners of the darknet, there are places where victims are held captive, psychologically tortured, live-streamed, then given a chance to escape if they confess their worst sins, preserving them online for eternity in Red Rooms.
Subgenre: | videocomputer animationpsychological |
Themes: | tortureescapenatureevil |
Mood: | web series |
Characters: | priesthitmanwriter directorformer priest |
Story: | familiarquestionsbloodyruncomputerrunningisolationgeneralexperimentgamecaptiveserieslostproducerfrustration …meetingepisodicheld captiveinternationalsittingweblocationworkinghitconnectionfleshunknownrulesleavesexperienceanswercreditseasonvideo conferencingepisodemethoddiebreakingvirtualthemepost production (See All) |
When a chauvinist millionaire buys the television network where the sexy Elvira is the horror hostess of a late show, she quits her job with the intention of producing her own show in Las Vegas. However, the producers demand 50 thousand dollars from her and Elvira does not have the money. Out of the … blue, she receives a telegram informing that her great-aunt Morgana died and she has an inheritance to receive. Elvira drives to the uptight town of Fallwell, Massachusetts, where her convertible breaks down. While repairing her convertible, Elvira inherits an archaic mansion, a recipe book and a poodle. Her great-uncle Vincent Talbot proposes to buy her book, but the poodle hides it in the sofa. Meanwhile, the conservative council of Fallwell feels uncomfortable with Elvira's clothes and behavior and does not let her find a job. But cinema owner Bob Redding and the local teenagers help Elvira. When she decides to cook a dinner to impress Bob, she uses Morgana's recipe and finds that it is indeed a spell book that belonged to her mother Divana. Further, Morgana has protected her from the warlock Vincent that wants the book to take over the world and destroy Elvira, who is a powerful witch. When Elvira refuses to sell the spell book to Vincent, he convinces the council that she is a witch that must be burned at the stake. How will Elvira stop the evil warlock Vincent? (Read More)
Subgenre: | independent filmcult filmb moviehorror spoof |
Themes: | jealousymonstermagicinheritancebook of magic |
Mood: | spoofbreaking the fourth wall |
Locations: | small towngas station |
Characters: | female protagonistwitchuncle niece relationship |
Story: | familiarlocalcinemacharacter name in titledogexplosionfirejailgood versus evilcleavagecookinggraveyardduelstripteaseactor playing multiple roles …las vegas nevadalove interestcorrupt cophenchmanwitchcraftmovie theaterrebelsevered handbar fightmoralitythugpet dogpsychotronicstabbed in the headsexual humorhorror hostmassachusettssexual repressionlynchingfemale horror hostmoney falling through the airshowgirlgas station attendantpoodlesecret doorhostesswarlockcouncildisembodied handdobermanburned at the staketheme songlove potionconservative moralsmagical ringzealotdrug referencecorrupt priestold mansioncamp humourlast willlunar eclipsebreathing firemob ruletar and featherstied to a stakewitch burningacid in facemob sceneevil unclewhite ratquipgreat unclecelebrity playing herselfnipslipburlesque showlow cut dresssentient hand (See All) |