Please wait - finding best movies...
Police commissioner Funes and three researchers of supernatural phenomena investigate inexplicable events that are occurring in the suburbs of Buenos Aires.
| Subgenre: | paranormal investigationparanormalsupernatural |
| Themes: | evildeath |
| Mood: | movingnight |
| Locations: | kitchen |
| Characters: | old friendvampirepolice officerboyfriendpolice |
| Story: | kitchen sinkmoving onparanormal investigatordinner tableunder the bedhaunted housereanimated corpselatin american horrorhorror moviepassive protagonistfear mongeringbuenos airesout of focusstateweird …explanationsuburbiapolice commissionerfeature filmfreak accidentsinkexpertfungrindhouse filmpsychotronic filmmind readingtraffic accidenthearing voicesinsane asylumlanguagedead childargentinacrime scenepresumed deadhomestreetsuburbpoint of viewdinnerhousebathroombedwritten by directorcorpseshowerone word titlebloodviolence (See All) |
A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.
| Subgenre: | paranormal investigationcult film |
| Themes: | ghostvoyeurismsupernatural powerdysfunctional familyafterlifemissing childscience versus supernatural |
| Mood: | moving |
| Locations: | kitchenswimming poolcemetery |
| Characters: | boyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteenage girlgirlphotographersister sister relationshiplittle girllittle boyemployer employee relationship …blonde girl (See All) |
| Period: | 1980s |
| Story: | paranormal investigatorhaunted househomesuburbhousecorpseone word titleinterviewpantiesmirrorblondewatching tvcameralingeriemarijuana …neighborhallucinationvoyeurtelevisiongood versus evilcleavagevideo camerawhite pantiesscantily clad femalecoffinchild in perilclownfirst of seriesskeletonhauntingfirst partobscene finger gesturecult directorpsychicgirl in pantiespot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieverlifting a female into the airsource musicanimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All) |
In Japan, when the volunteer social assistant Rika Nishina is assigned to visit a family, she is cursed and chased by two revengeful fiends: Kayako, a woman brutally murdered by her husband and her son Toshio. Each person that lives in or visits the haunted house is murdered or disappears.
| Subgenre: | supernaturaljapanese horror filmsupernatural horrorasian horror |
| Themes: | deathmurdersuicidemarriageghostfearangersupernatural powerparanoiasadismcrueltypanictraumamurder investigationmurder of a police officer …missing childmysterious deathpsychological trauma (See All) |
| Mood: | goredarknessmurder suicide |
| Locations: | hospitalrestaurantschoolelevatorwheelchair |
| Characters: | police officerboypolicemother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteacherpolice detectiveghost girlmysterious girlghost in mirrorghost boy |
| Story: | haunted househomehousebedcorpseshowerbloodflashbackphotographremakewatching tvcatbedroomnonlinear timelinebrunette …searchold womanpainscreamingpossessionthreatsuspicionfirst partarsonmass murderragemutilationdesperationvisitteddy beardead womansufferingsonstairsatticgasolinesocial workerpsychoticvideo surveillanceclosetdark secretlong hairstairwayevil spiritrestroomblood stainpremonitionwrathmysterious womanmultiple murderchapter headingstenantblack catcrime investigationhusband murders wifemurder victimdeeply disturbed personmultiple homicideghost childremadehorror movie remadecatatoniamystery womansakewraithfear of ghostsretired copwoman journalisthomicidalhome care (See All) |
When frightening events start to occur in their home, young couple Kelly and Ben discover they are being haunted by a presence that was accidentally conjured during a university parapsychology experiment. The horrifying apparition feeds on their fear and torments them no matter where they try to run …. Their last hope is an expert in the supernatural, but even with his help they may already be too late to save themselves from this terrifying force. (Read More)
| Subgenre: | paranormalsupernaturalsuspenseparanormal phenomena |
| Themes: | surrealismsuicideghostfearescapeparanoiaredemptionsurveillancenear death experienceregret |
| Locations: | kitchenhotel |
| Characters: | father daughter relationshipboyfriend girlfriend relationshipsecurity guard |
| Period: | 1970s2010syear 1973 |
| Story: | haunted houseexperthomepoint of viewbathroomwritten by directorcorpseshowerfemale nuditydogtwo word titlebare chested malesurprise endingvoice over narrationcell phone …rescuebeerneighbordemonscientistsubjective camerasurvivalflashlightcaliforniano opening creditsflash forwardattackcharacter's point of view camera shotproduct placementtentbaseball batcollege studentdisappearancelaptophauntingdirectorial debutgaragefreeze framepickup truckexperimentrevelationelectronic music scorelooking at oneself in a mirrorsecurity cameravandalismloss of loved onehaunted by the pasttensionsurveillance cameraresearchpower outageaerial shote maillanternneighborhooddead dogenglishman abroadsuffocationelectricitygardeningveterinariandead animalseanceevil spiritportalfish tankcameramanfilm starts with textwarningcactuswoman in lingerieexperiment gone wrongcamcorderwashing machineoverhead camera shottragic endingwoman undressingfood fightfemale in a showerentityvideo recordingstartledheadsettroubled productionout of body experiencefigurinesleeping on a sofamalfunctionlovecraftianpainting toenailscrawlspaceall terrain vehicleamplifierhousing developmentlocking a doorgas lampstepladderhome aquariumparapsychologistbreak door innachocrawl spacewashing laundrychevrolet pickup truckelectrical towerfaraday cagewarehouse storevideo file (See All) |
Legendary filmmaker 'Sam Raimi' (qv) and director 'Gil Kenan (I)' (qv) reimagine and contemporize the classic tale about a family whose suburban home is invaded by angry spirits. When the terrifying apparitions escalate their attacks and take the youngest daughter, the family must come together to r …escue her. (Read More)
| Subgenre: | paranormal investigationparanormalsupernaturalparanormal activity |
| Themes: | ghostabductionunemployment |
| Mood: | movinghorror movie remake |
| Locations: | cemeterybaseball |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteenage girlex husband ex wife relationship |
| Period: | 2010s |
| Story: | paranormal investigatorhaunted househomesuburbcorpseone word titletitle spoken by charactersurprise endingcell phoneremakehallucinationtelevisionno opening creditschild in periltree …character repeating someone else's dialogueclowndebtskeletonscene during end creditsuniversityscarhauntingspirit3 dimensionalthunderstormatticcellphoneman cryingsunsetclosetdinner partystuffed animalwoman cryingportaldronereality showsquirrelaltered version of studio logooverturning carrealtorcar rolloverevil clownpoltergeistfinancial crisiscaged animaltv hostnew houseghost hunterpower drillman undressingextreme closeupearthwormparanormal phenomenonanimate treehandprintvideo conferencingstuckpinwheelparapsychologistcredit card declinedhole in a wallstatic electricitysecurity alarmlifelinepsychic investigatorbig screen televisionheat sensorclown dollscared child (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo …od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
| Subgenre: | ghost storyparanormal activity |
| Themes: | evildeathmurderfriendshipsuicidereligionghostpregnancyweddinginvestigationpsychopathsupernatural powerhome invasioncrueltytrauma …self sacrificedevilpolice investigationnear death experience (See All) |
| Mood: | movingnightdarkness |
| Locations: | kitchenhospitalchurchelevatorapartmentcatholic churchkitchen knifekitchen fire |
| Characters: | friendpolicehusband wife relationshipafrican americandoctorfemale protagonistnursedetectivepolicemanbabypriestchristianreference to godlittle girlkiller …christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
| Period: | 1970syear 1969year 1970 |
| Story: | haunted housepsychotronic filmtraffic accidenthearing voiceshomeone word titlebloodviolencef ratedcharacter name in titleflashbackfightphotographtitle spoken by characterknife …chasebased on true storytelephone callfirecryingshot to deathblood splattershot in the chestslow motion scenepunched in the facewatching tvcamerashootingbookneighbordemonhallucinationreference to jesus christgood versus evilfoot chaseflashlightname in titlestabbingthroat slittingsuicide attemptnonlinear timelinecultnunno opening creditsdrawingchild in perilritualnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollbaseball batscreamscargiftbasementsacrificegraffitiblood spattercouplerecord playeroccultspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisittaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomfilm starts with textlistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflamemysterious womanbechdel test passedsymboltraumatic experiencereference to john waynedeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
For young Charley Brewster, nothing could be better than an old horror movie late at night. Two men move in next door, and for Charley with his horror movie experience, there can be no doubt that their strange behavior is explained by the fact that they are a vampire and his undead day guardian. The … only one who can help him hunt them down is a washed-up actor, Peter Vincent, who hosts Charley's favorite TV show, Fright Night. Vincent doesn't really believe that vampires exist, but does it for the money... (Read More)
| Subgenre: | cult filmpost modernstop motion animationteen movieteen horrorhorror spooflgbt horrorvampire comedy |
| Themes: | deathherovoyeurismseductionsupernatural powerfaithpolice investigation |
| Mood: | nightgorespoof |
| Locations: | small townnightclub |
| Characters: | vampirepolicemother son relationshipteenagerboyfriend girlfriend relationshipteenage boyserial killerdetectivepolicemanactorsingle mothervillaingirlfriendparent child relationshipneighbor neighbor relationship |
| Period: | 1980s |
| Story: | horror moviegrindhouse filmpsychotronic filmsuburbhousewritten by directorviolencebloodfemale nuditynuditymale nuditymale rear nuditytwo word titlebare chested malegun …title spoken by characterchasesurprise endingpistoltopless female nudityshot to deathmirrorshot in the chestpunched in the facewatching tvundressingfalling from heightpaintingheld at gunpointneighborvoyeurgood versus eviltoplessimpalementstabbed in the chestsevered headcoffinnews reporttransformationshot in the foreheadbinocularsvirginskeletonscarhigh school studentstalkingcrossexploding bodywitnessbasementcharacter says i love youfirst partundeadwerewolffalling down stairswolfburned alivelifting someone into the aircrucifixhunterteenage protagonistwoman in jeopardyreverse footagehypnosisjumping through a windowfriendship between boysdead boylevitationstabbed in the handhorror hostmale friendshipcamera shot of bare feetbroken mirrorkiss on the lipsrhyme in titlebitten in the necksuper powerbra removingbloody violencevampirismhomosexual subtextvampire hunterblack copghoullifting person in airglowing eyesholy watervampire slayerjumping out a windowtv hostthroat rippingolder man young girl relationshiphand injurystakelifted by the throatnext door neighborgarlichowlingsunlightnew neighbortv starremadewashed up starstabbed in the heartshort haired femalevampire bitehorror movie remadered eyesthreatening telephone calldead body in a car trunkteenage sonpointing a gun on someonevampire batseductive manboyfriend girlfriend conflictreflection in a mirrorgrabbed by the throatstabbed with a pencilfanboyeviction noticeusa horror hosttv personalitymale vampireseductive dancereflection in mirrormelting manbat attackreference to bela lugositeenager in dangerhuman versus vampirestake through the heartno reflectionvampire driving a carthrown across a roomtruth taken as a liereference to christopher leenosy motherpunch catch (See All) |
Jonathan Harker is sent away to Count Dracula's castle to sell him a house in Wismar where Jonathan lives. But Count Dracula is a vampire, an undead ghoul living off of men's blood. Inspired by a photograph of Lucy Harker, Jonathan's wife, Dracula moves to Wismar, bringing with him death and plague. ….. An unusually contemplative version of Dracula, in which the vampire bears the curse of not being able to get old and die. (Read More)
| Subgenre: | cult filmgothic horror |
| Themes: | evildeathsurrealismmarriagefearlonelinessdepressioninsanityillnessamnesiaself sacrifice |
| Mood: | nightmarehorror movie remake |
| Locations: | hospitalbeachcemeterysmall townvillageseashipcastlegermanytown |
| Characters: | vampirehusband wife relationshipdoctorlustemployer employee relationship |
| Period: | 19th century |
| Story: | psychotronic filminsane asylumdinnerhousebedcorpsebloodbased on novelknifesurprise endinghorsemirrorremakecatarrest …falling from heightbookdead bodyvoyeurmansionwomannuncoffinforeign language adaptationjourneynecklacecurseevil mandiarycrosshorse ridingpigratcaptaininjuryagenthammervisitsheepviolinclockwoman in jeopardygypsyimmortalitysuperstitionshadowexistentialismhorse and carriagemelancholyviolinistbatcontractreflectionreal estate agentharbordraculaplaguereal estatemarried couplekittensunrisefeverinnsleepwalkingescaped mental patientbitebaldnessfuneral processionblood drinkingtransylvaniadrinking bloodstakemaster servant relationshipbusiness tripnew neighborruinvampire biteriding a horsebaltic seanew german cinemacity councilblack seagerman expressionismestate agentgypsiespsychic linktown squarenosferatuwatching through a windowevil spellpallbearerpeststraitjacketlong fingernailssucking bloodmultiple language versionpointy earssigning a contractbiting someone's necksleeping in a coffin (See All) |
In 1977, paranormal investigators Ed and Lorraine Warren travel to London, England, where single mother Peggy Hodgson believes that something evil is in her home. When Peggy's youngest daughter starts showing signs of demonic possession, Ed and Lorraine attempt to help the besieged girl, only to fin …d themselves targeted by the malicious spirits. (Read More)
| Subgenre: | paranormal investigationparanormalsupernaturalparanormal phenomenaparanormal activity |
| Themes: | evillovechristmasghostfeardeception |
| Locations: | london englandengland |
| Characters: | husband wife relationshipteenage girlpriestlittle girlsingle mothercatholicterror |
| Period: | 1970syear 2003year 1976 |
| Story: | paranormal investigatorhaunted househomehousesequelinterviewbased on true storyshot to deathpaintingsecond partdemonaxenunno opening creditschild in peril …transformationscreamingpossessiontentchristmas treescreamcrossbasementhauntingpsychicrecord playertape recorderrecordingtied to a bedcrucifixnosebleedwatching televisionarchival footagethunderstormchairdemonic possessionteleportationreference to elvis presleynarrated by characterlevitationseancebroken windowcatholicismpremonitionsoccer ballouija boardwoman smokerphonographends with biographical notesstarts with narrationrosaryjumping out a windowsing alongarchival photographscreaming in fearfalse teethmale singerjumping ropebreaking down a doorbased on supposedly true storyvideo recordingstutterconvulsiontalking to the deadspeech impedimentdriving in the rainswing setjump scareskepticdenturespsychokinesisvoice recordingsprayed with watercrucifix pendantbite markfalling out of bedblurry visionhiding under the coverslocked in jailwoman screamingbegins with historical notesrosary beadsspecterhavocstuttering charactertelevision statictoy truckchild shot in the backparanormal experthyperventilatingbrick thrown through a windowdownpourflooded basementupside down crossamityvillesitting on a swingzoetropepulled underwaterspeaking in another voiceupside down crucifixflickering lightstalkshow (See All) |
Michael King (Shane Johnson) doesn't believe in God or the Devil. Following the sudden death of his wife, Michael decides to make his next film about the search for the existence of the supernatural, making himself the center of the experiment - allowing demonologists, necromancers, and various prac …titioners of the occult to try the deepest and darkest spells and rituals they can find on him - in the hopes that when they fail, he'll once and for all have proof that religion, spiritualism, and the paranormal are nothing more than myth. But something does happen. An evil and horrifying force has taken over Michael King. And it will not let him go. (Read More)
| Subgenre: | paranormalsupernaturalmockumentarytragedyfound footagefake documentaryparanormal activity |
| Themes: | evildeathmurderlovesuicidefearvoyeurismangerbrutalitysupernatural powerdrug usegriefsadismcrueltydeath of wife …panicdevilsupernatural being (See All) |
| Mood: | gorenightmaredarknessaffectionblood and gore |
| Locations: | carcemetery |
| Characters: | friendhusband wife relationshipfather daughter relationshipbrother sister relationshipgirlpriestpsychiatristdaughterfathertalking to oneself in a mirrorself destructionout of controlself injury |
| Story: | hearing voiceshomehousebathroombedviolencebloodcharacter name in titleknifepantiesfirefondlingunderwearblood splattermirror …computercameraundressingbookdemonhandcuffsbedroomvideo camerastabbingdeath of friendstabbed to deathsuicide attemptaccidentchildchild in perilritualgraveyardlooking at the cameratalking to the camerapaindangerscreamingpossessionangelscreamthreatdarkbrothersacrificepsychickillingsisteroccultdestructiondruginjuryrageloss of friendloss of wifedesperationhomicidemale underwearrampagepillssufferingboxer shortsblood on facebroken glassfalling to deathstairsblood on shirthandheld cameraperversiondemonic possessionliving roomroomblack magiccoindead dogtombstabbed in the handstaircaseadvicebroken windowsatanisminsomnialsdpiercingnihilismfall from heightglassantwrathhypnotismmediumwarningreading a bookseizurefuneral homemurder attemptdecadencefrightmenacetormentknife murderrisksleeplessnesswatching a videoanguishangstpentagrambroken neckincestuous desirenoiseloss of controlvoicejumping out a windowscreaming in feardigital cameraskepticismmausoleumsleeping pillssatanic ritualdeath of dogconvulsionperilsatanistdemonicpaganismscreaming in horrorscreenchild in dangerevil forcehandcuffed to a bedfurypsychological tormentskepticdistorted voiceforces of eviljeopardymysterious noiseantsbroken glassesstaticreflection in a mirrorinsomniacoccultismpossessed manrun overevil beingnecromancermysterious voicediabolicalnecromancydemonic voiceburning bookcar run overpagan ritualfight with selfforce of evilnoisesbottle of pillssleeplesstelevision screenignoring advicedemonologyphysical tormentbroken camerajump from heightblack bookdemonic forceignoring warning (See All) |
Beneath the fake blood and cheap masks of countless haunted house attractions across the country, there are whispers of truly terrifying alternatives. Looking to find an authentic, blood-curdling good fright for Halloween, five friends set off on a road trip in an RV to track down these underground …Haunts. Just when their search seems to reach a dead end, strange and disturbing things start happening and it becomes clear that the Haunt has come to them... (Read More)
| Subgenre: | mockumentaryfound footagefake documentary |
| Themes: | evildeathfeartravelpaniccamping |
| Mood: | nightdarkness |
| Locations: | barroad tripcampfiretexas |
| Story: | haunted househousebathroomwritten by directorviolencebloodbare chested maleknifecameramasklow budget filmsubjective camerahalloweenvideo cameramap …looking at the cameratalking to the cameracursedangercostumescreamingclownscreamactor shares first name with characterhalloween costumedarkhauntingsleepinggroup of friendsmale underwearnew orleans louisianahandheld camerapumpkintripalleyburied alivenewscastfrightrecreational vehicleroadinvitationscaremonth in titlebegins with textscreaming in feardigital camerahaunted house attractionobscurityscreaming in horrorhands tied behind backhand camerapaintball gunmysterious noiseclown maskhalloween masklocked in a car trunkhauntmechanical bullrunning in the darkchaos in the darkbaton rouge louisianalights turned offscary clownhalloween nighthooded victimglowsticktyler texas (See All) |
A couple of college students known only as the Girl and the Guy are traveling home to Delaware the day before Christmas Eve. They're on a frozen road that the Guy is convinced is a scenic short-cut. In the middle of nowhere in below freezing conditions they are run off the road by a hit and runner. …They soon realize they're caught in a supernatural bubble where a crime from 1953 is doomed to repeat itself, year after year threatening new victims. The Guy attempts to walk back to the last petrol station but his wounds from the crash are worse than he let on. (Read More)
| Subgenre: | supernaturalindependent filmsuspenseparanormal phenomenaghost storyteen horrorholiday horror |
| Themes: | deathmurdersurrealismkidnappingchristmasbetrayalghostfearescapedeceptionobsessionsupernatural powerparanoiaunrequited loveabduction …panicpolice brutalitynear death experiencesupernatural being (See All) |
| Mood: | nightnightmaredarknessatmosphere |
| Locations: | forestcarsnowwoodspolice carroad tripgas stationroad moviepennsylvaniafire truckcar fire |
| Characters: | police officerzombiepriesthostageterrordriver |
| Period: | 2000s1950swinter20th century21st century |
| Story: | reanimated corpsepsychotronic filmhearing voiceshomebathroomcorpsebloodviolenceflashbacktwo word titlekissphotographtitle spoken by charactersurprise endingfire …cell phonedreamcar accidenturinationrescueslow motion scenearrestcar crashhandcuffstelephonesurvivalflashlightambulancedinerdrivingdouble crossgraveyardracial slurstalkerdangerscreamingon the roadrace against timecollege studentuniversitylong takedisappearanceisolationsuspicionnewspaper headlineredheadcorrupt copholidaypickup truckiceburned alivegothiclifting someone into the aircowboy hatloss of friendstrangercrushredneckbarefoottensionescape attemptracisthighwayduct tapeethnic slurburned to deathnewspaper clippingsouthern accenttext messaginghit and runcar troubleapparitionminimal castold dark houseevil spiritcrashroad accidentn wordseizureshockmacabrecollege campuscar radiocar breakdownfeettextingcamera phonememorialspitting bloodcoldroadcar rolloverlifting person in airtruck stopremotehand injurynail polishvisionsfreezingcold weatherpublic restroomburning carschool classstate troopertire ironnameless characterfreeze to deathmistrustfrostbitevengeful ghosthighway patrolhorror filmravineyear 1953pedicurefrozen alivesurvivingfreezing to deathsnowplowtoesdead familyrigor mortisracist copoldsmobileurinating on groundevil copnamepsycho copghostly figurebulletin boardtelephone polejammed doorride shareroadside memorialbritish actress playing american characterbag of groceriesmad copmaniac cop (See All) |
Lance Preston and the crew of "Grave Encounters", a ghost-hunting reality television show, are shooting an episode inside the abandoned Collingwood Psychiatric Hospital, where unexplained phenomena have been reported for years. All in the name of good television, they voluntarily lock themselves ins …ide the building for the night and begin a paranormal investigation, capturing everything on camera. They quickly realize that the building is more than just haunted - it is alive - and it has no intention of ever letting them leave. They find themselves lost in a labyrinth maze of endless hallways and corridors, terrorized by the ghosts of the former patients. They soon begin to question their own sanity, slipping deeper and deeper into the depths of madness, ultimately discovering the truth behind the hospital's dark past...and taping what turns out to be their final episode. (Read More)
| Subgenre: | paranormal investigationparanormalcult filmmockumentaryfound footagefake documentaryparanormal phenomenaghost hunting |
| Themes: | ghostsupernatural powerinsanity |
| Mood: | night |
| Locations: | bathtubwheelchairtunnel |
| Story: | paranormal investigatorhaunted houseblooddemonsubjective cameraflashlightvideo cameralooking at the cameratalking to the camerascreamingcharacter's point of view camera shotratfirst partladdermale underwear …blood on facemental hospitalfoghandheld cameradead manbriefscharacters killed one by oneman cryingabandoned buildingblood on camera lenswoman cryingnight visionreality showwhite briefsfictional reality showelevator shaftlabyrinthtv hostscreaming in fearghost hunterbreaking down a doorhospital gownsevered tonguedemonicscreaming in horrormanic laughtervomiting bloodblood vomitingabandoned hospitalevpfalling down an elevator shaftdemonic spiritelectronic voice phenomenagoing in circlesbloody scratchparanormal investigation teamhospital bracelet (See All) |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
| Subgenre: | paranormalindependent filmmockumentaryfound footagefake documentary |
| Themes: | murderfearsupernatural powerpanic |
| Mood: | nightnightmaredarkness |
| Locations: | kitchenswimming pool |
| Characters: | boyfriend girlfriend relationshipself mutilationself absorption |
| Period: | 2000syear 2006 |
| Story: | haunted housesuburbhousewritten by directorbloodinterviewtwo word titlebare chested malephotographknifesurprise endingfirecomputercameralow budget film …demonguitarf wordsubjective camerabedroomvideo camerano opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguemicrophonescreamingfirst of seriescollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst partsevered armobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterladdermale underwearbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerdemonic possessionexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All) |
For nineteen-year-old Jay, Autumn should be about school, boys and week-ends out at the lake. But after a seemingly innocent sexual encounter, she finds herself plagued by strange visions and the inescapable sense that someone, something, is following her. Faced with this burden, Jay and her friends … must find a way to escape the horrors, that seem to be only a few steps behind. (Read More)
| Subgenre: | supernaturalcult filmsupernatural horrorcult horror |
| Themes: | evildeathmurderfriendshipghostfearinvestigationvoyeurismsupernatural powerparanoiapanicsupernatural beingsupernatural rape |
| Mood: | rainhigh schoolambiguous ending |
| Locations: | hospitalbeachschoolswimming poolforestcarboatbicyclewaterwheelchairpolice carlakesex in carsex in hospital |
| Characters: | friendteenagerteenage girlprostituteteenage boyfemale protagonistsister sister relationshipneighbor neighbor relationshipsex with a strangersupernatural killer |
| Story: | horror moviegrindhouse filmpsychotronic filmsuburbhousebathroomwritten by directorcorpseviolencebloodsexbare breastsfemale frontal nuditymale frontal nuditymale rear nudity …two word titlebare chested malesex scenekissfemale rear nudityphotographmale full frontal nuditychasepantiespistoltopless female nudityshot to deathblood splatterurinationshot in the headwatching tvbikinibookcar crashlow budget filmcafeneighbordemonvoyeurclassroommale pubic hairf wordsubjective camerafoot chasebedroomflashlightbanddeath of friendtied to a chairwhite pantiesunderwater scenesearchshot in the legold womanpublic nuditycursedangerelectrocutionknocked outcollege studentlightningstalkingautomobilethreatdatelove interestteenage sexcard gamegameelectronic music scorelooking at oneself in a mirrorsexual attractiongroup of friendsmovie theaterpooldesperationflatulenceswimsuitstrangervictimteenage protagonistpeeping tombroken leggirl with glassesvisiontarget practiceplaygroundthunderstormboyfriendswingtied feetlooking at self in mirrorbroken armliving roomneighborhoodchloroformbeing followedabandoned buildingsuffocationgirl in bra and pantiesinvisibilityporn magazineapparitionshot in the neckhead wounddetroit michiganreading aloudabandoned housebroken windowhospital bedswimming underwaterbreaking a windowhallwaycowgirl sex positionshot in the handfrightmenaceshape shiftertied up while barefoottalking about sexscareyoung adultoverhead shotsexual intercoursehit with a chairrunning for your lifefalse nameentityhead bandageloss of innocencetarget shootinggirl next doorsexually transmitted diseasemidnight movieporchnipple sliparm castindoor swimming poolwashing a carincest subtextconsequenceshape shiftingmotor boatsleep overmysterious personcollateral damagefootstepsguessing gamebare breastnear drowninghigh school yearbookneo 80schevrolet impalaopening creditstimelessnessdemonic presencesex horrordead woman on a beachdemonic entityelectric typewriterlounging on a beachtied to a wheelchair (See All) |
A young girl witnesses her brother murder a man through a reflection in a mirror. Twenty years later the mirror is shattered, freeing his evil spirit, which seeks revenge for his death.
| Subgenre: | independent filmcult film |
| Themes: | evildeathmurderrevengedrinkingfeardrunkennessangersupernatural powerpanictraumavengeancechildhood trauma |
| Mood: | nightgorenightmaredarknessaffection |
| Locations: | kitchenchurchcarcemetery |
| Characters: | husband wife relationshipmother son relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyserial killerpriestpsychiatrist |
| Story: | dead childhousebathroombedviolencebloodflashbackkisstitle spoken by characterknifepantiesfiredreamunderwearfood …mirrordrinkletterrunningalcoholbedroombrabound and gaggedstabbingimpalementstabbed to deathchild abusechildfishinggraveyardcursedangerstabbed in the backscreamingpossessionevil manscreamactor shares first name with charactertied upcoupleropeelectronic music scoresexual attractiontied to a bedcrucifixdesperationsexual desirewindcouchstabbed in the neckmutebroken glassscissorsspyingdemonic possessionliving roomlightpsychoticreflectionold dark housebottleskirtsilentbroken mirroractress shares first name with characterrobeshirtmurder witnesssofarunfrighttied up while barefootknife murderpitchforkabusive boyfriendold housedisturbed individualcurtainabusive mothercapstabbed in the mouthliquormistreatmentblouseevil powerfragments of glassforced suicidetrousersripping clothesvideo nastydouble impalementmultiple stabbingreading letterknife through the neckchild witnessstocking masktraumatic childhood experienceblouse rippingdisturbed childchild killing an adultkilled with a forkcaughtmouth to mouththrown down a wellstocking hat face mask (See All) |
Clementine, a teacher in a French School in Bucharest, lives with her husband, Lucas, in a remote real estate in Snagov. During the night, Clementine is woken by weird noises outside their house, and Lucas sees their car being stolen. The lights are turned off, the phones are disconnected and they s …ee that they are no longer alone. When weird lights appear outside, they hide in the cellar and try to ask for help from what could be a dreadful night of pure terror... (Read More)
| Subgenre: | independent filmfrench horror |
| Themes: | deathhome invasion |
| Mood: | nightslasherone night |
| Locations: | kitchenforestcarwoodstunnelschool busschool teachercar thief |
| Characters: | boyteenagermother daughter relationshipboyfriend girlfriend relationshipchildrenteenage boywriter |
| Period: | year 2002 |
| Story: | weirdgrindhouse filmhouseone word titleviolenceblooddogcigarette smokingchasesurprise endingpantiesbased on true storycell phonefalling from heightcar crash …classroomtelevisionstrangulationbeaten to deathscreamingcouplegamenipples visible through clothingbreaking and enteringcaptivestrangerinvasionbroken glassintruderplayelectricityromaniahead woundfemale teacherlightervillaroad accidentcountry housekiller childleg woundexpatriateno survivorsnailbased on supposedly true storyabandoned carschool childteen violencejump scareunderground tunneldictationhooded sweatshirtcatacombsstrange noisechild's playbucharest romaniawake uprattletraveling through a sewercouple killed (See All) |
Roger Cobb is a Vietnam vet whose career as a horror novelist has taken a turn for the worse when his son Jimmy mysteriously disappears while visiting his aunt's house. Roger's search for Jimmy destroys his marriage and his writing career. The sudden death of his aunt brings Roger back to the house …where his nightmares began. The evil zombies in the house force Roger to endure a harrowing journey into his past. (Read More)
| Subgenre: | independent filmcult filmblack comedy |
| Themes: | evildeathmurderrevengesuicideghostfuneralmonsterseductiondivorcesupernatural powerabductionvengeancewritingmissing child |
| Mood: | gorenightmare |
| Locations: | kitchenswimming poolcemeterybathtubpolice carjungle |
| Characters: | police officerhusband wife relationshipfather son relationshipmother son relationshipsoldierpolicemanwriteractresslittle boywitchex husband ex wife relationshipaunt nephew relationshipsuicide by hangingamerican soldierwriting a book …zombie soldier (See All) |
| Story: | haunted househousebathroomcorpsebloodflashbackdogknifedreamshot to deathmachine gunmirrorshot in the chestshotgunwatching tv …computercamerapaintingbookrifledead bodyneighbordemonhallucinationtelevisionshot in the backflashlightaxevideo cameramansionsnakesevered headcoffinchild in perilunderwater scenecreaturegraveyardauthorfbifirst of seriesskeletonexploding bodyfirst partsevered armundeadflirtingropefalling down stairsfireplacegrenadebulletwoundhidingvietnamvietnam warsevered handdead womanclockfanloss of sonshovelnovelistthunderstormcapturemarital separationbrushing teethdeath of loved onehappy endinglevitationvietnam veteranclosetfamily reunioneuthanasiaautographbroken mirrorfalling into watertentaclerazorbathroberobewriter's blockbleedingbabysittingcut into piecesmattressdelivery manhouse on firealternate dimensionhusband murders wifedelivery boybreaking a mirrorfinding a dead bodygogglespolice sirentoothbrushmidnightbook signingdivorced mangolden retrieversickleharpoonchimneyhanged womanmissing sonchildhood hometrailer narrated by percy rodriguezalternate universeman carrying a womandecapitated headspear gunwatching a movie on tvmotorscootermultiple monstersshot in the bellycarrying a dead bodydeath of auntfishing rodburying a dead bodygarbage binjumping into a swimming poolgremlinfishing polegrave siteharpoon gunhiding a dead bodyinanimate object comes to lifehouse for salebathroom mirrorone piece swimsuitswordfishburyingfemale monsterflushing a toiletwalking the dogshearsshotgun shellmonster in the closetpendulum clockwinged creaturedog carrying a severed handbathing a childmounted fishclimbing down a ropecarrying a dead womanmaterializationhearth (See All) |
It hasn't even been a year since a plantation owner named Louis lost his wife in childbirth. Both his wife and the infant died, and now he has lost his will to live. A vampire named Lestat takes a liking to Louis and offers him the chance to become a creature of the night: a vampire. Louis accepts, …and Lestat drains Louis' mortal blood and then replaces it with his own, turning Louis into a vampire. Louis must learn from Lestat the ways of the vampire. (Read More)
| Subgenre: | cult filmblack comedylgbt horror |
| Themes: | deathmurderrevengebetrayalfearescapeangersupernatural powerguilttheatremurder of family |
| Mood: | nightgoreraindarkness |
| Locations: | carhelicoptercemeteryparis francewaterpolice carfrancesan francisco californiaamerica |
| Characters: | vampireboyfather daughter relationshipprostituteactorartistlittle girlamericanamerican abroadvampire girlsame sex parents |
| Period: | 19th century20th century18th century1870s |
| Story: | mind readingdead childbedcorpsebloodviolencebased on novelnudityinterviewdancingsingingsurprise ending …pistolfirevoice over narrationcryinghorsemirrorrescuemaskrunningdead bodypianodecapitationgood versus evilorphancandleweaponanimalcoffinritualtreelibrarydangercostumescreamingcharacter's point of view camera shotdollpianistautomobileneck breakingratcinemaundeadchild murderdestinydressgothicslow motiontape recorderlifting someone into the airhatslaverywatching a moviebuttocksblockbusteraudiencetorchslavenew orleans louisianaimmortalitytheatre audiencestairsswampdark herosunshadowhomoeroticismhorse and carriagelaughingvoodooplaying cardsreflectionvictorian erastage showyellingtablelouisianaglovesplaguefemale vampirechandelieraudio cassetteteethritegolden gate bridgehouse firescytheliquidplantationsailing shipcurtaincustomsittinglifting female in airwoman's neck brokensexual innuendopoodlesliced in twocmnfbisexual mantwilightcandelabralifting male in aircarrying someonelifting an adult into the airclothed male naked femaleeroticismcmnf scenepleadingvampire human lovemarquee1790sbisexual malesiren the alarmdangerous friendmississippi rivergrand guignolgeorgian erachild vampireburial at seamonster as victimgirl in dangercostume horrorvampire driving a carreference to river phoenixtheater audiencetheater curtaindancing with dead body (See All) |
What starts as a poignant medical documentary about Deborah Logan's descent into Alzheimer's disease and her daughter's struggles as caregiver degenerates into a maddening portrayal of dementia at its most frightening, as hair-raising events begin to plague the family and crew and an unspeakable mal …evolence threatens to tear the very fabric of sanity from them all. (Read More)
| Subgenre: | mockumentarymedicalfound footagefake documentary |
| Themes: | evildeathmurderkidnappingdrinkingfearinvestigationmemoryangersupernatural powerparanoiaillnessphotographypanicmysterious death |
| Mood: | nightgoredarkness |
| Locations: | kitchenhospitalforestcarwoodspolice carcavetunnelbackwoods |
| Characters: | police officerfriendpolicemother daughter relationshipdoctorserial killerpolicemanpriestsherifffilmmakerself destructivenessself destructionthe familyout of controlself injury …lesbian daughter (See All) |
| Story: | dead childhomehousebathroombedcorpseviolencebloodfemale nuditynudityflashbackgunfemale rear nudityphotograph …knifetelephone callfirecryingcell phoneshot to deathfoodmirrorshotguncomputercameradrinksecretshootingpaintingvomitingbirthdayneighborpianorevolvertelephonereportersubjective camerabedroomflashlightcookingvideo cameraeatingwidowsuicide attemptinternetsnakeman with glassesbirthday partyritualold womanlooking at the cameratalking to the camerajeansconfessiontreeargumentpossessionmissing personinjectionbasementpolicewomangardensacrificemaniactv newsmedicinedresshypodermic needleinjurydiseasedesperationdriving a carladderhomiciderampagesufferingsurveillance cameraattempted suicideshovelmedicationstairssurpriseattichandheld camerahealingalzheimer's diseasecellphoneh.p. lovecraftfemale doctorminedark pastopening a doorfemale reporternervous breakdownliving roomroomdead girlpsychopathic killerconfusionmysterious mangardeningdark secretmoney problemspaintfilm crewstaircasetelevision newsdiggingtv reporterx raycameramanhospital roomhospital bedwhisperingsicknessjacketworminternet videomedical studenthallwayvirginiauniversity studentshirtfemale police officerdecadencemysterious womannervousnessriteholeanguishenigmamedical doctorwindowtalking while drivingtelevision reportercaverndisturbed individualquestionbiteloss of controlsmartphonecorridorloss of memorybitingfemale studentdigital camerasenilityhostilityserpentblouseevil powerdiagnosisobscuritythesiscancer patientnightiehummingtrousersporchbloody handevil forcetelephone operatorcomputer screenfurystaringtroubled pastdistorted voicepediatriciansackforces of evilmysterious noisemedical testpantsspadedark powerburnt corpsecamera operatordark forcehospital patientmedical examhuman remainsdegenerative diseasedisturbed personrecuperationspinal tapclosed doorfemale patientpagan ritualforce of evilswitchboardburning corpsemysterious behaviortrowelradiographybewildermentswitchboard operatoraspsinister forcechild with leukemiamurmuringsenile dementia (See All) |
After the funeral of a old friend who died in a car accident, former school friends Harris, Kira, and Sid break into the local cemetery after dark, and after Sid reads a mysterious incantation he finds on one of the nearby tombstones, they dance on the graves. Soon, the three of them find themselves … haunted by three different ghosts whose graves they desecrated. Harris and his wife Allison find themselves haunted by a deranged female pianist/ax murderer. Sid gets haunted by a child pyromaniac. And Kira haunted by a sadistic rapist. All of them turn to a paranormal investigator named Vincent Cochet and his assistant Frances to try to help them break the curse they imposed on themselves before the next full moon when they will be killed by the ghosts' wrath. (Read More)
| Subgenre: | paranormal investigationparanormalindependent filmparanormal phenomena |
| Themes: | murderrapeghostjealousydancefuneralsupernatural powergriefsadismsupernatural rape |
| Locations: | hospitalcemeterybathtubhumvee |
| Characters: | old friendfriendhusband wife relationshipex boyfriend ex girlfriend relationshipbabe scientist |
| Story: | paranormal investigatorhaunted housecorpsesexbondagedancingpianoprayervideo cameradeath of friendthroat slittingjudgecoffinstalkercurse …person on fireskeletonpianistarsonrecord playerloss of friendvandalismskullparking garagecgirapistcelebrationmourningthrown through a windowaxe murderburned to deathburied aliveapparitiontombstoneundertakerhiding under a bedold photographcaretakercasketpoltergeistburning mangrave diggingthroat cutenvelopefrench accentghost hunterburning houserecitalgrand pianoarsonistafter dark horrorfestaxe murderersackdesecrationsleeping on the jobpipescar through wallword processorbite markssteadycam (See All) |
A girl is mysteriously killed after recording herself playing with an ancient Ouija Board, which leads to a close group of friends to investigate this board. They later find out that some things aren't meant to be played with, especially the 'other side'.
| Subgenre: | supernaturalparanormal activity |
| Themes: | evilmurdersuicideghostfearfuneralinvestigationdeceptionsupernatural power |
| Mood: | high schoolslasher |
| Locations: | swimming poolbathtubwheelchair |
| Characters: | friendteenagerboyfriend girlfriend relationshipsister sister relationshipwaitressdeath of girlfriendbest friendsghost girl |
| Period: | 2010s |
| Story: | haunted housegrindhouse filmpsychotronic filmbathroomwritten by directorone word titlebloodflashbackphotographtitle spoken by charactersurprise endingtelephone callcell phonemirrorflashlight …death of frienddinerno opening creditsdrowningcharacter repeating someone else's dialoguecharacter's point of view camera shothigh school studentdarkbasementsisterspiritfireplaceelectronic music scoregroup of friendsloss of loved onemental institutionpower outagetitle appears in writingstairsatticshadowtitle at the endcharacters killed one by onebased on toyclose up of eyeslevitationclosethiding in a closetseanceevil spirityoung version of charactermediumouija boardphone callboard gameclose up of eyechristmas lightsbreaking a mirrorspiritualismevil childdeath by hangingflickering lightbased on gameghost childwoman in a wheelchairdead teenagerouijamidnight moviestartledfurnacehanged girljump scaremouth sewn shutblack and white photographcommunicating with the deadprimal screamopening credits (See All) |
Franco Arno is a blind man that lives with his young niece and makes a living writing crossword puzzles. One night, while walking on the street, he overhears a weird conversation between two man sitting in a car parked in front of a medical institute where genetic experiments are performed. The same … night someone breaks in the institute and knocks out a guard. Arno decides to investigate with the help of reporter Carlo Giordani. (Read More)
| Subgenre: | gay interestcult filmsuspense |
| Themes: | deathmurderlovefriendshipsurrealisminfidelitymoneybetrayalghostjealousydrinkingfearfuneralinvestigationmemory …seductionrobberyangercorruptionlonelinesstheftpsychopathobsessionparanoiablackmailguiltinsanityunfaithfulnessmental illnesssadismphotographygreedadoptioncrueltypanicdyingblindnessinheritanceself sacrificemysterious death (See All) |
| Mood: | nightgoreneo noircar chasedarknessaffection |
| Locations: | kitchenbarhotelcarcemeterywatertaxiapartmentpolice stationcityrooftoplaboratorytrain stationgay baryacht …towntrain accident (See All) |
| Characters: | old friendpolice officerfriendpolicehusband wife relationshipfather daughter relationshipgirlserial killerdetectivepolicemanphotographerartistkillerpolice detectivevillain …psychiatristpolice chaseuncle niece relationshipfiance fiancee relationshipcoronerfashion photographer (See All) |
| Story: | weirdhomestreethousebedcorpsebloodviolencesexfemale nuditynumber in titlefemale frontal nuditybare chested malekissfight …nipplesphotographexplosionpartyknifebeatingblood splattercar accidentpunched in the facecatcameradrinksecretfalling from heightpaintingvomitingsunglassesanimal in titlerunningdead bodyvoyeurfightingscientistsubjective camerabedroomjournalistbound and gaggedold manstrangulationmassacrevideo camerastabbingpoliticianstabbed in the chestaccidentchild abusecoffindrawingchild in perilsearchpantyhoseold womanfive word titleconfessionstalkerbinocularscharacter repeating someone else's dialoguescreamingfired from the jobchampagnepoisonpassionstorytellingmissing personevil mandeath of childscreamsensualitymanipulationstalkinggovernmentchildbirthglassesthreatwitnesssadnessratsuspicioncult directorespionagesplattermaniacrevelationdesirebreaking and enteringdressmass murderhypodermic needlegay characterlooking at oneself in a mirrorrome italysexual attractionhatragemutilationarchitectdesperationsalivapsychologistvictimladderparking garagedead womanmilkcrushed to deathclockembarrassmenthomicideransomambitionretirementcamera shot of feetsufferingcouchgash in the facepool tablebroken glassfalling to deathdelusionmedical examinationhit on the headenglishfrustrationsurpriseshadowperversiondead manmurder of a childattractiondark pastblind manextortionliving roomdead woman with eyes openpsychoticpipe smokingpsycho killerdrugged drinkfemale stockinged feetdead girlgarterjoyrevolutionarynews reporterdoppelgangerpsychopathic killerconfusionhandshakemysterious maninvestigatorpickpocketdark secretcremationcar drivingrepeated scenegloveslong haireyeclose upchild molestationstairwaypicturepiano playingbarberbitternessdisposing of a dead bodybroken windowreal estatex rayclimbing through a windowslashingblood staindenialfoot closeupmind gamepharmacypocket watchpoisoningdying manrazorroadblockdisappointmentdripping blooddnarazor bladestabbed in the shouldershirtmurder witnesshijackingcluesofadarkroommurder attemptmenacestabbed in the facemultiple murdersilenceknife murdercircular staircaseanorexiagialloinspectormasculinityfemale victimstrangled to deathcut handsilhouettecommitmentelevator shaftfamily feudbludgeoningextreme close upmurder victimnewspaper reporterfederal agentresearcherhit by a trainknife in the chestfalling off a roofmiddle aged manflickering lightstrobe lightvoice over inner thoughtsrearview mirrorexaminationmultiple homicidemistreatmentblack gloveslifted by the throatniecenight watchmansearchingwoman strangled to deathcollarreference to friedrich nietzscheitalian restaurantdying womanjaguarsocial realismstabbed in the heartfalling through a windowparking ticketdeath by strangulationdragging a dead bodyvenominstitutionmotorscooterrailroad stationgene manipulationmustardpathologistfireplace pokersecurity guard killedsprayed with waterunknown killergendarmebroken vaseman girl relationshipdistortionquestion and answertrapped in a roommurder by stranglingsecret lovertool shedfalling down an elevator shaftattempted poisoningdifficulty breathingkidnapping a childhomicidalteaching assistantchampagne glassscrambled eggclarinet playerpushing someoneravioliabnormal behaviorchromosomeradiologyresearch teamdead woman on the floorrheumatismshaving one's beardarithmetichereditary disease (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their … courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
| Subgenre: | supernaturalblack comedyconspiracysurvival horror |
| Themes: | deathmurderrevengesurrealismmarriagemoneybetrayalghostdrinkingfeardrunkennessescapedeceptionseductionsupernatural power …paranoiainsanitysurveillanceunemploymentcourageself sacrificenear death experience (See All) |
| Mood: | nightgoreone nighthorror movie remake |
| Locations: | barlos angeles californiabathtubelevatorwheelchaircave |
| Characters: | husband wife relationshipafrican americandoctornursesecurity guardalcoholic |
| Period: | 1990s1930s |
| Story: | haunted houseinsane asylumpresumed deadhousecorpsebloodfemale nudityfightphotographtitle spoken by characterpartyknifechasesurprise ending …pistolfirecell phoneshot to deathblood splatterfistfightshot in the chestremakerescuepunched in the facewatching tvcomputerdrinkbrawlheld at gunpointsunglassesbirthdaydemonhallucinationf wordsubjective cameradecapitationsurvivalflashlightjournalistambushaxeimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologuescreamingelectrocutioncharacter's point of view camera shotknocked outskeletonbasementhauntingsuspicionriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerskullfaked deathmental institutioncameobraveryguestimpostorstabbed in the neckbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothstabbed in the handfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramanbubble bathscalpeloffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
| Subgenre: | independent filmcult filmblack comedydark comedypsycho thrillersurvival horroramerican horror |
| Themes: | evildeathmurderkidnappingdeceptionincestpsychopathinsanitymental illnesssadismhome invasiongreedcannibalismwealthstarvation …claustrophobia (See All) |
| Mood: | goresatireslasherdarknesssocial satire |
| Locations: | los angeles californiaslum |
| Characters: | boypolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipvillainterrorkiller dog |
| Period: | 1990s |
| Story: | grindhouse filmhomesuburbhousecorpseviolenceblooddogcigarette smokingtitle spoken by characterknifepistolshot to deathblood splattershot in the chest …face slapshotgunbirthdayflashlightmansionimpalementchild abusechild in perilvanracial slurcharacter repeating someone else's dialogueelectrocutiondollevil mandeath of childskeletonbasementcharacter says i love youcult directorterminal illnessmaniacfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragemutilationstabbed in the stomachspiderpsychosevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordpsycho killergothpervertserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
In Pasadena, Mrs. Davis sends her daughter Aubrey Davis to Tokyo to bring her sister Karen Davis, who is interned in a hospital after surviving a fire, back to the USA. After their meeting, Karen dies and Aubrey decides to investigate what happened to her and gets herself trapped in the same situati …on, being chased by the ghost of the house. Meanwhile in Tokyo, the three high school mates Allison, Vanessa and Miyuki visit the famous haunted house and are also chased by the ghost. In Chicago, Trish moves to the apartment of her boyfriend Bill, who lives with his children, the teenager Lacey and boy Jake. On the next door, weird things happen with their neighbor. (Read More)
| Subgenre: | ghost story |
| Themes: | deathmurderrevengeghostfearangersupernatural powermysterious death |
| Mood: | high school |
| Locations: | hospitaltrainbathtubvillagerural settingjapancitychicago illinois |
| Characters: | police officerboyfamily relationshipshusband wife relationshipfather son relationshipmother daughter relationshipteenage girlteachernursestudentlittle boyterrorstepmother stepson relationship |
| Story: | haunted houseweirddead childhousecorpsenumber in titlesequelflashbackphotographsurprise endingpantiestelephone callcell phonemirrorurination …watching tvcatcondomfalling from heightsecond partclassroomgood versus eviljournalistbraritualdrowningcursediaryneck breakingschoolgirlpsychicspiritbreaking and enteringgothicphone boothdead womantokyo japanpastdeath of sisterdead woman with eyes opennewspaper clippinggothreturning character killed offphysicianaltered version of studio logoloss of sisterkiller childdarkroomvideo cassettewoman's neck brokenevil childdead woman on groundinter culturalremake by original directordefenestrationpasadena californiawraithurinating in fearfamily violencefemale urinatingestranged family memberrecords (See All) |
| Subgenre: | cult filmcoming of age |
| Themes: | evildeathmurderfriendshiprapebetrayalfeartortureincestmemorybrutalitydysfunctional familyguilthumiliationsadism …abuseexploitationcrueltychildhoodrevenge murder (See All) |
| Mood: | night |
| Locations: | kitchennew york cityforestsmall townwoodsamerica |
| Characters: | police officerfriendpolicefamily relationshipsfather son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipteenage girlteenage boypolicemanhostagesister sister relationshipterrorcousin cousin relationship …aunt niece relationshipchildhood friendhomeless manofficer (See All) |
| Period: | 1950s |
| Story: | dead childsuburbbedviolencebloodsexfemale nuditybased on novelbare breastsfemale frontal nudityflashbackbondagefemale full frontal nuditycigarette smokingknife …pantiesbased on true storyvoice over narrationcryingbeatingwatching tvsecretbeertearslow budget filmneighborrivertelevisionsurvivalorphanbrabound and gaggeddeath of friendwhite pantieschild abusechildhit by a carcontroversyspankingpainscreamingscreamtragic eventthreatbasementtied upblindfoldsacrificehatesistergamesexual abuseragemutilationloss of friendcaptivedesperationvictimrape victimcarnivalrapistdead womanpeeping tommoralityinnocencesufferingunderage drinkingconfrontationmercilessnessgang rapecellarneighborhoodpsychoticsmokemoral dilemmaphysical abusenarrated by characterstrugglechild molestationcrutchessexual violencedegradationself defensemind gameadult actress playing teenage girltoastdisciplineimmaturityamericanaatrocityunderage smokingevil womantormentpsychological torturehopelessnessloss of parentsdepravitycutgenital mutilationclothes rippingburnendurancesexual sadismblowtorchcprleg braceloss of innocencedehumanizationpityblameinfamymouth to mouth resuscitationchild smoking cigarettepsychological abusewatercolorimmoralitysavagerytraumatic childhoodcigarette burnbraless teenolder brotheramoralityhelplessnesssleep overobjectificationcrawfishstruggle for survivalmurder threatwill to liveheld at knifepointburnedfemale mutilationoffenderrape slaydisciplinarianfemale in perilcigarette behind earfemale degradationhung by one's wristspowerlessnesspolio victimbed spring (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their … dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
| Subgenre: | supernaturalindependent filmcult filmdark fantasyurban fantasy |
| Themes: | deathmurderrevengesurrealismkidnappingbetrayalpregnancyfearescapedeceptionextramarital affairangerbrutalitysupernatural powerdeath of mother …paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All) |
| Mood: | nightgoredarkness |
| Locations: | trainswimming poolairplanebathtubelevatorurban settingapartmenttruckrooftoprussiatunnelyachtfire escape |
| Characters: | vampirepolice officerfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierhostagetough guywarrioraction herosingle motherlittle boywitchrussian …pregnant womanself mutilation (See All) |
| Period: | 1990s2000s20th century21st centuryyear 1992 |
| Story: | psychotronic filmmind readinghearing voicescorpseviolencebloodfemale nuditybased on novelflashbackdogtwo word titlebare chested malefemale rear nudityfightphotograph …title spoken by characterexplosionknifechasesurprise endingvoice over narrationcell phonebeatingblood splatterhorserescueslow motion scenepunched in the facebattleswordarrestbrawlbare buttshowdownsunglassesneighborsubjective cameradecapitationgood versus evilfoot chaseflashlightsword fightambushconcertaxebridgearmyimpalementstabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuescreamingcharacter's point of view camera shotmissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetlifting someone into the airexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodieimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All) |
People are dying mysteriously and gruesomely, and nobody has a clue what the cause is. Only health worker Mike Brady has a possible solution, but his theory of killer slugs is laughed at by the authorities. Only when the body count begins to rise and a slug expert from England begins snooping around … does it begin to look like Mike had the right idea after all. (Read More)
| Subgenre: | creature featureamerican horrorspanish horror |
| Themes: | deathfriendshipinfidelitymonster |
| Mood: | gorehigh school |
| Locations: | kitchenrestaurantsmall townpolice carsewertown mayor |
| Characters: | policehusband wife relationshipboyfriend girlfriend relationshippsychiatristmaidsheriffmayorself reflection |
| Period: | 1980s |
| Story: | sinkexpertgrindhouse filmsuburbbedcorpseviolencebloodsexfemale nuditybased on novelmale nudityfemale frontal nuditymale frontal nuditymale rear nudity …bare chested malefemale rear nuditycigarette smokingmale full frontal nudityexplosionfireblood splattermirrorslow motion scenevomitinganimal in titletelevisionscientisthalloweenbedroomflashlightwineexploding carpantyhosedrowningblack pantiesskeletonhairy chestpremarital sexundergroundfemale stockinged legslooking at oneself in a mirrorsurvivormutilationexploding buildingnosebleedcovered in bloodgrindhousecrushed to deatheaten alivecamera shot of feetinvasionblood on faceescape attemptexploding headpollutioneye gougingplantfemale stockinged feethigh school teacherblack pantyhosegardenerclimbing through a windowgreenhousedeputyactual animal killedcar set on firedisfigured facegraphic violencesuntan pantyhosebloody violencedragging a bodycut armbitten handalcohol abusesmall town sherifftrampmealpickaxescreaming in horrordrive in classicbusiness dealhit with a frying pandouble murdergory violencesaladgruesomecabbageinfestationslugscience teacherfaucetboy eatenexploding eyefemale in braspanish cinemabitten in the handjerseybrief male full frontal nuditycrampdead teen coupleeaten by animaleaten by an animalsanitationteen couple eatenskeleton mask (See All) |
The film begins with the return home of a wwII veteran who was the recipient of a "Dear John Letter". After swiftly dispatching a courting couple in a Gazebo we leap to present day where a college celebration becomes the hunting ground for a uniform clad killer.
| Subgenre: | independent filmcult filmsuspense |
| Themes: | deathmurderloveinfidelityjealousyfearescapeangerpsychopathbrutalityobsessioninsanitycrueltypanictrauma …shower murder (See All) |
| Mood: | goreslasher |
| Locations: | kitchenswimming poolcemeterysmall townwaterwheelchairpolice caroffice |
| Characters: | police officerfriendpolicesingerteenage girlteenage boysoldierserial killerpolicemanmusicianwaitresssheriffterrorpolice arrest |
| Period: | world war two1980s1940syear 1945year 1980year 1944 |
| Story: | presumed deadhomehousebathroomcorpseshowerbloodviolencefemale frontal nudityflashbackkissfightnipplesphotograph …singingknifesurprise endingtelephone callbeatingblood splattermirrorblondeshot in the headslow motion scenebikinilettervomitingriflerunningvoyeurtelephoneswimmingbedroomflashlightold manstabbingdeath of friendthroat slittingbridgeimpalementstabbed to deathdinerstabbed in the chestrock bandbrunettecoffinpolice officer killedvoice overgraveyardpaingunshotgravestalkermicrophonestrippinguniformscreamskeletonhangingglassestrappolicewomanratstageflowermaniacballoonjeepcakesexual attractionjail cellhidingcelebrationtensionstabbed in the throatnewsreel footagepolice officer shotstabbed in the headballroseattractioncellarmasked killerexhibitionismmusic bandplaying cardspsychopathic killergraduationmysterious manmarketfilm clipbicyclingmaking outmessageexhibitionistpursedeputysawed off shotgunhand over mouthbayonetswimming underwaterlocked doorhanged mancampuscruise shipnaked dead womangravestonemultiple murdercustomerknife murderpitchforkmurder of a nude womandying during sexcasketpolice officer shot in the headcurtaindeeply disturbed personmistreatmentblack glovesgalalifting a female into the airblue dressconfettigeesedouble impalementunknown killerprom nightkilled with a forkmaster of ceremoniesteenage pranksterreference to glenn miller (See All) |
For people who don't believe the events of _Grave Encounters (2011)_ (qv).Grave Encounters, film student Alex Wright is out to prove them wrong. Alex is as obsessed with the first film as the 20 million people who viewed its viral trailer on YouTube. While he and his friends research the events and …visit the real psychiatric hospital depicted in the original film, they find themselves face-to-face with unspeakable evil, banking on the hope that their knowledge of the original film will help them survive the sequel. (Read More)
| Subgenre: | paranormal investigationmockumentaryfound footagefake documentaryparanormal phenomena |
| Themes: | evildeathmurderghostfearsupernatural powerinsanity |
| Mood: | darkness |
| Locations: | los angeles californiaelevatorpolice carcanadatunnel |
| Characters: | police officerpolicenursebabysecurity guard |
| Story: | haunted housepoint of viewbathroombloodsequelinterviewmasturbationcamerasecond partsubjective camerahalloweenflashlightvideo cameradeath of friendtoilet …maplooking at the cameratalking to the camerahotel roomscreamingelectrocutioncharacter's point of view camera shotcollege studentdarkhauntingratsleepingspiritloss of frienddead womanblood on facemental hospitalscene after end creditsproducerhandheld cameramurder of a childsurgeondormitoryabandoned buildingdementialevitationsurgical masknight visionshoutingmooningfrightouija boardcamera phonepentagramchainsbludgeoninglabyrinthcutting hairdorm roomdead babywriting on a wallaudio recordingmetaduffel baganimate objectabandoned hospitalrocking horsebreaking through a wallglow stickcrazy manshock therapythrown out a windowevpdemonic spiritinsane manbolt cutterelectronic voice phenomenagatewayinvisible beingteen filmmakerburning to deathfilmed paranormal eventfoghorn (See All) |
While driving , the pregnant horror-movie actress Kyoko Harase and her fiance are in a car crash caused by the Toshio's friend. Kyoko loses her baby and her fiance winds up in a coma. Kyoko was cursed together with a television crew when they shot a show in the haunted house where Kayako was brutall …y murdered by her husband years ago. While each member of the team dies or disappears, Kyoko is informed that she has a three-and-a-half-month-old fetus in her womb. (Read More)
| Subgenre: | ghost storyasian horror |
| Themes: | ghostpregnancy |
| Characters: | friend |
| Story: | haunted househorror movietraffic accidentsuburbhousesequelsecond partcamera shot of feetfemale stockinged feetpushed down stairswraithmale feet in socksmale stockinged feetsupernatural pregnancy |
Innocent people are being brutally murdered on the streets of New York City by a uniformed police officer. As the death toll rises and City Hall attempts a cover-up, Frank McCrae heads the investigation. A young cop, Jack Forrest, finds himself under arrest as the chief suspect, having been the vict …im of a set-up by the real killer and a mysterious woman phone-caller. Forrest, his girlfriend Theresa, and McCrae set out to solve the puzzle before the Maniac Cop can strike again. (Read More)
| Subgenre: | independent filmcult film |
| Themes: | deathmurderrevengeadulteryprisoninvestigationpsychopathsurveillancepolice investigationmurder of a police officerpolice corruption |
| Mood: | neo noirslasher |
| Locations: | new york citypolice stationpolice carprison shower |
| Characters: | police officerpoliceafrican americandoctorserial killersecurity guardpolice shootoutpolice chase |
| Period: | 1980s |
| Story: | police commissionergrindhouse filmpsychotronic filmcrime sceneshowerviolencebloodnuditymale nuditybare chested maleguntitle spoken by charactersurprise endingjailreporter …stabbed to deathfalse accusationpolice officer killedpantyhoselatex glovesgunshotuniformmini skirtstreet shootouthairy chestneck breakingfirst partcult directormaniacfemale stockinged legsjail cellpsychogrindhouseparadeback from the deadcamera shot of feetblood on facepsychotronicpolice officer shottough copmustacheworld trade center manhattan new york citynewspaper clippingmale in showerfemale stockinged feetmedical masksurgical maskpolice officer shot in the chestsuit and tiehomicidal maniacdental maskfoot closeupdisfigured facefemale copstrangled to deathmass murderermortuaryinnocent person killedpolice officer shot in the headscrapbookwoman's neck brokenpolicewoman killingshower roomnypdpolice officer knocked unconsciousarmored truckmass killingswatpolice protagonistweirdokiltleg braceinfirmarypolice badgestabbedarmored vehiclemale in a showerpolice officer stabbednude fightpolice departmentmurder of a policewomansecurity guard killedpolice precinctsecurity officervice squadnew york police departmentpolice officer throat slitpolice officer strangulatedpolice ambushpolice station attackst. patrick's dayindestructibilitycop on the edgecrippledcop killed by a copvice coppolice officer hackedpolice officer shot in the foreheadkilled while sitting in a police vanpolice officer killed by femalepsycho coppolice officer killed at traffic stoppolice officer stabbed in the chestarmored vehicle attackedpolice officer stabbed in the backcop in prisonpolice officer killed in police stationpolice officer knocked down by vehiclemurder in showermaniac coppolice officer trapped (See All) |
In Los Alamos, New Mexico, the twelve year-old Owen is a lonely and outcast boy bullied in school by Kenny and two other classmates; at home, Owen dreams of avenging himself against the trio of bullies. He befriends his twelve-year-old next door neighbor, Abby, who only appears during the night in t …he playground of their building. Meanwhile, Abby's father is a wanted serial-killer who drains the blood of his victims to supply Abby, who is actually an ancient vampire. Abby advises Owen to fight Kenny; however, soon he discovers that she is a vampire, and he feels fear and love for the girl. Meanwhile a police officer is investigating the murder cases, believing that it is a satanic cult. (Read More)
| Subgenre: | independent filmcoming of agedark fantasy |
| Themes: | friendshipreligiondivorcelonelinesssupernatural powerbullyingfalling in loveboy girl friendship |
| Mood: | nighthorror movie remake |
| Locations: | schoolsnownew mexico |
| Characters: | vampirepolice officerboyfriendpolicechildrenteachergirlbullyamericanvampire girlreligious mother |
| Period: | 1980swinteryear 1983 |
| Story: | homewritten by directorbloodfemale nuditybased on novelkisscigarette smokingknifethree word titlefireremakerescuebookprayer …swimmingambulancestabbingchild in periltransformationlocker roomperson on firelong takethreatened with a knifesingle parentchainsawiceeavesdroppingaddictiontelescopechild's point of viewchild protagonistyoung lovemurder of a childdead boy12 year oldface masksuper strengthtween girlweightliftingfemale vampirehugbare chested boymercy killingswimming underwaterkiller childstar crossed loverslighting a cigarettetragic lovereference to ronald reaganin medias resjunior high schoolpre teenmiddle schoolsaying gracejoggerbitingyoung boyblood drinkingrubik's cuberailroad crossinggym teachermorse codevampire human loveswimming lessonthinnessspying on someoneattempted drowninghanged bodydangerous friendwedgieacid burningtwenty dollar billchild vampiretweentouching breastbreaking into a carclimbing up a buildingfootprintstriple child murderbarefoot girlneck woundolder manlos alamosswimming bathspre adolescentchild heroinepicture of jesusbarefoot childstrength trainingbarefoot boyremake of swedish film (See All) |
In 1971, Carolyn and Roger Perron move their family into a dilapidated Rhode Island farm house and soon strange things start happening around it with escalating nightmarish terror. In desperation, Carolyn contacts the noted paranormal investigators, Ed and Lorraine Warren, to examine the house. What … the Warrens discover is a whole area steeped in a satanic haunting that is now targeting the Perron family wherever they go. To stop this evil, the Warrens will have to call upon all their skills and spiritual strength to defeat this spectral menace at its source that threatens to destroy everyone involved. (Read More)
| Subgenre: | paranormal investigationparanormalparanormal activity |
| Themes: | evilsuicidemarriageghostsupernatural powernear death experience |
| Locations: | motelsinging in a car |
| Characters: | police officerhusband wife relationshipfather daughter relationshipmother daughter relationshipteenage girlsister sister relationshiplittle girllittle boymaidwitchcatholic priesttruck driversuicide by hangingghost in mirror |
| Period: | year 1968year 1971 |
| Story: | paranormal investigatorhaunted househouseflashbacktwo word titlebased on true storyshotgunvideo cameratied to a chairno opening creditschild in perilattempted murdercharacter repeating someone else's dialoguecharacter's point of view camera shotpossession …dollprankblindfoldelectronic music scorecrucifixpump action shotgunvisionscissorsdemonic possessionlaughingbruisepigeonexorcismdead doglevitationapparitionblindfoldedlecturefarmhousenoosestation wagonmusic boxdead birdlocketsleepwalkingclairvoyantflash cameraends with textrocking chaircutting hairpancakefalling through the floornew housesailor suitghost hunterfilicidewardrobedeath of pethanged womanlaundry drying on clothes lineclotheslinehanged by the neckwind chimerhode islandblood vomitingmatchesvolkswagen busbitten in the facemusic score features pianosideburnsloss of petupside down camera shotchild sacrificeultraviolet lighthand clapping gamespiralanimate dollpsychic visionboat dockslit wristscrawl spacehole in a walllocked in a cellarrevealing the truthdybbuk boxgenuflectingdybbukdriving at night in the rainbumping headends with quotationhiding in cupboardhouse by a lakehung from tree (See All) |
| Subgenre: | paranormal investigationmockumentaryfound footagefake documentaryparanormal phenomena |
| Themes: | evildeathmurdersuicideghostdrinkingfearinvestigationcrueltypanicabortionmysterious death |
| Mood: | nightdarkness |
| Locations: | kitchenforestcarsmall townboatvillagewoodsapartmentcitytown |
| Characters: | boyhusband wife relationshipmother daughter relationshipgirlpriestout of controlself immolation |
| Period: | 1970s2000s |
| Story: | housecorpseviolencebloodinterviewflashbackdogfightphotographtitle spoken by charactertelephone callfirebeatingblood splatterfood …punched in the facecameradrinksecretmaskbookrunningneighbordemonriverfightingtelephonejournalistvideo camerabridgeeatingman with glasseschilddrawingrituallooking at the cameratalking to the cameracursedangerscreamingperson on firepossessionstorytellingmissing personscreamdisappearancedarksacrificepsychickillingocculttv newsdestructionrevelationtape recorderwoman with glassesvideotapeeccentricdesperationdead womanhomicideapartment buildingmental institutiontokyo japanresearchhousewifehandheld cameradead mancellphonebalconydemonic possessionliving roomphoneneighborhoodpigeontelekinesisdead dogfolkloredark secretcar drivingrepeated scenecanoetelevision newsabandoned housecameramanflaskfilm starts with textconversationdamtelevision showmissingmediumpsychoanalysisfrightphone callmultiple murderritedead birdshrinewatching a videoanguishscarewindowhouse on fireanimal killingdoorclairvoyantnews footagephotoloss of controlvoicemultiple homicideextrasensory perceptionhostilitysickletelevision broadcastshaky cambomb shelterevil powerclairvoyanceobscurityanimal deathevil forceeccentricityembryophenomenonforces of evilmysterious noisestrange behaviorkillingsweird behaviorkyoto japanmysterious persontv journalistevil beingmysterious individualstrange noisedark powerraw footagemysterious voicepunch into the cameraevil spellyarnevil entitypsychological testingtelevision programtinfoilmultiple killingplanktonforce of evilectoplasmdiabolical possessionpsychic researchtinfoil hattelevision journalistdemonic entitydemonic force (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | paranormalsupernaturalindependent filmcult filmsuperherostop motion animationslasher flickbody horroramerican horrorurban fantasy |
| Themes: | evildeathmurderfriendshiprapeghostpregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanity …sadismtrauma (See All) |
| Mood: | gorenightmareslasher |
| Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
| Characters: | boyfriendfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorfemale protagonistgirlserial killernursebaby …artistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | haunted housegrindhouse filmpsychotronic filmtraffic accidentstreetbedshowerviolencebloodsexfemale nudityf ratednuditybare breastssequel …flashbackbare chested malegunfemale rear nudityphotographpartyknifechasesurprise endingpistoltelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlecar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armdismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disorderfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathwet clothescut handmurder spreefetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
True-crime writer Ellison Oswalt moves himself and his family into a house where a horrific crime took place earlier, but his family doesn't know. He begins researching the crime so that he can write a new book about it to help his flailing career. He uses some "snuff" film footage he finds in the h …ouse to help him in his research, but he soon finds more than he bargained for. There is a figure in each of the films but who or what is it? As a result, his family start to suffer (as does he) and things take a turn for the worse. Will they survive? (Read More)
| Subgenre: | supernaturaltragedyfound footagesupernatural horror |
| Themes: | evildeathmurderghostfearinvestigationobsessionsupernatural powerpanicwritingmurder of familymissing childnovel writing |
| Mood: | nightdarkness |
| Locations: | swimming poolsmall townpennsylvaniacar fire |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipwritersheriffterror |
| Story: | grindhouse filmhomehousewritten by directorviolenceblooddogcigarette smokingphotographknifecell phoneblood splatterpaintingbookalcohol …bedroombound and gaggedmassacrethroat slittingtied to a chairmapsnakeman with glassesdrawingchild in perildrowningcoffeetreeargumentdeath of childbaseball bathangingdisappearancelaptopfirst partkillingchild murderoccultburned aliverevelationtied to a bedwatching a moviepoolduct tape over mouthwhiskeyresearchpower outagenovelistatticfamily dinnerlens flareaxe murderboxdrugged drinkbag over headdark secrettrue crimewebcamfilm projectordeputyscorpionpatricideheld captivebloody body of childsnuff filmcollege professorvhshanged manmoving inbackyardkiller childcar set on firefilmed killingmultiple murdermatricideknife murdersuper 8tapesleepwalkingsleeping on a couchfratricidesinisterfalling through the floormystery killernew housemovie projectorsuper 8mmst. louis missourighost childfilm reelhanged womangooglesingle locationnew homefoaming at the mouthsacramento californiafilm editingorange county california8mm filmhanged childpov shotkilled with a lawnmowernight terrorsax murdershushing someonecrime novelist (See All) |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
| Subgenre: | cult filmconspiracytragedyasian horror |
| Themes: | deathlovefriendshipsurrealismsuicidebetrayalghostjealousypoliticsmemorybrutalityobsessionparanoiacancerredemption …guiltinsanitysexualitymental illnesstheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All) |
| Mood: | rainnightmaredownward spiral |
| Locations: | small townbuselevatorvillagewheelchairrooftop |
| Characters: | boychildrenfemale protagonistnursedancersister sister relationshiplove trianglesuicide by hangingstepmother stepdaughter relationship |
| Story: | haunted housedead childpresumed deadhomehouseviolencebloodf ratednumber in titleinterviewflashbackfightcigarette smokingphotographsurprise ending …punctuation in titlecryinghorsemirrorremakelierunningdead bodyhallucinationcolor in titlenewspaperorphanflashlightstabbingmontageaccidentdream sequencedrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicioncult directorheroinhatechild murderchesssistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatpatientdemonstrationloss of loved onedrug abusecommunityhomicidemental institutionreverse footagesevered fingernostalgiamental hospitaldelusionscissorsbribemedicationblack brasibling rivalrydeath of sisterperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationdockcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All) |
Radio DJ Vanita 'Stretch' Brock's open request night is plagued by the annoying phone pranking of two road tripping, party-hard, hoodlums, but things take a disturbing turn when the hoodlums meet their demise at the hands of familiar chainsaw wielding maniacs. With the entire gruesome ordeal recorde …d on tape, Stretch seeks out the help of a former Texas Marshall who's on a personal quest of vengeance against this family of cannibals. While at first he turns her down, he eventually decides to use her tape to his advantage, asking her to air it during her request block- effectively baiting the cannibals to the radio station where he'll personally deal with them. (Read More)
| Subgenre: | independent filmcult filmblack comedydark comedyb movieabsurdismpsycho thrillerslasher flicksurvival horrorcampyamerican horrorindependent horrorsadistic horror |
| Themes: | evildeathmurderrevengesuicidekidnappingfeartorturedrunkennessescapeinvestigationdeceptionangerpsychopathbrutality …paranoiadysfunctional familyinsanitysadismhome invasionexploitationpaniccannibalismself sacrificemadnessnear death experience (See All) |
| Mood: | nightgoresatireparodycar chaseslasherambiguous ending |
| Locations: | elevatorwheelchairroad triptruckcavetexastunnelcave inback country |
| Characters: | police officerpoliceteenagerteenage boyserial killerhostagekillervillainterrorself mutilationslasher killerserial murdererpolice lieutenant |
| Period: | 1980s |
| Story: | dinner tablegrindhouse filmpsychotronic filmcrime scenepresumed deadcorpsebloodviolencenumber in titlesequelgunfightcigarette smokingdancingexplosion …singingpartyknifechasesurprise endingpistolbeatingdigit in titleblood splattercar accidentrescueslow motion scenepunched in the facewatching tvfalling from heightshowdownsunglassessecond partrunningcar crashrevolvertelephonef worddecapitationsurvivalfoot chaseflashlightambushdeath of friendbridgestabbed in the chesttied to a chairsevered headman with glassesradiodouble crosspolice officer killednews reportattempted murderbeaten to deathdangerstabbed in the backscreamingpuppetattackcowboymini skirtproduct placementcover upevil mankicked in the facetough girlopening action sceneskeletonprankconvertiblecountrysidehigh school studentstalkingcontestexploding bodyautomobileratmurderertied upprofanityhandgunobscene finger gesturecult directortypewriternewspaper headlinekillingrecord playermaniacpickup truckchainsaweavesdroppingfalling down stairshand grenadedestructionhead buttelectronic music scorejeepgothicsociopathlifting someone into the aircowboy hathammereccentricchefpsychogrindhouseskullfollowing someonecarnivalsocial commentarymasked manfemale warriorrampageredneckwoman in jeopardydamsel in distressreverse footagefight to the deathdual wieldhatredcannibalmercilessnesschaosdark humormutefalling to deathbutcherpsychotronicescape attemptcigarette lighteramusement parkpunched in the chestdisembowelmentwisecrack humorblood on shirtone daybody landing on a carraised middle fingerbody countlens flarelieutenantlaughingcharacters killed one by onesequel to cult favoritekilling spreereckless drivingpsychoticmasked killerpsycho killersouthern accentgothserial murderpsychopathic killerbad guyharassmentmadmandirector cameoface maskvietnam veteranfinal showdownfire extinguisherhuman monstertowerhomicidal maniacslashingradio stationfilm starts with texthillbillyone linerhead injuryradio showcarnagewoman kills a manaudio cassetteextreme violencerepeated linewoman fights a mandallas texasmasked villainslaughterhouserecreational vehiclesubterraneanpsychological tortureshrinebloody violencehit with a hammersadistic psychopathsledgehammermurder spreestupid victimvillain not really dead clichelifting person in airbutcheryfreewayhookcrime spreeradio djchantingvinyltoothfalling through the floorgross out humorhands tiedhigh school seniordecomposing bodypsycho terrorskinweirdopranksterbased on supposedly true storydisturbingmusic score composed by directorstate in titlebonesradio hosttorturerstar spangled bannermidnight moviesevered facesadisticspit takedrive in classicstate trooperanthropophagushoodlumover the topthrown from heightentrailsgory violenceevil laughterscream queencar phoneeating human fleshstabbed through the chestgruesomehell on earthman eatermeat hooksplit headchainsaw murderpsycho filmcult favoritevictimizationpower toolbrutalleatherfacebased on ed geinfemale djchiliabandoned amusement parkdriving backwardswearing human skinreference to bonochainsaw fightcut headchillireference to sonny bonocannibal familyevil familyhole in floor (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
| Themes: | evildeathmurderfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadism …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | nightgorenightmarecar chaseslasherdarknessblood and gore |
| Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
| Characters: | boyfriendpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend …killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
| Story: | grindhouse filmhousebathroombedcorpseshowerbloodviolencefemale nudityf ratedbare breastsfemale frontal nudityflashbackmasturbation …dogguncigarette smokingphotographknifelesbian kisschasesurprise endingtelephone calldreamblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassescar crashdead bodylow budget filmneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chestsevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherybludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
While investigating a call in an abandoned house, Officer Frank Williams and a rookie find a woman brutally blinded, but they are attacked by a huge psychopath with an ax; the rookie is killed and Frank shoots the criminal in the head, but has a severed arm. Four years later, the mutilated Frank is …relocated, working as a guard in the County Detention Center. Frank goes with some delinquents to the Blackwell Hotel, an abandoned place since a fire burnt the last two floors, with the purpose of cleaning the location, preparing it to work as a shelter for the homeless; in return, the criminals will have their sentences reduced. During the night, the inmate Kira who has some Christian tattoos on her body is kidnapped by the deranged serial-killer Kane who collects the eyes of his victims, while the rest of the group is attacked by the psychopath with his ax. (Read More)
| Subgenre: | psycho thrilleraustralian horroramerican horrorindependent horrorsadistic horror |
| Themes: | evilmurderrevengedrugsreligionprisontorturetheftpsychopathbrutalitydrug usesadismmurder of a police officer |
| Mood: | nightgore |
| Locations: | kitchenhospitalhotelelevator |
| Characters: | policemother son relationshiptattoolustvillainterrorreligious fanatic |
| Period: | 2000s |
| Story: | presumed deadhousebathroomcorpseshowerviolencebloodflashbackmasturbationdoggunchasesurprise endingpistolblood splatter …mirrorurinationshot in the headfalling from heightlow budget filmflashlightbound and gaggedstrangulationaxethroat slittingimpalementchild abuseevil manattempted rapestalkingsevered armmaniacpornographycagelifting someone into the airpsychoanimal attackcrushed to deathstabbed in the headstabbed in the legeye gougingstabbed in the eyebody countcharacters killed one by onepsychoticpsycho killersinserial murderpsychopathic killersuffocationbad guyhuman monsterhomicidal maniacfemale psychopatheyeballcrushed headfemale villainevil womanmaggotmurderessmatricidelunaticsadistic psychopathmurder spreestupid victimcrime spreecaptivitycreepabusive motherwardenstun gunpsycho terrorfemale serial killersnorricamprosthetic limblifting a female into the airfragments of glasskilled in an elevatoranimal rights activistjuvenile detentionone armed mansickobad girlmeat hookstabbed through the chinchoked to deathfliesspinning axereference to three wise monkeys (See All) |
Yorkshire, 1974. Britain is in recession, the oil crisis and black outs loom large. The Maynard family move into their dream house, only to find a "presence" already living there. Len, Jenny and their daughter Sally must struggle to keep their already-fragile family together as they are attacked by …poltergeists. Soon it becomes apparent that Sally is their main focus of attention. The house becomes a living nightmare. They must exorcise the evil spirits for them to survive. (Read More)
| Themes: | evilghostfearblackmail |
| Mood: | movingrain |
| Locations: | schoolcarbuswoodsschool bus |
| Characters: | friendfather daughter relationshipmother daughter relationshipteacherpriestlittle girlcatholic priestcrying girl |
| Period: | 1970s |
| Story: | haunted househousebathroombedwritten by directorcigarette smokingsurprise endingurinationcamerabirthdaytelevisionreporternewspaperbedroomflashlight …candletoiletbirthday partysuitcasedollhangingwigbasementhauntingballetrecord playerspiritcrying womanphone boothcrushwindpower outagepool tablerosemustacheliving roompuppytourexorcismdead girllevitationseancestairwaybeenoosemusic boxhair salonfamily manslapcoallocketfirecrackerpoltergeisttranceexorcistnew househome alonegrandfather clockbeehivemoving vanvacuumanimate objectbee stingwallpaperhopscotchteacher crushlights outstrange noiseshattering glassbilliard tableetch a sketchalone in houseslinky (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou …nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
| Subgenre: | independent filmcult filmsuspensetragedycreature featureallegorysurvival horrorzombie apocalypseamerican horrorzombie survivalindependent horrorzombie outbreak |
| Themes: | deathmurderrevengemarriagefearescapemilitarybrutalityparanoiapanicapocalypsecannibalismcourageself sacrificepolice brutality …near death experienceradiation (See All) |
| Mood: | nightgoredarknessone night |
| Locations: | kitchenforestcarhelicoptercemeterywoodsrural settingfarmtruckpennsylvania |
| Characters: | policehusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorbrother sister relationshipzombieprofessorsheriffterrorpolice dog |
| Period: | 1960syear 1968year 1967 |
| Story: | explanationexpertgrindhouse filmpsychotronic filmhousecorpseviolencebloodfemale nuditybare breastsfemale frontal nuditydoggunfemale rear nudityfight …cigarette smokingexplosionknifechasesurprise endingpistolfiretopless female nudityhigh heelsbeatingshot to deathblood splatterfistfightfoodcar accidentshot in the chestface slapshot in the headshotgunrescuepunched in the facewatching tvbrawlbare buttrifleheld at gunpointrunninglow budget filmrevolvertelevisionscientistshot in the backsurvivalfoot chaseaxemassacrestabbingwomanbridgearmystabbed to deathstabbed in the chestexploding carman with glassescultradiocontroversycreaturegraveyardpantyhosenews reporttransformationshot in the foreheadlimousinegravetreebeaten to deathdangerscreamingperson on fireattackfirst of seriesactor playing multiple rolesrace against timeknocked outscene during end creditsshot in the shoulderdeath of brotheramerican flagtragic eventexploding bodyisolationbasementdie hard scenariofirst partdirectorial debutsevered armgeneralhandgunvigilantecult directorundeadwashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned aliveelectronic music scoregothicmutantdiseasevirusbarnloss of loved onehammerimpersonationsevered handgrindhouseskulltorchend of the worldwhite housesocial commentaryback from the deadeaten alivecamera shot of feetseriescameobraverycannibalmercilessnesspower outagechaosresurrectionbroken glassinsectpsychotronicescape attemptscene after end creditsinfectionone daysiegegasolinemutationcellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterintestinesliving deadmolotov cocktailcremationgerman shepherdblack manpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillypatricidequarreloffscreen killingfriends who live togetherhandshocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manimprovised weaponfade to blackfamous lineghoulheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieremadenational guardmultiple cameosdrive in classicporchtire ironanthropophagusmass deathrefugeends with deathjarentrailshorror movie remadezombificationhunting rifleheadshothell on earthlivermeat hooknon personbabehole in chestblack man white woman relationshipmutilated bodyreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenushit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | supernaturalindependent filmcult filmcoming of agesuspenseconspiracyfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | evildeathmurderfriendshipsurrealismfeardrunkennessescapedancedeceptionvoyeurismbrutalitysupernatural powerparanoiaillness …sadismunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All) |
| Mood: | nightgorerainavant gardeslasherdarknessstylization |
| Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
| Characters: | police officerboyfriendteenagerdoctorteenage girlfemale protagonistteachergirlstudentsister sister relationshipkillerpsychiatristprofessorwitch …germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
| Period: | 1970syear 1977 |
| Story: | reanimated corpsegrindhouse filmhearing voicesbathroomcorpseone word titleviolencebloodflashbackdogcigarette smokingdancingexplosionknifechase …surprise endingtelephone callfirevoice over narrationblood splatterslow motion scenesecretfalling from heightshowdownpianodemonhallucinationvoyeurtelephonesubjective cameraswimminggood versus evilfoot chasewineambushstrangulationstabbingdeath of friendthroat slittingimpalementstabbed to deathtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotmissing personcover upcollege studentlightningscreamhangingdisappearanceinjectionsuspicionmurdererfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperingwormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalstabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
A man is released from prison after serving ten years for murdering an elderly woman. He quickly begins to feel the compulsion to kill again. After failing to murder a cab driver, he flees and discovers a secluded rural home, where a young woman lives with her sick mother and disabled brother. He th …en begins to take out his sadistic pleasures on them, attempting to hold them hostage, while thinking of his troubled childhood with his abusive mother and grandmother... (Read More)
| Subgenre: | cult film |
| Themes: | evildeathmurderrapeprisondrinkingescapevoyeurismmemorypsychopathbrutalitymental illnesssadismhome invasioncruelty …traumapsychological trauma (See All) |
| Locations: | kitchenrestaurantcarbathtubtaxipolice carsex in a car |
| Characters: | police officerpoliceserial killerlustout of control |
| Story: | homestreethousebathroomviolencebloodfemale nuditynuditybare breastsfemale frontal nuditydogfemale rear nudity …female full frontal nudityknifeleg spreadingpantiesbased on true storytopless female nudityvoice over narrationfondlingblood splatterfoodsex in bedcar crashcafevoyeurbound and gaggedstabbingeatingstabbed to deathfemale pubic hairwhite pantiesscantily clad femalepantyhoseold womandrowningblack pantiesdangerfemale removes her clothessuspicionmurderergaragegirl in pantiesmaniaceyeglassesfemale stockinged legsno pantiesnipples visible through clothingdesperationpsychocoitushomicidepillsmercilessnessbroken glassanxietypanties pulled downred pantiesdark pastliving roomtan linefemale in showerreckless drivingcopulationpsycho killerstolen carpsychopathic killermadmannecrophiliagatecar drivingnudemini dressstaircaseblack pantyhosesexual perversionsexual violencebroken windownude girlbackyardmistakemurder attemptnervousnessmultiple murderknife murderriskanguishroadangstclumsinessloss of controlsidewalkmultiple homicideruthlessnesssnorricamsexual crueltyperilstaringdachshundirrational behaviorjeopardybloodstainimpulsivenesssexual deviantdangerous drivingmultiple stabbingsbig housefemale taxi driversex on a chairsex on a pool tableprison releaseerratic behaviortan panties (See All) |
Karen Davis, an American Nurse, moves to Tokyo and encounters a supernatural spirit who is vengeful and often possesses its victims. A series of horrifying and mysterious deaths start to occur, with the spirit passing its curse onto each victim. Karen must now find away to break this spell, before s …he becomes its next victim. (Read More)
| Subgenre: | supernaturalpsycho thriller |
| Themes: | deathmurdersuicidemarriageghostjealousyadulteryfearsupernatural powerdating |
| Mood: | goreneo noirhorror movie remakemurder suicide |
| Locations: | hospitalcemeterybathtubbuselevatorjapanpolice caroffice |
| Characters: | police officerpolicefamily relationshipshusband wife relationshipmother son relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistteachernursedetectivelittle boysecurity guardjapanesepolice detective …professorterroramerican (See All) |
| Story: | haunted housesinkcrime scenecorpseshowerflashbackmale frontal nuditytwo word titlephotographsurprise endingcell phonecomputercatfalling from heightstabbing …nonlinear timelineritualold womandrowningstalkercursemissing persondiaryneck breakingfirst partarsonwaitergothicragemorguetokyo japanvisionsonhousewifeatticbalconysocial workerbuddhismloss of husbandgothreal estate agentvideo surveillanceclosetelderlymailshockmurder of wiferealtorpet catsurveillance footagevcrvideo cassettestairwellghost childfilicideinter culturalspider webcarecatatoniaremake by original directorwraithremake of japanese filmdrowning someonebroken electronic workssevered jaw (See All) |
A couple encounters a perverted gas station attendant who threatens them with a shotgun. They take a deserted path in Texas to seek help, but only meet up with a cannibalistic clan interested in helping themselves to fresh meat.
| Subgenre: | independent filmblack comedysuspensefish out of watersurvival horror |
| Themes: | deathmurderrevengekidnappingbetrayalfeartortureescapedeceptionvoyeurismpsychopathbrutalityparanoiadysfunctional familyinsanity …sadismpaniccannibalismself sacrificemurder of family (See All) |
| Mood: | nightgorecar chaseslasher |
| Locations: | kitchenforestcemeterydesertwaterwoodswheelchairpolice carroad triplaketruckgas stationtexas |
| Characters: | police officerpoliceafrican americanboyfriend girlfriend relationshipserial killerhostagelittle girlself mutilation |
| Period: | 1980s1990s |
| Story: | dinner tablecrime scenepresumed deadbathroomcorpsebloodviolencecharacter name in titlesequelgunfightcigarette smokingphotographexplosionknife …chasesurprise endingpistolfireshootoutbeatingshot to deathblood splatterfistfightmachine guncar accidentmirrorshot in the chestblondeshotgunrescuepunched in the facecameragunfightbrawlrifleheld at gunpointrunningrock musiccar crashinterrogationvoyeurrevolverf wordsurvivalfoot chaseorphanflashlightbound and gaggedambushaxeimpalementstabbed to deathtoiletstabbed in the chesttied to a chairexploding carbrunettesevered headman with glassesdisarming someonehit by a cardouble crossgraveyardthird partdrowningracial slurstalkercharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingperson on firecowboyproduct placementrace against timedollevil manknocked outkicked in the facedeath of childskeletonshot in the shoulderstalkingmurdererthreatened with a knifesevered armshot in the armdismembermentchild murdermaniacpickup truckchainsaweavesdroppingwolfburned aliveelectronic music scorejeepgothiclooking at oneself in a mirrorsociopathlifting someone into the aircowboy hatroman numeral in titlehammerkicked in the stomachcovered in bloodskullhitchhikerpeeping tomfemale killermasked manmechaniccamera shot of feetredneckwoman in jeopardydamsel in distressfight to the deathgrandfathercannibalmercilessnessshot in the facecigarette lighterlostswamppunched in the chestassault riflebooby trapblood on shirtone dayhighwaydisfigurementbody landing on a cargasolinesevered legethnic slursequel to cult favoriteburned to deathmasked killermoral dilemmaflat tiresouthern accentshot through a windowpervertcar troubleyellingface maskpistol whiphuman monsterlightermental retardationhomicidal maniacrestroomamputeefarmhousedouble barreled shotgunflarehanging upside downfilm starts with textdeputyhillbillymercy killingman kills a womanroad accidentwoman kills a mandeath of boyfriendkiller childcar set on fireoverturning carmurderessdeath of familypsychological torturehit with a hammerloss of familysledgehammeranimal killinglifting person in airknocked out with a gun buttbody partlifting female in airno endingbear trapsevered eargas station attendantcar wreckdecomposing bodyjumping from a carbased on supposedly true storytireleg braceracist commentroadkillhit with a rocktire ironwater bottleanthropophagusone armed mantoolevil laughtershot in the earsurvivalisthook for handjackhammermeat hookarmadillochainsaw murderleatherfacebased on ed geinrolling down a hilltracheotomywearing human skinhouse of horrorsvoice boxcannibal familyunearthed skeleton (See All) |
When hundreds of videotapes showing torture, murder and dismemberment are found in an abandoned house, they reveal a serial killer's decade-long reign of terror and become the most disturbing collection of evidence homicide detectives have ever seen.
| Subgenre: | mockumentaryfound footageamerican horrorindependent horror |
| Themes: | evildeathmurdersuicidekidnappingrapefeartortureescapeinvestigationcorruptionpsychopathbrutalityguiltinsanity …humiliationsadismhome invasionexecutionexploitationcrueltypanictraumamadnessmurder investigationmysterious deathpsychological trauma (See All) |
| Mood: | nightgoreslasherdarkness |
| Locations: | hospitalcemeterywaterpolice carroad tripgas stationpennsylvania |
| Characters: | police officerpoliceprostitutegirlserial killerlittle girlvillainterrormysterious villainserial murdererout of controlmysterious killer |
| Story: | streethousebathroombedcorpseshowerviolencebloodfemale nuditynudityfemale frontal nudityinterviewbondageknifepanties …telephone callcryingbeatingblood splattercameramasktearsrunningtelephonereportersubjective cameranewspaperbedroomjournalistbound and gaggednew yorkaxevideo camerastabbingthroat slittingstabbed to deathprisonermapchild abusefalse accusationman with glasseschildgraveyardnews reportlooking at the cameratalking to the camerastalkerbeaten to deathscreamingfbimissing personevil mantragic eventstalkingautomobilethreatbasementtrapmurderernewspaper headlinedismembermentkillingchild murdermaniactv newsbreaking and enteringballoonsexual abuseragemutilationsecurity cameracaptivefbi agentassaultvideotapedesperationpsychogrindhousevictimjournalismdriving a carrapistdead womantowelhomicidemasked mansubmissionslaverampagehookersufferingcouchkickingmercilessnessball gagstabbed in the neckanxietybutcherdespairscene after end creditspedophiledisembowelmentsurprisehandheld cameraperversiondead manmurder of a childhighwaybody countfemale reporternervous breakdownliving roominjusticecellarkilling spreemisogynychloroformpsychoticmasked killerpsycho killersurprise after end creditsdead girlpervertpsychopathic killerbad guymadmanmysterious manbrainwashingnecrophiliaset uppedophiliamisogynisthuman monsterhogtiesex slavesexual perversionsexual violencehomicidal maniactv reportermasochismslashingdegradationframednihilismamputationkidnappermissingdnasnuff filmsawnaked dead womandecadencemenacenervousnessdeath sentencemultiple murderchild molestertormentknife murderfemale prisonerpsychological tortureriskanguishbloody violenceroadfemale victimangstsadistic psychopathtapetalking while drivingmolestationmurder of a nude womanmurder spreecriminal investigationdisturbed individualbutcheryvideo cassettecrime spreecaptivitymissing daughterdepravityloss of controlfemale journalistsidewalkmissing girlstockholm syndromechild killedmystery killerfetishismmass mediamultiple homicideruthlessnessviral videosexual sadismchild killercreepysexual crueltychild murdererbreakdowndisturbingperiltorturerdead prostitutedehumanizationmissing womancollapsemasked womanknife attackserial child killerperversity911 callgrave robbingeast coastpsychological tormentgruesomeparaphiliadeviant sexglass of waterkidnapped womanunknown killerfemale fbi agentjeopardyinhumanitynecrophiliachelplessnessjustice systemmysterious personfbi investigationsexual devianttorture victimoutragephysical torturebound in chainsbrutalwoman in toweldna testhomicide investigationkidnap victimbrainwashassailantdysfunctionalityserial child murdersexual aberrationfemale slavedisturbed personfbi profilerloss of humanitydysfunctional societyneedlesprowlerfemale captivechelsea smiledefenselessnesstormentorphysical tormentpoughkeepsie new yorkdepravationhandsawdisturbed man (See All) |
A team consisting of a physicist, his wife, a young female psychic and the only survivor of the previous visit are sent to the notorious Hell House to prove/disprove survival after death. Previous visitors have either been killed or gone mad, and it is up to the team to survive a full week in isolat …ion, and solve the mystery of the Hell House. (Read More)
| Subgenre: | paranormal phenomenabritish horror |
| Themes: | evildeathghostinvestigationsupernatural powermadnessscience versus supernatural |
| Locations: | trainengland |
| Characters: | husband wife relationshiplustcatholicsex with a ghost |
| Story: | haunted househousebathroomcorpseshowerbloodbased on novelcatsecretscientistgood versus evilbedroomold manmansionapology …man with glassesfive word titleargumentpossessioncrossisolationhauntingpsychicrecord playeroccultspiritfireplacegothicscene during opening creditscrucifixwristwatchvisittorchresearchmillionairebroken glasspsychotronicsculpturechristmas evefogshadowdark pastopening a doorcellarapparitiongateold dark housescene before opening creditsseanceevil spiritstaircasechandelierlying on bedmediumwarningmoustachemicroscopepsychic powerchapeldead catwaking upblack catold housefinding a dead bodysleepwalkingblanketclairvoyantpoltergeistscreaming womanman slaps a womannightgownphysicistkeysscreenplay adapted by authorhidden roomhidden doorwine cellarwoman in bedman in wheelchairman and woman in a bedman in bedcabinetphenomenondecemberdining roomdecomposed bodyhidden corpseparapsychologyold mansionelectromagnetismovernight in a haunted houseforebodingcat attackiron gatereference to mount everestunlocking a door (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com