Please wait - finding best movies...
Reeling from the unexpected death of her husband, Beth is left alone in the lakeside home he built for her. Soon she begins to uncover her recently deceased husband's disturbing secrets.
Subgenre: | supernatural thrillersupernatural horrorghost storypsychological horrorbritish horrorfamily tragedysupernatural |
Themes: | supernatural powercheating deaththe devilnear death experienceself sacrificemental illnessgriefdepressionfeardrinkingghostsuicide |
Mood: | high schoolnightnightmare |
Locations: | forest lakelakewoodsboatforestschoolbar |
Characters: | night terrorsuicide by gunshothusband wife relationshipneighbor neighbor relationshipchristianserial killerteacherfemale protagonistfriendafrican american |
Story: | haunted houselake houseboat dockdrinking winesuicide of husbandsundance film festivalbookstore clerkwatching a home moviehome movie footagecheating husbandelementary school teacherhigh school teacherbuilding a houseswimming in a lakegrieving widow …young widowwalking in the woodssecret from wifekeeping a secretsecret lifeslamming someone's head into a mirrorwaking up from a nightmarefogged mirrornightmare sequencewriting on a mirrorbolt upright after nightmarecracked mirrorbroken mirrorlooking at oneself in a mirrorexcessive drinkinghigh school studentdream sequenceworrying about a friendhorror moviehorror filmreflection in a glass windowproduction companysecretly photographedunexpected visitorsleeping at worklittle league baseballauditory hallucinationthe other sidehiking trailman attacks a womanbelief in ghostsbody wrapped in plasticdifficulty breathinggrieving widowerthrown down stairscoming back to lifedistorted soundsound designbloody footprintfloor planangry womansleep paralysisupside down camera shotbook storeman murders a womanwall clockdepressed womanfootprintsvisual hallucinationwedding videoviolence against a womanlate for workwaving goodbyedisembodied voicesecretsjump scarewalking a dogsundancewind chimenew york statefeature filmhallloud musicvoodoo dolllooking in a windowjumping off a cliffdiscovering a dead bodyapple computerbrandyframed photographhauntedscreaming womansuicidal thoughtsdeal with the devillabyrinthfinger guntext messagecircular staircasewatching a videobechdel test passedhiding under a bedlocked doorman kills a womanschoolteacherbearded manhusbandfriendship between womenlooking out a windowhuman sacrificespecial effectsmazedocksaving a lifeserial murderlaptop computeralarm clockbookstorelostmourningremote controlwoman in jeopardyhomecrying womanarchitectscene during opening creditsoccultblack americanreference to william shakespearehauntingdarktragic eventritualhousewidowwinesubjective camerasecretdrinkslow motion scenemirrordreamcell phonemale nudity (See All) |
A darkness swirls at the center of a world-renowned dance company, one that will engulf the troupe's artistic director, an ambitious young dancer and a grieving psychotherapist. Some will succumb to the nightmare, others will finally wake up.
Subgenre: | supernatural thrillersupernatural horrorpsychological horrorsupernaturalindependent filmsuspenseconspiracyparanormal phenomenapsychological dramadark fantasyart horrorbody horrorcult horror |
Themes: | supernatural powernear death experiencefearghostsuicidemurderdeathrevengesurrealismkidnappingreligionmoneypoliticstortureescape …dancemonsterinvestigationdeceptionmagicmemorybrutalityterrorismredemptionguiltinsanitydatinghumiliationsadismevilcrueltypanicregretmysterious deathgerman politicsdying motherdance ritualdance student (See All) |
Mood: | nightnightmaregorerainbehind the scenesarchive footageavant gardedarknesshorror movie remakemurder plotatmosphereblood and goreritual murderslow burn |
Locations: | schoolrestauranttraintaxirural settingkitchenapartmentpolice stationfarmtrain station |
Characters: | husband wife relationshipteacherfemale protagonistpolicemother daughter relationshipdoctorsingerteenage girlpolice officerdetectivedancerhostagemotherpolice detective …teacher student relationshippsychiatristmaidwitchterrorrussianfrenchgermanamerican abroadself mutilationdance teacherevil witch (See All) |
Period: | 1970syear 1943year 1977 |
Story: | broken mirrorlooking at oneself in a mirrorhorror filmreflection in a glass windowdifficulty breathingsecretslooking in a windowframed photographschoolteacherfriendship between womenhuman sacrificeserial murderwoman in jeopardyscene during opening creditsoccult …hauntingdarktragic eventritualwinesubjective camerasecretslow motion scenemirrordreammale nudityfemale nudityf ratednuditybloodviolenceone word titlefemale frontal nudityflashbackmale frontal nuditymasturbationmale rear nuditygunkissfemale rear nudityfemale full frontal nuditycigarette smokingdancingphotographmale full frontal nudityexplosionsingingknifelesbian kisssurprise endingpistoltelephone callfiretopless female nuditycryingsongcorpseblood splatterfoodhorseurinationremakerescuewatching tvshowdownliesunglassesbombrunningcafebathroomcollegedemonhallucinationtelephonef worddecapitationgood versus evilsurvivalnewspaperambushold manstabbingmontagethroat slittingbridgeeatingimpalementstabbed to deathtoiletstabbed in the chestfemale pubic hairsubwaymapapologyculttrialradiodisarming someonedrawingdouble crosssearchnews reportold womanpaintrainingflash forwardcursebeaten to deathdangerstabbed in the backprologuescreamingprotestwidowerumbrellaauditionpossessionrace against timesuitcasemissing personcover upcollege studentlightningscreamfarmerdiarylong takemanipulationdisappearanceexploding bodywitnesssuspicionballettypewritergraffitisubtitled sceneberlin germanyriotpickup truckeyeglasseseavesdroppingtv newsdestinydestructionrevelationnipples visible through clothingelectronic music scoregothicheavy rainlistening to musictape recordercomamutilationdemonstrationexploding buildingwitchcraftpsychologydesperationcovered in bloodmind controlcrying mandead womanbroken leghomicideambitionchokingpassporthaircutrampagebarefootdamsel in distresscameohaunted by the pastface paintsufferingcouchhypocrisyblood on faceintrigueconfrontationstabbed in the throatbackstagemercilessnessstabbed in the neckdeath threatplot twisttitle appears in writingdespairdelusionimmortalityescape attemptmentorsculpturearchival footagestabbed in the legscene after end creditsexploding headrivallaughterdisembowelmentshadowsoultitle at the endboarding schoolrainstormslaughterwedding ringdark pastdressing roombarefoot femalebody countpastorbroken armroombruisekilling spreeblack magicpajamastelekinesisbloodbathnewspaper clippingholding handspipe smokingsurprise after end creditsmedia coveragesintelepathydead girlfemale female kissactress playing multiple rolesgothdormitorypost world war twoblood on camera lensintestinesprayinghysterialiving deadlevitationfinal showdownapparitionbodydark secrettractorohioscene before opening creditsspiral staircasemetaphorsubway stationjournalstairwayevil spiritchoreographycorporal punishmentdiscoveryabandoned houseborder crossingperformerfarmhousewallstabbed in the armsatanismredheaded womanwhisperingyoung womanhearing voicesurinepiercingwetting pantscigarettehand over mouthnihilismballerinamercy killingsoupmissingtesttrain ridetutorchandelierepilogueatrocityseizurehijackingvanityextreme violencemacabrenewscastfemale police officerberlin wallreading a newspapermenacemurderessbloodshedtragic pastoverhead camera shotjumpingchapter headingsdistrustradio newsbloody violencevotinggiallofemale victimmind readingpentagrampsychotronic filmchoreographerkiss on the cheeksecret passagehouse on firescythebonebilingualismrebirthred hairhooksecret roomleg woundsinistertrancecryptrevolving doorhorror artballet dancerpower strugglechantingmentor protege relationshipspiritualismjumpmissing girlfemale sitting on a toiletsubway trainkeyspolitical protestbloody faceportrait paintingdecomposing bodyenglishwoman abroadspectatoramishcult leaderacademyruthlessnesssong and danceel trainbarefoot womansecret passagewaywatching someoneemaciationbeing watchedmodern dancesweatingpokiesstabbed with a knifesatanic cultbreakdownred lightsatanic ritualconvulsiondining hallevil powersick motherborder guardscreaming in painfemale star appears nudedance studiofrenchwomaninstructorpitysoundtrackpsychotherapistsubliminal messagewalking in the rainagonyactress playing male rolefiendheavy breathingplayingjarcovenentrailsmatriarchymysterious eventswest berlin west germanyblood on the floorpsionic powersurrogate familypaintbrushschool expulsiondollar billnewsstanderased memorysoul transferencestrange personvaliumeast berlin east germanymeat hookmysterious disappearancemysterious eventrotting corpsec wordfemale corpsefile cabinet40 year oldback in timepessimismspooningaryanyear 1948ritual sacrificedance rehearsalspoken inner thoughtsearthwormdance performancereading in bedurinating in fearmysterious personreanimated corpsereference to frederic chopinreflection in a mirrordark killerill mothernude dancingsmall penisballet schoolexperienceurine samplecatacombssessioncivil unrestairplane hijackingdark powerwitchesbroken bonebroken jawclothes ironfalling to the groundmatronreference to johannes brahmsshushingsupernatural murderturmoiltryoutblindspantingsee through gownfracturesadistic torturethroat slitbaader meinhofdance practiceideaunrestcrypticgroaningtransference2015crying teenage girldance auditiondevil worshiperboeing 707dance recitalblood traildance companyprima ballerinasevered spinewitches' covenhaunted schooltriple roleurinating on the floorwhite paintbreaking mirrorcompound fracturedance academynude dancerred army factionchest ripped openlistening to music on a radio (See All) |
A young girl, passionate about fashion design, is mysteriously able to enter the 1960s where she encounters her idol, a dazzling wannabe singer. But 1960s London is not what it seems, and time seems to be falling apart with shady consequences.
Subgenre: | supernatural thrillerpsychological horrorbritish horrorsuspensemurder mysteryteen horrorpsychological thrillerpsychologicalzombie comedy |
Themes: | supernatural powernear death experiencemental illnessfeardrinkingghostsuicidemurderdeathrevengesurrealismrapemoneydrunkennessescape …investigationdeceptionmemoryangerbrutalitytime travelinsanityabusebullyingexploitationpanicfashion (See All) |
Mood: | nightnightmaregoreraindarknessambiguous endingblood and gore |
Locations: | restauranttrainnightclublondon englandtaxiurban settingapartmentpolice stationpolice carcityenglandtaxi driverbrotheltrain station |
Characters: | serial killerteacherfemale protagonistpoliceteenagermother daughter relationshipsingerteenage girlprostitutepolice officerstudentdancerkillerinterracial relationshipmother …police detectivepimpgrandmother granddaughter relationshipaunt nephew relationshipgo go dancerex policemandancing girlmean girl (See All) |
Period: | 1960syear 1969year 1967year 1960 |
Story: | waking up from a nightmarenightmare sequencebolt upright after nightmarebroken mirrorlooking at oneself in a mirrordream sequencehorror moviehorror filmdistorted soundupside down camera shotwaving goodbyejump scareframed photographserial murderalarm clock …scene during opening creditshauntingsubjective camerasecretdrinkslow motion scenemirrordreamcell phonemale nudityf ratedbloodviolenceflashbacksex scenekisscigarette smokingdancingphotographsingingpartyknifechasesurprise endingtelephone callfiresongcorpseblood splatterblonderescuepunched in the facelettershowdownlieplace name in titlebedprostitutionhallucinationbritishtelephonehalloweenorphanambushold manambulancestabbingmontagethroat slittingfour word titlestabbed to deathsuicide attempttoiletstabbed in the chestsubwaymodelfalse accusationapologydrawinghit by a cardouble crossold womanbartenderflash forwardconfessiontheaterattempted murderlibrarydrug addictstalkerscreamingchampagnepoisonumbrellaauditionproduct placementrace against timesuitcasemissing personcollege studenthalloween costumemanipulationscarstalkingautomobilebasementpolicewomanclasssleepingpsychicpubnewspaper headlinerecord playerflirtingapplauseeavesdroppingfalling down stairsteaburned aliverevelationelectronic music scoredresshypodermic needlegothicheavy rainlistening to musicrecordingtitle based on songgossipphone boothfemale singergrindhousefollowing someoneschizophreniastreet lifepromiseinterracial romancehaunted by the pastnicknamevisionface paintbraverymobile phonenostalgiastabbed in the throatbackstagehatredstabbed in the neckplot twistheadphonesscissorslaughterpridetitle at the endrefrigeratordark pastdressing roomroomdead motherhalloween partymannequinlocation in titlefirefighterdrugged drinkfiremanbeing followedpervertmental healthmysterious mannew jobrepeated scenespiral staircasefemale teacherstairwayname callingjukeboxnaivetycoca colapeer pressure18 year oldwhisperingyoung womanfashion designerinterracial kisscostume partynewspaper articlefilm starts with textlandladygiving a toastchandelierretrofashion showburlesquecrazinessgurneydesignerpsychic powerinterracial couplefemale police officerrepeated linemurderessrighteous ragetragic pastoverhead camera shotreference to james bondfemale bartendercockney accentold househouse on firefade to blackbreaking a mirrorgrindhouse filmpolice sirenclairvoyantrentred herringvinylboarding housedeeply disturbed personbarmaidwomen's bathroombloody faceshowgirlabusive relationshipbig cityred light districtcliquepainted faceyoungdoorbellmirror ballrainy nightcigarette holderdorm roomtaxi ridefemale serial killerhand kissingoxygen masksocksblond hairdouble decker busjoke tellingseamstressneon signaspiring singerdreamsblowing a kisssedativeskeleton costumeclairvoyancegiallo esqueshooting upclassmate classmate relationshipstar died before releasemanipulative mannightclub ownerover the topaudio flashbackcrime victimroommate roommate relationshipechomicrofilmoverhearing a conversationdoor lockfake namefemale murderermurder by stabbingseeing dead peoplemurder confessionrecord albumschool libraryafrican angloarchivesfilm with ambiguous titleslamming a doortitle mentioned in songwoman murders a manmusic managerpast and presentcalling for helphickeylistening to music on headphonesmaking a filmpoisoned drinkpink dressreference to cleopatrareflection in a mirrorbreaking through a wallpacking a suitcasewinkingalmost hit by a carlatenesspiccadilly circus londonsoho londonawakened by alarm clockbroken dreamkilling in self defenseurban gothicfashion designscene during closing creditsroom for renttrafalgar square londonvintage clothingchorus girlcommitting suicideflat sharegin and toniccollege acceptance letterdeceased motherfaceless manfacial woundheroin injectionpresent dayrunning in the rainimitating fellatioblood on bodycrying teenage girllandlady tenant relationshiprenting a roomstrongtalent managersinging auditionaudio montagedifferent face in mirrorsmoke detector18 year old girlvomiting into a toilet bowlwriter director producerfame seekernewspaper archiveblowing a raspberrycollege librarydying one's hairmurder in self defensetragic villainessvoice over telephone callbouncing on a bedcoke candistorted visiondual storylinesforced into prostitutionpimp whore relationshippin cushionpub crawlworld's end (See All) |
A harmless game of "Truth or Dare" among friends turns deadly when someone—or something—begins to punish those who tell a lie—or refuse the dare.
Subgenre: | slasher flickteen moviesurvival horrorteen horror |
Themes: | supernatural powernear death experienceself sacrificegriefdepressionfearghostsuicidemurderdeathfriendshipsurrealisminfidelitybetrayaldrunkenness …escapeinvestigationdeceptionextramarital affairthefthumiliationrivalryevilunrequited lovepaniccannibalismhomelessnesstrauma (See All) |
Mood: | high schoolslasherdarknessambiguous endingmurder suicide |
Locations: | schoolbarhospitalbeachchurchdesertlondon englandapartmentpolice stationpolice carrooftopmexicogas stationusa |
Characters: | suicide by gunshotfemale protagonistfriendafrican americanhomosexualfather son relationshippolicefather daughter relationshipteenagerboyfriend girlfriend relationshipdoctortattooteenage girlteenage boypolice officer …nursedetectivepolicemanlove trianglebest friendgay kissinterracial relationshipalcoholichomosexualitypolice detectiveterrorcanadianamerican abroadself mutilationgrandmother granddaughter relationshiphomeless mancheating girlfriendcrying girlself inflicted gunshot woundsuicide by shootingsuicide by stabbingsame sex kiss (See All) |
Period: | 2010s |
Story: | looking at oneself in a mirrordepressed womandisembodied voiceframed photographtext messagewatching a videolocked doorcrying womanscene during opening creditsritualsubjective camerasecretslow motion scenemirrorcell phone …male nudityf ratednuditybloodviolenceinterviewflashbackmale rear nuditybare chested malegunsex scenefightphotographtitle spoken by characterpartyknifelesbian kisschasethree word titlesurprise endingpistoltelephone callfirecryingshot to deathblood splatterfistfightshot in the chestblondeshot in the headrescuepunched in the facebrawlbare buttfalling from heightlettershootingvomitinglieheld at gunpointbeerdead bodycollegedemonhallucinationclassroomrevolveralcoholshot in the backsurvivalfoot chaseorphanstabbingmontagethroat slittingimpalementstabbed to deathsuicide attemptstabbed in the chestinternetbrunetteapologynundisarming someonedouble crossold womantalking to the cameragunshotflash forwardattempted murderpublic nuditylibrarycursedangerstabbed in the backprologuecoming outperson on firefantasy sequencefugitivemissionpossessionproduct placementrace against timecollege studentmanipulationsplit screenlaptoppremarital sexshot in the armclasssacrificegraffitinewspaper headlineteenage sexfreeze framecouplecloseted homosexualgameburned alivebreaking and enteringbeer drinkinggay characterlistening to musicsexual abusesexual attractiongroup of friendsvandalismhammeraccidental deathyoutubebarefoot malevisitteenage protagonistfalse identitybroken legchokingdrug dealinghaunted by the pasttokyo japanattempted suicidejob interviewpool tablerejectionpunched in the stomachconvenience storemutetitle appears in writingrivalsexual harassmentaccidental killinggay sonfallbordergasolinestabbed in the eyebarbecueyoutubermale male kissdark pastbarefoot femaledemonic possessionburned to deathmoral dilemmasunbathingfemale female kisstext messaginginterrupted sexmale objectificationtaking a photographgay manpromiscuous womandark secretplaying poolrepeated scenescene before opening creditssenior citizenspiral staircaseyoutuber as protagonistsexual tensionsocial mediavideo bloghearing voicesvideo bloggertaking off shirtmedical studentcowgirl sex positioncrying femaleromantic rivalrycrotch grabcollege campusopen endedawkward situationhomeless personmanipulative behaviortragic pastdance sceneseductive behaviorcamera phonetaking off clotheshit with a hammervending machinepsychotronic filmdeath by gunshotbroken necku.s. mexico bordersurveillance footagecloseted gaymale male hugpointing a gun at someonetear on cheekdrinking from a bottledrunken womantalking to oneselfjumping from a rooftopbloody facereading a letterlearning the truthfemale vomitingbig ben londonhand injurypsychological manipulationbroken handtruth or darecollapsing buildingdeath by shootingmale nursesevered tonguetijuana mexicofemale star appears nudeforced suicideunfaithful girlfriendeye injurydrunk womanfantasy scenebroken backtalking during sextaking a selfiedeath by impalementprivate investigationeating human fleshhand bandagemale bare buttmysterious eventabandoned churchreference to instagramschool librarypossessed womanrepeated scene from a different perspectivelighting a candlereading a letter aloudarm injuryseductive manmute charactersetting a firetongue cut outpossessed mandeath by fallingreference to beyoncecar tripreading a magazinestabbed with a pendrunken girlgoogling for informationforced to drinkmute womanembarrassing nuditylocking a doorembarrassing male nuditywalking on a ledgelighter fluidwoman on top sexdopplegangerfalling from a rooftopmale star appears nudevomiting in a toiletvulnerabilitytraumatic memorywoman on fireevil smiledrinking vodkashooting oneself in the headconflict between friendssitting on the floorgirl girl kisssetting someone on firewashing one's face45 year oldcovering a dead bodycrotch grabbingdrunk girlforbidden zonescene repeated from alternative perspectivewalking on handshot stoveimaginary girlfriendstanding on a rooftop69 year oldforced coming outforced to eatgrabbing one's crotchpublic indecencyscene told from more than one perspectivesilent characterstate bordersurveillance video (See All) |
A woman is involuntarily committed to a mental institution where she is confronted by her greatest fear.
Subgenre: | suspense |
Themes: | depressionfeardrinkingmurderdeathfriendshipkidnappingdrugsmoneyjealousytortureescapefuneralinvestigationmemory …lonelinesspsychopathobsessiondrug useinsanityhumiliationunrequited lovetraumapolice investigation (See All) |
Locations: | woodsforestbarhospitalrestauranthotelcemeterywheelchairpolice carmotelrunning through the woods |
Characters: | female protagonistfriendafrican americanfather son relationshippolicefather daughter relationshipmother daughter relationshipdoctorpolice officernursepolicemanlawyergay kisspsychiatristemployer employee relationship …same sex kiss (See All) |
Story: | looking at oneself in a mirrordistorted sounddiscovering a dead bodyapple computerframed photographscreaming womansuicidal thoughtstext messagebechdel test passedlocked doorlooking out a windowserial murderremote controlwoman in jeopardycrying woman …black americanwidowdrinkslow motion scenemirrorcell phonef ratedbloodviolenceone word titleflashbackbondagedoggunkisscigarette smokingphotographknifelesbian kisschaseshowertelephone callvoice over narrationcryingcorpseblood splatterfoodface slappunched in the facewatching tvcomputerarrestletterbooklierunningdead bodycafebathroomhandcuffstelephonef wordreporternewspaperflashlightjournalistbrabound and gaggedold manstabbingmontagethroat slittingeatingtoiletapologyold womantalking to the cameracoffeeflash forwardstalkerhotel roomvirginprologuelocker roomfired from the jobmistaken identityscreambankflowersbusinessmanipulationamerican flaginjectionpursuitstalkingcrossisolationbasementmanagerthreatened with a knifetherapyhatefreeze framemaniaceavesdroppingtv newsdressjogginghappinesstied to a bedmorguehammerassaulttherapistimpersonationcommunityfollowing someonecrying manburialfalse identitydrug overdosemental institutionpromisetrappedsurveillance camerahypocrisymisunderstandingboston massachusettskicked in the crotchmental hospitalescape attemptmedical examinationmedicationsexual harassmente mailwedding ringstabbed in the eyetied feetsexual assaultasylumbencharrogancepsycho killermale virginfemale female kisstext messagingbeing followedtaking a showernarrated by charactermental patient12 year oldhit in the facefake identitydead fatherreading aloudtelling someone to shut upname callingsexual violencesocial mediagroup therapyhospital roommasturbation reference15 year oldgiving a toastpsychiatric hospitalfemale police officerreading a newspapermanipulative behavioroverhead camera shotcamera phonefirst person narrationhit with a hammertraumatic experiencefemale bosspsychotronic filmmurder spreesolitary confinementfinding a dead bodywrapped in a towelman in a wheelchairdeeply disturbed personcrying maletelephone numberhysterical womaninvestigative reporterbloody facemental asylumfemale in a showerrearview mirrorsecretly observingbossy womanpretending to be someone elsepsychological manipulationfalse namemanipulative womanoverheard conversationlocked inmedia frenzywatching someonehospital gownhysterical outburstbeing watchedmale nursecharacter appears on tvfemale hysteriacarrying someonedining hallwoman hits a mangiallo esquehandcuffed womanhospital visitnight shiftmanipulative manrestraining orderpsychiatric wardbed wetting911 callrubber glovesshallow graveinsurance companysearch warrantwetting oneselffalling down a hilldead body in a car trunkfake namec wordkidnapped womantaking a pilloverweight womanbank employeeoverweight manspoken inner thoughtsattacked from behindcalling for helppadded cellgoogle searchinsurance scammedicine cabinetwork ethicvideo calllocked in a car trunkpolice investigatorspurting bloodviolent manmentally unstable womanshock treatmentgoogling for informationmentally unstable protagonistcourt orderfalling to the groundsocial isolationinsurance claimpounding on a doorthe color bluewrist bandagefemale therapistflushing a toilethospital wardthrowing something at someonecrying for helpmale bondageinvoluntary commitmenthypocritical womanb wordjumping from a moving vehiclemother daughter talkthrowing a drink in someone's facearrogant womanemotionally unstable womanhysterical laughterlistening at a doorsitting on the floorstrapped to a bedhit in the headsecurity expertmedical restraintsstolen ringco worker co worker relationshipemergency callemotionally unstable protagonistfemale bondagementally unstable manpsychiatric carereference to patsy clinewetting one's pantswetting the bedwindow blindsapplying mascarabreaking someone's neckinternet searchmedical insuranceshot on iphonehospital orderlynever give upsex harassmentsleeping fully clothedsticking out tonguewashing one's handscovering someone's mouthemotionally unstable manhand on throatstealing mailtied to a wheelchair (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
Subgenre: | supernatural horrorsupernaturalcult filmparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | supernatural powerfearghostmurderdeathfriendshiprevengesurrealismkidnappingescapemonstervoyeurismpsychopathbrutalityparanoia …sadismevilpanicmysterious deathshower murder (See All) |
Mood: | high schoolnightmaregorerainslasherdarknesspoetic justice |
Locations: | schoolbarswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | husband wife relationshipserial killerteacherfriendfamily relationshipshomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girl …teenage boygirlstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | haunted househigh school teachercracked mirrorbroken mirrorlooking at oneself in a mirrorhigh school studentdream sequencebloody footprintlocked doorserial murderalarm clockhousesubjective cameraslow motion scenedream …male nuditycharacter name in titlenuditynumber in titlebloodviolencesequelmale rear nuditybondagedogbare chested malefightcigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdigit in titleunderwearblood splatterface slapshotgunwatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordfoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologybirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclassobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreetelekinesisnewspaper clippingpsycho killermale objectificationpsychopathic killertaking a showerbad guybarking dogmadmanstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlebreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonisthigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolecrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
Successful author Veronica finds herself trapped in a horrifying reality and must uncover the mind-bending mystery before it's too late.
Subgenre: | psychological horrorpsychological thriller |
Themes: | feardrinkingsuicidemurderloverevengekidnappingmarriagerapepregnancydrunkennessescapeangerracismbrutality …bullyingabductioncrueltyprejudicerape and revengerevenge murder (See All) |
Mood: | nightnightmare |
Locations: | woodsbarrestauranthotelairplaneelevatorpolice carsinging in a carsuvshed |
Characters: | husband wife relationshipfemale protagonistafrican americanfather daughter relationshipmother daughter relationshipsingergirllittle girlprofessorsuicide by hanging |
Period: | future |
Story: | looking at oneself in a mirrorhorror filmdifficulty breathingupside down camera shotman murders a womanframed photographscreaming womanfriendship between womenlooking out a windowlaptop computercrying womanscene during opening creditsblack americanwinedrink …slow motion scenemirrorcell phonesexbloodviolenceone word titleflashbackkissfightexplosionsingingchasetelephone callfiresongbeatingfoodhorseface slappunched in the facecomputerbookshowdownriflerunningdead bodyhallucinationhandcuffstelephonecandleaxestabbingeatingsearchcigar smokingcoffeegunshotflash forwardauthormicrophoneprologuechampagneumbrellatentscene during end creditslong takescarspeechpursuitcabinflowergeneralwhippingtrustwashington d.c.moonafricancivil warapplauseropetv newswaiterfireplaceburned alivebreaking and enteringslaveryhidingcrying mantorchrealitychokingslavefull moonhaunted by the pastnicknamewindpastnew orleans louisianaplot twistescape attempthit on the headlaughtersuperstitiondiscriminationlipstickracistalternate realitycapturelanternbigotrygunfiremiscarriagearrogancehorseback ridingbushpresentforced sexlouisianastairwayname callingfemale friendshipcommanderpolitical campaignflaskwhisperinggiving a toastwhistlingamerican civil warn wordvirginiastabbed in the shoulderoverhead camera shottextinggodracial discriminationwoman slaps a mankiss on the cheekanachronismbulldozerchainsbouquetfinding a dead bodyu.s. senatorplantationman slaps a womanfemale writercaptivitychantingpancakehorse drawn carriagebegins with textshacklesskypeconferencecrematoriumstabbed in the sidelocked inchild's drawingcorporalbusiness tripwhite horsevisual effectsstabbed with a swordapplying lipstickhandcuffed womanstabbedconfederate flagpatriarchyclotheslineslave laborwhite911 calltaking a selfiewoman with a gundragging a dead bodyforced laborpolitical electionreference to thomas jeffersonsneaking outtwo directorscheeringphdveganismancestryassimilationhotel suitekidnapped womannew york timesescape plansupervisorcolumbia universitydrinking champagnerevenge killingvideo callwatching a video on a computerhuman brandingturning the tablesyoga classchampagne bottleconfederate soldieracademiadragged by a horseshushinguberconfederate armyhorseback chaseyoga instructorfist bumpmultiple directorsbranding ironfemale slavebegins with a quotationhorse drawn wagonkid artrope around necksnapping fingerscotton fieldcrawling on the floorinterracial rapereference to robert e. leecivilpresent dayreference to william faulknerwake up callfailed escapegirls night outcivil war reenactmentfalling to the floorhit on the head with a riflerunaway slaveescape from slaverywoman hits a womandeliberate anachronismstructural racismcrawling on the groundinstitutional racismplantation ownerrestaurant hostessstealing a horseescaped slavegeorgetown washington d.c.historically black collegepicking cottonspelman collegestealing a bookcross pendantfacial recognitionsetting a building on firestealing a cell phoneankle tattooraising a flaguber driver (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo …od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
Subgenre: | ghost storyparanormal activity |
Themes: | supernatural powernear death experienceself sacrificeghostsuicidemurderdeathfriendshipreligionpregnancyweddinginvestigationpsychopathevilhome invasion …crueltytraumadevilpolice investigation (See All) |
Mood: | nightdarknessmoving |
Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
Characters: | husband wife relationshipneighbor neighbor relationshipchristianfemale protagonistfriendafrican americanpolicedoctornursedetectivepolicemanbabypriestreference to godlittle girl …killerchristianitypolice detectivecatholicterrorpregnant womanpregnantreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
Period: | 1970syear 1969year 1970 |
Story: | haunted housebook storejump scareframed photographscreaming womanbechdel test passedlocked doorbookstorehomecrying womanoccultritualslow motion scenef ratedcharacter name in title …bloodviolenceone word titleflashbackfightphotographtitle spoken by characterknifechasebased on true storytelephone callfirecryingshot to deathblood splattershot in the chestpunched in the facewatching tvcamerashootingbookneighbordemonhallucinationreference to jesus christgood versus evilfoot chaseflashlightname in titlestabbingthroat slittingsuicide attemptnonlinear timelinecultnunno opening creditsdrawingchild in perilnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollbaseball batscreamscargiftbasementsacrificegraffitiblood spattercouplerecord playerspiritdresslistening to musicspin offstabbed in the stomachtoyvisittaking a picturefalling to deathreference to satanblack and white scenethunderstormsoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voicesfilm starts with textlistening to radiofall from heightafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womansymboltraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firevinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequenceshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manlocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
The twenty-one year-old Timothy "Tim" Allen Russell is discharged from a mental institution by his psychiatric Dr. Shawn Graham completely healed from a childhood trauma where his father purportedly tortured and killed his mother before being killed himself by Tim. His sister Kaylie welcomes him in …the parking area and brings him home. Then she tells that they need to destroy an ancient mirror that she has found through working at an auction house. She then steals the mirror and the reluctant Tim follows his sister and has fragmented recollections from their childhood, going back to when his father Alan buys a mirror for the home office of their new family home. Kaylie and Tim see a woman with their father in his office and the behaviors of Alan and Marie change, ending in a family tragedy. Kaylie blames the mirror and now she wants to destroy it with Tim. Will they succeed? (Read More)
Subgenre: | supernatural horrorghost storyfamily tragedysupernaturalparanormalparanormal phenomena |
Themes: | supernatural powerghostsuicidemurderdeathadulteryescapeinvestigationdeceptiondeath of fatherobsessiondeath of motherdysfunctional familyinsanitytrauma …childhood traumamysterious death (See All) |
Mood: | nightmare |
Locations: | hospitalpolice car |
Characters: | husband wife relationshipfemale protagonistfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipboybrother sister relationshipgirlpolice officerpolicemanalcoholicpsychiatristself mutilationfiance fiancee relationship …colleague colleague relationshipcrying girlcrying boyghost in mirrorghost in a mirror (See All) |
Period: | year 2002 |
Story: | haunted housedrinking winecheating husbandcracked mirrorbroken mirrorlooking at oneself in a mirrordream sequenceframed photographscreaming womanwatching a videolocked dooralarm clockhomecrying womanhouse …mirrorcell phonebloodviolenceone word titleflashbackdogbare chested malegunfightphotographchasesurprise endingtelephone callcryingface slapremakewatching tvcameraarrestshootingbirthdayhallucinationhandcuffsrevolverfoot chaseorphanflashlightstrangulationvideo camerastabbed to deathaccidentapologyanimaltalking to the cameragunshotargumentcursepossessionstatuescreamdomestic violencescarloss of fatherreunionloss of motherredheadtherapystrong female charactersisterexperimenteavesdroppingnipples visible through clothingtold in flashbackhidingwatching a movietherapistaccidental deathvisitcrying manchokingmental institutionpromiseresearchblood on facestabbed in the neckhousewifemental hospitaldelusionsculpturehit on the headaccidental killingdeath of sisterabusive fatherlooking at self in mirrorlanternpuppyasylumchainabusive husbandchildhood memoryshot multiple timesauctionplantunfaithful husbandmale objectificationfianceemental patientbarking dogillusionrepeated scenealarmgolf clubvacuum cleaneranimal crueltyhearing voicesartifactbased on short filmmoving inloss of sisterpsychiatric hospitalcrying femalemysterious womanoverhead camera shotiphonespitting bloodtoy gunwoman slaps a manpsychotronic filmdog attackfeet on tablehusband murders wifebreaking a mirrorglowing eyesgrindhouse filmpointing a gun at someonetear on cheekabusive mothercaged animalcrying malejumping out a windowthreatened with a gunhysterical womanflickering lightbad dreammental asylumnew housearchival photographfiancesecretly observingskepticismhand injurymarital crisisoverheard conversationlocked ingolden retrieverhysterical outbursttimerbloody mouthchild murdererblood on handscomputer programmertalking to an animalwoman hits a mancrime scene photographdog biteadulterous husbandson murders fatheranchorwoman in a bathtubcaught cheatingtalking to a dogcheating on wifebloody handsingle locationband aidyear 1955private investigationhit with a golf clubblood on mouthlightbulbmagical mirrorchained to a wallabusive parentmysterious eventstrong female protagonistblood on wallchild's bedroommirror does not reflect realitypossessed womanrepeated scene from a different perspectiveanimal bitedead body in a bathtubblood on handhole in the walleating an applepacking a suitcasepossessed mansleeper holdloading a gunmale female fightsleeping shirtlesswatching a cartoon on tvbitten by a doghome officetelephone terrordragging someoneviolent manescape out a windowfemale alcoholiclabrador retrievermentally unstable womanspilled drinkdeath by stabbingbreaking a platepsychiatric evaluationabusive womanapple macintosh computergun pointed at faceviolent womanbrother sister reunionchained to wallcursed objectchained womanvacuum cleaningyear 1864attacked by dogbarbellglowing eyeson hits fatherbroken platetraumatic memoryescape by the windowemotionally unstable womanhandcuffed mansitting on the floorsleeping in underwearvertigo shotbiting fingernailsfinger injuryhusband wife fightparanormal researchwoman wearing a negligeebottle of waterbrother kills sisterco worker co worker relationshipemergency callfilmed paranormal eventyear 1904house plantman's best friendreference to william tecumseh shermanscene repeated from alternative perspectiveyellow pagesdelusional manmysterious figureremoving a fingernailsanity hearingviolent fatherwatching a cartoonbroken lampchain around neckchanging a lightbulbcovering someone's mouthdestroying a cellphoneex mental patientmom and dadrelease from a mental institutionscared by a mirror imagescene told from more than one perspectivescreaming boy (See All) |
In an effort to repair their relationship, a couple books a vacation in the countryside for themselves and their daughter. What starts as a perfect retreat begins to fall apart as one loses their grip on reality, and a sinister force tries to tear them apart.
Subgenre: | supernatural horror |
Themes: | the devilmurderdeathinfidelitymoneyjealousyadulteryfilmmakingextramarital affairtime travelguiltunfaithfulnesswealthmissing child |
Mood: | nightmaremurder trial |
Locations: | woodsnew york cityswimming poolbathtublondon englandtaxivillagemexicosex in a carcatholic school |
Characters: | husband wife relationshipafrican americanfamily relationshipsfather daughter relationshipmother daughter relationshipsingerwriterlittle girlolder man younger woman relationshipdaughteramerican abroad |
Story: | haunted housewaking up from a nightmarenightmare sequencebolt upright after nightmarelooking at oneself in a mirrordream sequencedifficulty breathingman murders a womanjump scareapple computerframed photographcircular staircaselocked dooralarm clockcrying woman …black americanhousewinesubjective cameramirrorcell phonesexbloodviolencesequelflashbackkisstelephone callvoice over narrationbeatingfoodcomputerwritten by directorlierunningdead bodyhallucinationtelephonef wordswimmingflashlighteatinginternetapologysearchdrowningflash forwardconfessionlegendargumentstalkercurseprologuevacationsuitcasecountrysidesuspicionsleepingtrustexperimenteavesdroppingfalling down stairswalkie talkiewristwatchsheepdrug overdosepromisenicknameconvenience storemovie settitle appears in writingescape attemptheavenlaughterfilm setprideshadowholding handssinfilm crewname callingwalesolder man younger woman sexclimbing a treewashing machineoverhead camera shotfilming a movietime loophusband murders wifekicking in a doorhide and seekmissing daughterjealous husbandmissing girlwoman moaninghidden roomfamily vacationloopwoman in a bathtubcold the temperaturefamily lifescreaming girlpolaroid photographseat beltmarital argumenttaking a pillmarital strifemurder by drowningattempted escapedead body in a bathtubdrowning in a bathtubnightmare becomes realityreflection in a mirrorolder man younger woman marriagefather daughter hugcriminal trialdripping watershadow playargument between coupletape measuredream sequence within a dream sequenceproduction assistanthusband wife kissstabbing oneselfwoman on top sexvacation homeoverflowing bathtubb wordfailed escapeworried fatherlost girlrevealing a secretcarrying a childcutting oneselfjournal writingscene repeated from alternative perspectivesinister forcecutting one's armpassive aggressive manspitting out a toothgirl in jeopardyscared childwatching someone die (See All) |
An immigrant in search of the American dream is forced to take a room in a boarding house and soon finds herself in a nightmare from which she can't escape.
Subgenre: | ghost storypsychological horrorbritish horrorsurvival horrorurban fantasy |
Themes: | mental illnessghostmurderdeathmoneyescapemonsterpsychopathpovertydying mother |
Mood: | nightmaremovingmysterious |
Locations: | barhospitalsmall townbusmotel |
Characters: | serial killerfemale protagonistfriendafrican americanfamily relationshipsmother daughter relationshipbrother brother relationshippolicemankillerhispaniccousin cousin relationshipemployer employee relationshipuncle niece relationshipcolleague colleague relationship |
Period: | year 1963 |
Story: | haunted housedrinking winelooking at oneself in a mirrordream sequencehorror moviehorror filmupside down camera shotframed photographscreaming womanbechdel test passedlocked doorhuman sacrificecrying womanritualhouse …secretf ratednumber in titlebloodviolenceflashbackfightcigarette smokingphotographshowertelephone callcryingbeatingcorpserescuewatching tvfalling from heightliedead bodyhallucinationf worddecapitationsurvivalflashlightthroat slittingdinerimmigrantsubwaycreaturesearchimmigrationflash forwardbeaten to deathfactoryscreambasementeavesdroppingclaim in titlekilling an animallistening to musictape recordercaptiveworking classvisitbroken legdamsel in distressvisionjob interviewfalling to deathhit on the headbutterflybarefoot femalelandlordillegal immigranttaking a showermysterious manworkerrepeated sceneold dark housespiral staircasetelling someone to shut upportalbroken windowhospital roomhearing voiceslistening to a radiocigarettefactory workerbreaking a windowmoving incrying femalechainedlighting a cigarettecollectortitle same as bookmysterious womantenantpsychotronic filmlockpackingleg injuryfootprintboarding housedrinking from a bottlemultiple murdersbloody facebad dreamfired from a jobfemale in a showerlearning the truthsecretly observinghand injuryoverheard conversationcharacter says i'm sorrylocked inbeaten upfemale ghostseamstressmothblood on handsaudio tapecarrying someonevoice mailid cardlimpinghospital visitcuttingaudio recordingmexican immigrantlooking through a keyholecounting moneydragging a dead bodyfoot injuryhealing powermoney countingchange in lifestyleseeing dead peoplemysterious eventbroken ankleoccult ritualill motherlandlord tenant relationshipoccultismpacking a suitcasemale female fightbiting someonespurting blooddragging someoneviolent manankle injuryforced to drinkhead bitten offlocking a doorchained womanbroken footmentally illcrying for helpdaughter murders mothermistaken belief that someone is deadserial killersbutterfly collectionlimping characterdownpoursitting on the floorslitting someone's throatlying on the floorsinging a lullabythroat slashingcutting someonemysterious figurepouring rainwashing one's handslimping womanserial killing (See All) |
Still irrevocably scarred by the trauma he endured as a child at the Overlook, Dan Torrance has fought to find some semblance of peace. But that peace is shattered when he encounters Abra, a courageous teenager with her own powerful extrasensory gift, known as the 'shine'. Instinctively recognising …that Dan shares her power, Abra has sought him out, desperate for his help against the merciless Rose the Hat and her followers. (Read More)
Subgenre: | supernatural horrorsupernaturalsuspensedark fantasy |
Themes: | supernatural powernear death experienceself sacrificefearghostsuicidemurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaltorture …drunkennessescapedeceptionmagicmemoryangertheftbrutalityobsessionredemptionsadismevilabductionhome invasionalcoholismpaniccannibalismhomelessnesstraumamissing childchildhood traumaunlikely friendship (See All) |
Mood: | nightmaregoredarknessambiguous ending |
Locations: | woodsforestschoolbarbeachtrainhotelsmall townbathtubbuselevatorapartmentbaseballgas stationcampfire …abandoned factoryself help grouphotel fire (See All) |
Characters: | husband wife relationshipserial killerafrican americanfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctortattooteenage girlzombiepriesthostagethief …vampirelittle girlnative americansingle motherlittle boyalcoholicsniperterrorself confidenceself inflicted gunshot woundself healing (See All) |
Period: | year 1980year 2011 |
Story: | haunted houselooking at oneself in a mirrorlittle league baseballman murders a womanjump scareocculttragic eventritualwidowwinemirrormale nudityfemale nuditynudityblood …violencebare breastssequelfemale frontal nudityflashbacktwo word titlebare chested malefightfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionsingingpartyknifechasesurprise endingpistolfiretopless female nudityshootoutcorpseshot to deathblood splattercar accidentshot in the chesturinationblondeshot in the headshotgunrescuewatching tvcatwritten by directorgunfightvomitingshowdownrifleheld at gunpointsunglassessecond partbirthdaycar crashbathroomhallucinationrevolveralcoholshot in the backf wordgood versus evilsurvivalbedroomgangambushaxemassacredisguisemontagebridgecocainetoiletstabbed in the chestfemale pubic hairbrunettecultcoffindrawingdouble crossbirthday partyfemme fataletransformationshot in the foreheadbartenderpainflash forwardattempted murderauthordrug addicthotel roomcharacter repeating someone else's dialoguedangerprologuescreamingpossessionmissing persontentstreet shootoutmanipulationamerican flagdisappearanceinjectionhairy chestgiftpremarital sextied upcharacter says i love youflowerprofanityshot in the armkissing while having sextypewriterpsychicpowerhenchmanbirthday cakefalling down stairssabotagesupermarketsyringeflyinghypodermic needlegothicsociopathhatcowboy hatmagicianbeardexploding buildingtwinsmovie theatervillainesswristwatchfloridadesperationfemale singerone night standirishteddy bearmind controlfollowing someonefateburialinterracial friendshipbar fightgun battleeaten alivewhiskeybarefootgypsyreverse footagehaunted by the pastgrocery storenew jerseyhatredjob interviewcannibalmercilessnesspool tableshot in the facehungerjunkiepeaceshoveldespairimmortalitytime lapse photographystabbed in the legrosepedophilemeditationbarbecuelonerdark pastlens flaresequel to cult favoritebenchburned to deathtelekinesiscoinarrogancetelepathymultiple storylinemagic trickcartoon on tvfinal showdownreturning character killed offhuman monstertwist endingtrailer homebaseball playermind gamewetting pantsbaseball capbaseball gameoffscreen killingnursing homefamous scorepsychic powertragic pastrecreational vehiclesole survivormind readingpsychotronic filmgang leaderreference to richard nixongrindhouse filmchild abductiontop hatleg woundchild swearingolder man young girl relationshipdecomposing bodycult leaderreference to frank sinatrabritish actor playing american characterhand injurylong island new yorkextrasensory perceptionyoung girlbroken fingerrecovering alcoholicghost childtwin sistersmagic showthrown through a windshieldnew hampshireboiler roomforced suicidemissing person posterbuilding on firefemale thiefclock towerlatin americanbloody handhuman preyshallow gravesurrogate familybaseball glovehunting rifleinitiation ritesleeping nudeteenage runawayinside the mindwoman murders a manastral projectionpool balltelescopic rifleblack man white woman relationshipviolence against a childabandoned hoteladult child friendshipgrabbed by the throatfemale sociopathcamper vanwoman in a bathfire axepsychic linkwhite catburying a bodylife forcementor student relationshipchildren in perilwooden boxaa meetingjack daniels whiskeymute boyhaunted hotelhouse flyopening creditsre enactmenthedge mazepunched in the face multiple timesreference to netflixyear 2019crashing into a treefather murderedinjection in neckmagical hatdigging up a gravevomiting into a toilet bowlblack man white woman kisscat and mouse gamesoul eatertrapped soulcrumbling to dustgirl in jeopardyman girl friendshipmodel buildingstabbed over and overwashing floor (See All) |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel … Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
Subgenre: | suspensegothic horror |
Themes: | supernatural powergrieffeardrinkingghostsuicidemurderdeathfriendshiprevengebetrayaladoptiondeath of wifevengeanceforgiveness …madnessdeath of daughterafterlifedeath in childbirth (See All) |
Mood: | nightmarerainhorror movie remake |
Locations: | woodsforestbeachtraincarbathtublondon englandvillagerural settingengland |
Characters: | husband wife relationshipfriendfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboygirlsister sister relationshipreference to godlittle girllittle boysingle fathersuicide by hangingbaby boy …ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All) |
Period: | 1910s |
Story: | haunted houselooking at oneself in a mirrorwaving goodbyehauntedlocked doorlooking out a windowlosthauntingtragic eventhousewidowsecretdrinkslow motion scenemirror …based on novelbloodviolenceflashbackdogphotographfirecryingcorpsefoodrescueletterpaintingtearsrunningdead bodycolor in titletelephonenewspapercandleaxemansioneatingaccidentdrivingchildbirdcoffindrawingsearchjourneygraveyarddrowningflash forwardgravecurseprologuescreamingkeywidowerperson on firedolldeath of childskeletonhangingcrossdeath of sonbasementreunionsuspicionloss of mothersleepingsingle parentfireplacecrucifixtoyloss of wifeeccentriclossrailway stationclockthunderloss of sonwizardthunderstormsuperstitiondead childatticfogmurder of a childvoice over letterlanternbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionold dark housemental breakdownlast will and testamentstairwayestateseagullknocking on a doorhearing voicespocket watchloss of childbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All) |
When Ellen, the matriarch of the Graham family, passes away, her daughter's family begins to unravel cryptic and increasingly terrifying secrets about their ancestry.
Subgenre: | supernatural horrorpsychological horrorfamily tragedysupernaturalfolk horror |
Themes: | supernatural powermental illnessfearghostsuicidemurderdeathfuneraldysfunctional familyevil |
Mood: | high school |
Locations: | hospital |
Characters: | husband wife relationshipfemale protagonistfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage boydaughtergrandmother grandson relationshipgrandmother granddaughter relationshipsuicide by hangingmother in law son in law relationship …death wishasking for forgiveness (See All) |
Story: | horror filmreflection in a glass windowdifficulty breathingdiscovering a dead bodylooking out a windowlaptop computercrying womanscene during opening creditstragic eventritualsubjective camerasecretcell phonemale nudityfemale nudity …bloodviolenceone word titlefemale frontal nuditymale frontal nuditydogkissphotographpartyknifesurprise endingtelephone callfirecryingcar accidentwritten by directordead bodydemonf worddecapitationfoot chasesevered headperson on firepossessionanswering machinepot smokingloss of loved oneart gallerycrying manunderage drinkingatticnervous breakdownfamily secretburned to deathphoto albumparking lottext messagingbarking dogbreast feedingdead fatherseanceevil spiritsecret societygroup therapy13 year old16 year oldhearing voicesantcrashing through a windowguitar playerutahacoustic guitarteenage crushoverhead camera shotdead birdmagnifying glassman on firetraumatic experiencesupport grouppsychotronic filmhip hop musicdeeply disturbed personjumping out a windowbegins with textrearview mirrormatriarchchild's drawingdollhousesatanic cultcaught in the rainmultiple personality disordercandy bartaking off shoesasthma attackdecapitated headsleeping on a sofaancestrybodily possessionemotional breakdownfly the insect7 year olddissociative identity disorderchocolate barmother daughter estrangementattacked from behinddecomposed bodytree housebanging head against wallreflection in a mirrorclimbing a ladderchocolate cakedecapitated childtrap doordisturbed childburnt corpseschool belllocking a doorbad guys wintelephone hangupemotionally disturbed personburning a bookclothes on fireopening creditsminiaturesholy trinitymail slotprescription bottlecrying teenage boypaint thinnerpsychotic depressiondigging up a gravefamily traumaminiature modelanaphylactic shockblack bloodspilled paintdoll housegasping for breathgraveside ceremonyheadless bodynut allergypainting with bloodreference to sophoclesbird flying into a windowdecapitated corpsedestroying a bookdistracted driverdrinking glassgrief counselingwelcome mat (See All) |
Marlo, a mother of three, including a newborn, is gifted a night nanny by her brother. Hesitant at first, she quickly forms a bond with the thoughtful, surprising, and sometimes challenging nanny named Tully.
Themes: | depressionfeardrinkingmurderfriendshipmarriagemoneypregnancydrunkennessmemorywealthautism |
Mood: | high schoolnightnightmareraindarkness |
Locations: | boatschoolbarhospitalnew york citybathtubbicycletaxikitchenshipgas station |
Characters: | husband wife relationshipfemale protagonistfriendfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorsingerbrother sister relationshipgirlnursedancerbaby …waitresslittle boyjapanesemothercousin cousin relationshipfatherparent child relationshipmermaidpregnant wifeold friendcrying babybaby girlbaby daughter (See All) |
Period: | 1980s |
Story: | drinking winelooking at oneself in a mirrordream sequenceloud musicscreaming womanbearded manfriendship between womenlooking out a windowremote controlscene during opening creditshousewinedrinkmirrorcell phone …f ratedone word titlebare breaststhreesomedogdancingnipplesphotographtitle spoken by charactersingingpartyshowersongwoman on topfoodurinationblondewatching tvvomitingliebeerrunningcar crashcafehallucinationrivertelevisionf wordbedroomflashlightbraeatingdinerdinnerapologyunderwater sceneroommatenecklacecoffeebartenderpainjeansmicrophonescreamingproduct placementninjasuitcaseamerican flagchildbirthbrotherflowersleepingtrustpizzasexual fantasytwenty somethingsisteritalianballoonlistening to musicjoggingtoyoverallsasian womanyoutubebrooklyn new york citybirthcrying mantorchbreakfastblack womanpromisenicknameface paintmobile phonespanishmiracleanxietyplot twistmeditationhot tubwedding ringrefrigeratorfemale doctorcanefamily dinnertrophybenchpajamasnannyparking lotmotherhoodgiving birthforename as titlebreast feedingfemale bondingmental breakdowntwist endinggolden showerblonde womanname callingdrunk drivingelementary schoolsplit personalityinterracial marriagequitting a jobpocket watchplaying a video gamepearl necklacemaking a movienewborn babystation wagonsoccer ballfilling stationgarbage truckwaking uphip hop musicportland oregondriving at nightyoung adultexpectant motherstory tellingfat womanforty somethingred winewhite coatrocking chairmicrowave ovenwomen's bathroomexpectant fatherdyed hairrearview mirrorwashing dishesbody imagebrother in law brother in law relationshipphoenix arizonahospital gownreference to mickey mousesaudi arabiajumping on a bedrich familykiss on the foreheadbare midriffbaby monitorsister in law sister in law relationshipstuffed toysleep deprivationfree spiritreference to justin bieberjunk food8 year oldbaby bornstrange behaviorchopsticks the eating utensilheavily pregnant mothermaternity wardfacial injurypacking a suitcasehuman resourceswoman in a bathface paintingautistic childfalling to the groundpregnant woman's water breaksschool bellweight gaingas pumpabsent husbandautistic sonflushing a toiletpastry shopfemale drivershort dressvomiting in a toiletcleaning houselaundry basketthree in a bedgirls night outbreastfeeding a babychanging a diaperchildren's partywaitress uniformmaternal instinctstealing a bicyclewaking up someonecar falling into waterreference to stevie nicksbrunette womancarousel horsegaining weightkaraoke machinesex discussionbushwick brooklyn new york citydrink umbrellafalling asleep while drivingman's best friendpostpartum depressionsocial security numberautistic boybaby cribchild raisinghawaiian musicshampooing hairwaking someonewater breakingmaternity leaveslapping butt (See All) |
In 1979, a group of young filmmakers set out to make an adult film in rural Texas, but when their reclusive, elderly hosts catch them in the act, the cast find themselves fighting for their lives.
Subgenre: | american horrorindependent filmmakingslasher horror |
Themes: | feardrinkingmurderreligionmoneyjealousyfilmmakingmemoryyouthsexualityexploitationmurder investigationamerican filmmaking |
Mood: | goreslasher |
Locations: | lakerural settingfarmpolice carstrip clubgas stationtexasbackwoods |
Characters: | husband wife relationshipserial killerafrican americanfather daughter relationshipboyfriend girlfriend relationshipsingerreference to godchristianitysherifffilm directorfiance fiancee relationshipamerican dreamslasher killer |
Period: | 1970syear 1979year 1918 |
Story: | looking at oneself in a mirrorhorror filmman murders a womanlooking in a windowframed photographscreaming womanhiding under a bedhusbandlooking out a windowserial murderwoman in jeopardycrying womanblack americansubjective camerasecret …drinkslow motion scenemirrormale nudityfemale nuditybloodviolencefemale frontal nudityflashbackgunsex scenekissfemale rear nudityfemale full frontal nuditycigarette smokinginterracial sexdancingtitle spoken by charactersingingknifesongcorpseshot to deathfoodshot in the chestshotgunwatching tvbeerdead bodyvoyeurreference to jesus christguitarstripperswimmingflashlightold manaxestabbingeatingcocainestabbed to deathapologyvanold womanskinny dippingpublic nudityon the roaddollscreamattempted rapefarmercrosssplit screenfilm within a filmmurdererchickenhandguncowhateheart attackcouplerecord playerpickup truckgamefamerecordingagingbarncrucifixoverallshidingvillainesscovered in bloodmovie directorcrying manmilkmexicancrime scenerear entry sextensionnicknametrappedold agestabbed in the neckporn starescape attemptreference to satanswampscene after end creditsfilm producerrefrigeratorstabbed in the eyepierdressing roomwar veteranexistentialismcasual sexcellarprequelone letter titlebeing followedactress playing multiple rolessermonpervertwifelarge peniselderlyfilm crewmovie producerstairwayblonde womanname callingfarmhouseplaying guitarpush upsporn actresscigarettehillbillycabin in the woodsmacguffinguitar playershot point blankalligatorhorninesswhite briefspondhome videoaspiring actresstraffic accidenthouston texasmurderessoverhead camera shotfilming a moviepitchforkcashlesbian subtextbloody violencesole survivortalking about sexmovie cameracriminal investigationnegotiationgrindhouse filmhatchetvietnam war veteranpointing a gun at someoneadult filmmakingreference to the devilnightgownfranchiseyoungfemale serial killerlocked inreference to alfred hitchcockwatching someoneperiodskintelevangelistbeing watchedporn producerabandoned carfunlemonadefemale star appears nudereminiscingshower sceneover the topbloody handelderly coupleunfinished filmdragging a dead bodyold coupleyoung peoplemilitary veteranimplied rape23 year oldamateur actressworld war one veteranbigger dreamswoman murders a manadult film directorcalling for helpwading in watercocaine addictpatiencerun overdead cowlistening to a car radiohead crushingdisagreementnaked dead mandog tagslong haired manmovie scriptstruggling actresswoman murders a womanlimping manman wrapped in a towelgas pumpwatching through a windowwedding photographadult filmwoman on top sexcut fingerex u.s. marinekilled by an animalkilled with a knifefemale porn starhusband wife sexfarmer's daughterhead crushedlocked in a cellaropening creditsfilming people having sexfemale pervertmale porn starpreacher's daughtershooting porntv evangelistpop culture referencespumping gas42 year oldfailed rescuenaked swimmingreference to fleetwood macromantic relationshipstepping on a nailfame seekerfemale voyeurlust for fameman in a bathtubsexual moresfame seekingaspiring film directorblack man white woman sexhead mutilated (See All) |
reviewed by: jennie kermode "the lodge hinges on a powerhouse performance from keough, who inhabits the troubled grace so completely that we can stay with her even as her ability to distinguish what's real and what isn't breaks down." | photo: courtesy of sundance film festival introducing a new par …tner to one's children is rarely easy. it's still harder for richard (richard armitage) because the kids blame grace (riley keough) for their mother no longer being around. wanting to give them the chance to get to know her properly and understand why he wants to marry her, he suggests a few days away at his lodge out in the snowy wilderness, where they can skate together on a frozen lake and celebrate christmas. he'll still have to go into work but, sulky though aidan (jaeden martell) and mia (lia mchugh) may be, he reckons they'll survive a couple of nights with grace in charge. perhaps they should. this is no conventional wicked stepmother tale. once richard is out of the picture the kids' efforts to avoid speaking to grace gradually break down. she tries to please them, preparing food, putting up seasonal decorations and letting them watch the thing. but then something happens that she could never have anticipated and all of the horrors of her own childhood - growing up in a religious cult whose members killed themselves - come flooding back to the surface. without the medication that has been helping her to keep herself together, she goes all out to try to keep herself an the … (Read More)
Subgenre: | suspensechristmas horror |
Themes: | feardrinkingsuicidemurderdeathchristmasreligionfuneralvoyeurismdivorcepsychopathdysfunctional familyguilttraumareligious cult …self harm (See All) |
Mood: | nightmare |
Locations: | woodsforestchurchrural settinggas station |
Characters: | suicide by gunshothusband wife relationshipchristianfamily relationshipsfather son relationshipfather daughter relationshipteenagerboyfriend girlfriend relationshipsingerboybrother sister relationshipteenage boygirlpriestreference to god …christianityex husband ex wife relationshipfiance fiancee relationshipreligious fanaticcrying girlsuicide by shootingsuicide by shooting one's self in the head (See All) |
Period: | winter |
Story: | drinking winewriting on a mirrorlooking at oneself in a mirrorwall clockframed photographscreaming womanwatching a videolocked doorlooking out a windowsaving a lifecrying womanwinesubjective cameradrinkslow motion scene …mirrorcell phonesexfemale nudityf ratednuditybloodbare breastsdogbare chested malegunfemale rear nudityphotographsingingshowertelephone callfiretopless female nuditycryingshot to deathfoodcomputerbare buttshootingpaintingdead bodyhallucinationvoyeurreference to jesus christprayerrevolverf wordsurvivalorphanflashlightjournalisteatingsuicide attemptapologycultcoffinunderwater scenecoffeegunshotflash forwardconfessionvacationdollscreamhangingscarcrossfilm within a filmsuspicioncabinsleepingsacrificeblood spatterholidayfireplaceballoonlistening to musiccrucifixwatching a moviebarefoot malehome moviepeeping tomtrappedtarget practiceattempted suicidebackpackhungersafelaughterice skatingduct tapeholding handssinthanksgivingdead dogtaking a showermental patientbarking dog12 year oldchristmas presentgun in mouthmental breakdownfemale psychopath17 year oldfalling into waterblood stainhearing voicesnewspaper articlereading a bookhanged manstation wagonhome videofilling stationmurder by gunshotpsychotronic filmwet clothesdeath by gunshotpointing a gun at someonewrapped in a towelfemale antagonistdrinking from a bottlethreatened with a gunhysterical womanpower failureportrait paintingreference to santa claussleeping pillcult leadersecretly observingpsycho terroroverheard conversationbottled waterfemale objectificationfrozen lakehysterical outburstdeath by shootinggrandfather clockreference to the bibletalking to an animalvoice mailhanged boyapplying lipstickfemale star appears nudechristmas decorationfalling through icesmall castcold the temperaturetalking to a dogmass suicidelost dogwatching a movie on tvduct tape gaglooking through a windowmurder by shootingmysterious eventtaking a pillwoman murders a man30 year oldsleeping on the floorcharacter appears in newspaperweather reportpretending to sleepspurting bloodcar tripmentally unstable womangoogling for informationwoman wrapped in a towelmentally disturbed personmissing dogpower generatoropening creditsnude woman in showersitting on the floorwrapped in a blanketyear 2019eating a sandwichtalking to a dead bodychristian fanaticorgan the musical instrumentlying on the floorreligious womanshooting lessonbiblical quotationduffle bagwatching a horror moviesleeping fully clothedstuck carbreaking through icecovering someone's mouthdesperate woman (See All) |
The cynical and skeptical writer Mike Enslin writes books evaluating supernatural phenomena in hotels, graveyards and other haunted places, usually debunking the mystery. While writing his latest book, he travels from Los Angeles to New York to spend one night in the Dolphin Hotel's posessed room 14 …08, which is permanently unavailable for guests. The reluctant manager Mr. Gerald Olin objects to his request and offers an upgrade, expensive booze and finally relates the death of more than fifty guests over decades in the cursed room. However Mike threatens Mr. Olin, promising to sue the hotel, and is finally allowed to check into the room. Later in the night, he finds that guests of room 1408, once they have checked in, might never leave the room alive. (Read More)
Subgenre: | supernatural horrorsupernaturalparanormal phenomenaparanormal activity |
Themes: | supernatural powerself sacrificefeardrinkingghostsuicidemurderdeathsurrealismfuneralinvestigationmemoryangerparanoiaguilt …insanityillnessevilpanicdeath of daughterclaustrophobia (See All) |
Mood: | nightnightmarerain |
Locations: | hospitalnew york citybeachrestauranthotelsnowcemeterylos angeles californiawatertaxiwheelchairpolice carhotel fire |
Characters: | husband wife relationshipafrican americanfather son relationshipfather daughter relationshipmother daughter relationshipgirlpolice officerwriterlawyerwaitressbiblemaid |
Story: | haunted househauntedmazelaptop computeralarm clockbookstoreoccultblack americanhauntingsecretdrinkmirrordreamnumber in titleblood …flashbackcigarette smokingphotographtitle spoken by characterknifechasesurprise endingshowertelephone callfirecryingsongwatching tvcomputerfalling from heightpaintingbooktearscafebathroomhallucinationmanhattan new york citytelephonethroat slittingdinermapradiocoffinunderwater scenedrowningflash forwardgravelibraryauthorhotel roomkeyperson on firebased on short storypossessionkicked in the facesuspicionarsonicedestructionburned alivetape recordersurfingbarefoottrappedinsecttitle appears in writingeye gougingmarital separationrefrigeratorsurgeonbonfireatheistfiremandoppelgangerinvestigatorcandyclosetapparitionmolotov cocktailbandagerepeated scenepostcardpublishermetaphorremorsewebcambugsurferblood stainhearing voicesmind gamemailsurfboardwarningnursing homenoosehanged manburnt bodyshockhome videopost officedemolitionrescue from drowninghit with a hammertuberculosislocked in a roombludgeoningpoltergeistdeja vufloodingjumping out a windowconcussionbook signingskepticismhand injuryghost hunterhotel managerhospital gowndeath of a childturned to stoneledgekeyholeceiling fanestranged couplebased on the works of stephen kingcold the temperaturesingle locationcount downdeliriumnumber as titleinfra redmicrofilmair ventcognachotel desk clerkfly the insectsiren the alarmcrushed handboiling waterfire sprinklerbook editorsanityreference to franz kafkacall for helpletter openerwalking on broken glassreference to truman capoteunplugged electronic worksventilation shaftdoor handlebook tourdebunkinghaunted hotelclock radiosense of timefalling through the ceilingfire rescuehanging from a ledgepost office boxarmoirescene at a windowthermostattransom (See All) |
Chris and his girlfriend Rose go upstate to visit her parent's for the weekend. At first, Chris reads the family's overly accommodating behavior as nervous attempts to deal with their daughter's interracial relationship, but as the weekend progresses, a series of increasingly disturbing discoveries …lead him to a truth that he never could have imagined. (Read More)
Subgenre: | supernatural horrorpsychological horrorindependent filmdark comedypsychological thriller |
Themes: | feardrinkingsuicidemurderdeathfriendshiprevengesurrealismkidnappingbetrayaljealousydrunkennessracismpsychopathparanoia …abductionblindnesswildernesschildhood trauma (See All) |
Mood: | nightmaregoresatireraindarkness |
Locations: | lakewoodsforestnew york cityairportelevatorrural settingwheelchair |
Characters: | suicide by gunshothusband wife relationshipfriendafrican americanfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctorboybrother sister relationshipdetective …policemanphotographerbest friendreference to godinterracial relationshipvillainpsychiatristmaidolder woman younger man relationshipgrandfather granddaughter relationshipyounger version of characterjapanese americansuicide by shooting (See All) |
Story: | bolt upright after nightmarelooking at oneself in a mirrorjump scarelooking out a windowcrying womanscene during opening creditsblack americanwinedrinkmirrorcell phonebloodviolenceflashbackdog …two word titlebare chested malegunkissfightcigarette smokinginterracial sexphotographtitle spoken by characterpartysurprise endingtelephone callblood splattercar accidentwatching tvcomputercamerashootingrifletearsrunningcar crashdead bodytelephonef wordcandlestrangulationaxestabbingapologycultflash forwardprologuesuburbmissing personevil manmanipulationdisappearancedie hard scenarioloss of mothermaniacsurgeryeyeglasseshuggingshavingteafireplacekilling an animaladdictionreference to adolf hitlerrace relationsshot in the stomachexercisebisexual girlservantbrooklyn new york citycrying mannicknamestabbed in the throatimmortalityhypnosisstabbed in the leghit on the headlaughterracistdeercellphonestabbed in the eyeblind mandead motherbrushing teethbenchsports carbrainreference to barack obamaauctionmale objectificationhit and runearphonesstabbed in the handbrainwashingparalysisstereotypehuman monstersex slavesarcasmname callingsecret societyfemale psychopathself defenseknocking on a doorinterracial kissmale protagonistfemale villainseizurecrazinessevil womanawkward situationgenetics11 year oldracial discriminationhoodiepsychotronic filmhouse firegrindhouse filmpolice sireneyesflash camerapackingintercomtrancestory tellingbingochopping woodloss of memorylawnmowerbrain surgerybritish actor playing american characterart dealercar keysburning houseafrican american protagonistreference to 9 11bloody mouthroadkillgazebobody switchingtransplantwhite supremacistdead body in car trunkairport securityblack heroimplied incestdragging a dead bodystuffed animal toyolder woman younger maninside the mindsocial criticupstate new yorkisolated housestrange behaviorwhite supremacyattacked from behindneurosurgeonkicking someonehooded sweatshirtquitting smokingfootstepssedationhuman brainobjectificationreference to jeffrey dahmertranshumanismgroundskeepertalking in a carbrain transplantdog foodfloating in spacevagina slurfighting backreference to tiger woods26 year oldfalling to the groundidletter openerhypnotic tranceracial hatredkilling a deermissing friendtesticles slurhit on the head with a balltelephone hangupukeleleblack maidsneak attackstomped to deathb wordreference to jesse owenstransplantationdog sittinglong consweatpantshouse in the woodsstrapped to a chairtattletalebilliard ballromance subplotshot in the gutfellatio slurfoosball tablehead scarmedical operationmounted deer headstepford wives plottransportation security administrationbreaking a dishreference to greecestabbed with a letter openerbroken car headlightevil familylosing consciousnessrunning upstairssearching for missing friendthwarted ambitionwalking alone at night (See All) |
Subgenre: | ghost storyurban fantasyspanish horror |
Themes: | supernatural powerghostdeathfriendshipblindnessself harm |
Mood: | high schoolnightmare |
Locations: | schoolbarbathtubpolice stationpolice carspainschool nurseboy in a bathtub |
Characters: | neighbor neighbor relationshipchristianteacherfemale protagonistfriendfamily relationshipspolicefather daughter relationshipteenagermother daughter relationshipboybrother sister relationshipteenage girlnursedetective …policemansister sister relationshiplittle girlwaitresschristianitylittle boypolice detective (See All) |
Period: | year 1991 |
Story: | cracked mirrorbroken mirrorlooking at oneself in a mirrorhigh school studentdream sequenceupside down camera shotframed photographscreaming womancrying womanritualwidowslow motion scenemale nudityf ratedcharacter name in title …bloodviolenceone word titleflashbackmale frontal nuditycigarette smokingphotographtitle spoken by charactermale full frontal nuditypartyshowertelephone callfirecryingface slapwatching tvundressingpaintinghallucinationreference to jesus christclassroommale pubic hairflashlightname in titleeatingapologynundrawingbathold womanbartenderflash forwardpossessionscreamfilm within a filmclassstrong female charactereyeglasseslistening to musicfaintingtold in flashbackcrucifixwatching a moviemagazinevisitteenage protagonistreverse footagenicknamebackpackbroken glassprophecyabsent fathertitle at the endbalconyswingdemonic possessiontelekinesismale objectificationtaking a showerforename as titlehiding in a closetrepeated scenespiral staircasebroken windowelementary schoolblood stainsplit personalityhearing voicestaking a bathactress shares first name with characterdripping bloodbreaking a windowblind womanunderage smokingmadrid spaincrying femalelighting a cigarettefemale police officerouija boardwashing machinedance sceneundressing someonetelevision setpsychotronic filmwet clothesfemale name in titleuncircumcised penistalking to oneselfflickering lightbloody facebad dreamsecretly observinghand injurybarefoot womanoxygen maskyoung girlbased on supposedly true storysolar eclipsebiblical referencecaught in the rainclassmate classmate relationshiprock paper scissorsbar ownerbed wettingtaking off underwearwatching a movie on tvwatching someone sleepthree sistersmysterious eventstrong female protagonistpossessed womanrepeated scene from a different perspectivepossessed girlblind personoccult ritualwashing someoneplush toybiting someonepolice investigatorsinging alongspilled drinktalking to a ghostreading a magazineends with real life photosfirst menstruationfainting womanspilled milkbreaking a glassliterature teacherdrawing on a wallhot watercommunicating with the deadcrying for helpschoolmate schoolmate relationshipcutting one's fingertying shoelacessitting on the floorvertigo shotvoice over flashbackcutting one's handfinger injuryspiritual possessionbraces on teethemergency calllying on the floorblind characterburning oneselffriday the 13thliterature classname as titlescene repeated from alternative perspectivemysterious figurepouring rainrunning latestanding on a rooftopblowing smoke into someone's facescene told from more than one perspectivetalking to one's dead father (See All) |
In the aftermath of a personal tragedy, Harper retreats alone to the beautiful English countryside, hoping to find a place to heal. But someone — or something — from the surrounding woods appears to be stalking her, and what begins as simmering dread becomes a fully-formed nightmare, inhabited b …y her darkest memories and fears. (Read More)
Subgenre: | tragedybody horrorfolk horror |
Themes: | supernatural powergrieffearsuicidedeathlovepregnancymonsternatureangerhome invasiontrauma |
Mood: | nightmaregorerainsurreal |
Locations: | woodschurchbathtublondon englandvillagerural settingkitchentunneltowncar theftkitchen knife |
Characters: | husband wife relationshipfemale protagonistteenage boypolice officerpolicemanreference to god |
Story: | horror filmsound designlooking in a windowscreaming womantext messagehusbandlooking out a windowhomecrying womanreference to william shakespearehauntinghousewidowsubjective cameraslow motion scene …cell phonemale nuditynuditybloodviolenceone word titleflashbackmale full frontal nudityknifetelephone callcar accidentpunched in the facewritten by directorfalling from heightmaskdead bodyhallucinationhandcuffsmale pubic hairf wordbedroomstabbingmontageapologyhit by a carflash forwardstalkerscreamingkeyvacationsuitcaseattempted rapepianistcountrysidecrosschildbirthpolicewomanpubteacovered in bloodapplepromiseseriesthunderlaughterintruderloss of husbandclonesymbolismabandoned buildinggiving birthpresentnudename callingstabbed in the arminterracial marriageepiloguecountry househandopen endedfemale police officertormenttextingnakedman hits a womanhatchethide and seekquestioncrossword puzzleflickering lightbloody facegender rolesgrievingvicarcreepyfemalelost in the woodsstained glass windowpenis slurwoman in a bathtubheavy breathingplayingdead deerechoafrican anglonaked manvisualdreadelectric toothbrushapple treereflection in a mirroreating an applemale pregnancyvideo calldandelionmalebrushing one's teethimageryspousal abusegraphic nuditylocking a doorlondon bridgegender in titlefacial maskb wordfeelingreference to ulyssesford fiestahandcuffed mansilent screamthreaten to killforce of natureanglican priestblack anglohouse tourmusic video directorreligious imagerywearing a maskbloody bodyout of reachvacation gone wrong (See All) |
Madrid, June 1991. After celebrating a session of Ouija with her friends, Verónica is besieged by dangerous supernatural presences that threaten to harm her entire family.
Subgenre: | ghost storysupernaturalurban fantasyspanish horror |
Themes: | supernatural powerghostdeathfriendshipblindnessself harm |
Mood: | high schoolnightmare |
Locations: | schoolbarbathtubpolice stationpolice carspainschool nurseboy in a bathtub |
Characters: | neighbor neighbor relationshipchristianfemale protagonistfriendfamily relationshipspolicefather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlnursedetectivepolicemansister sister relationship …little girlwaitresschristianitylittle boypolice detective (See All) |
Period: | 1990syear 1991 |
Story: | cracked mirrorbroken mirrorlooking at oneself in a mirrordream sequenceupside down camera shotframed photographscreaming womanschoolteachercrying womanritualwidowslow motion scenemale nudityf ratedblood …violenceone word titleflashbackmale frontal nuditycigarette smokingphotographtitle spoken by charactermale full frontal nuditypartyshowerbased on true storytelephone callfirecryingwatching tvundressingpaintinghallucinationreference to jesus christclassroommale pubic hairflashlightname in titleeatingapologynundrawingbathold womanbartenderflash forwardpossessionscreamfilm within a filmeuropestrong female charactereyeglassesheavy rainlistening to musicfaintingtold in flashbackcrucifixwatching a moviemagazinevisitreverse footagenicknamebackpackbroken glassprophecyabsent fathertitle at the endbalconyswingdemonic possessiontelekinesistaking a showerinvestigatorforename as titlemenstruationhiding in a closetrepeated scenespiral staircaseseancebroken windowelementary schoolblood stainsplit personalityhearing voicesstretchertaking a bathcigaretteactress shares first name with characterdripping bloodbreaking a windowbleedingblind womanunderage smokingmadrid spaincrying femalelighting a cigarettecountdownfemale police officerouija boardwashing machinedance scenesymbolundressing someonevisitortelevision setinvitationmattresspsychotronic filmswingingwet clothessilhouettegrindhouse filmspiritualismfemale name in titleuncircumcised penisbarmaidtalking to oneselfeclipsedental bracesflickering lightbloody facebad dreamsecretly observinghand injurybarefoot womanoxygen maskyoung girlbased on supposedly true storysolar eclipsebiblical referencecaught in the rainouijabracesclassmate classmate relationshiprock paper scissorsbar ownertypingprojectiontaking off underwearwatching a movie on tvwatching someone sleepmenarchethree sistersmysterious eventstrong female protagonistpossessed womanrepeated scene from a different perspectivetransmitterpossessed girlblind personyawningoccult ritualwashing someoneoccultismplush toyspiritualistbiting someonepolice investigatorprojectorsinging alongspilled drinktalking to a ghostreading a magazineends with real life photosfirst menstruationfainting womanspilled milkbreaking a glassliterature teacherdrawing on a wallhot watercommunicating with the deadcrying for helpschoolmate schoolmate relationshipslapped in the facecutting one's fingertying shoelacesdownpoursitting on the floorvertigo shotvoice over flashbackcutting one's handfinger injuryspiritual possessionemergency calllying on the floorblind characterburning oneselffriday the 13thliterature classname as titlescene repeated from alternative perspectivemysterious figurerunning latestanding on a rooftopblowing smoke into someone's facescene told from more than one perspectivetalking to one's dead father (See All) |
Two couples on an oceanside getaway grow suspicious that the host of their seemingly perfect rental house may be spying on them. Before long, what should have been a celebratory weekend trip turns into something far more sinister.
Subgenre: | independent filmpsychological dramapsychological thriller |
Themes: | fearmurderinfidelityjealousyadulterydeceptionvoyeurismracismpsychopathbrutalitydrug useguiltunfaithfulnesssurveillancehome invasion |
Mood: | nightmurder plot |
Locations: | woodsbeachoceansex in showerchase in the woods |
Characters: | husband wife relationshipserial killerboyfriend girlfriend relationshipbrother brother relationshipslasher killerbrother in law sister in law relationshipserial murderer |
Story: | keeping a secretlooking at oneself in a mirrorhorror filmhiking trailman murders a womansecretsframed photographtext messagecircular staircasewatching a videolocked doorserial murderwoman in jeopardyhomehouse …winesecretmirrorcell phonesexbloodviolencedogkissphotographchasecar accidentpunched in the facewatching tvcamerakissingmaskliedead bodyvoyeurreference to jesus christcriminalf wordfoot chasefalse accusationdrivingapologysearchstalkerprologuevacationcover upbusinesspursuitstalkingbrothersuspicionsleepingpickup truckbeer drinkinglistening to musichidingpsychostrangerforbidden lovepeeping tomyogatensionnicknametelescopesurveillance camerablood on faceconfrontationfalling to deathdiscriminationaccidental killinghot tubsurprisefogspyingracistclifftripmasked killerpsycho killerpsychopathic killersuffocationbad guybarking dogmysterious manhikingname callinghangovercoastecstasygiving a toastracial prejudiceepiloguevideo footagegraphic violenceweekendmumblecorestabbed in the facewoman in a bikinicaretakerbloody violenceroadoff screen murderdisturbed individualbludgeoningrentdeeply disturbed persondrinking alcoholbloody facegetawayhome alonewatching sexwatching someonefamily vacationbusiness partnerloftcouplespropertycaught cheatingshower scenesmall castcoastlineheavy breathingwhitehidden2012ecstasy the drugsleeping on a sofatwo in a showeraccidental murderdrinking and drivingcarrying a dead bodywoman showeringfalling over a cliffkilled with a hammertoolboxhorseplaylocked roomwalking on a beachreflection in a mirrorsmothered to deathcrawlspacedance partyspy camerabad guy winscctv camerasmashing a car windowmissing petremote locationmissing dogsmoke alarmunpunished antagonistfalling to one's deathmurder disguised as accidentpushed off a cliffangry wifefrancoscene during closing creditswalk on the beachdisturbed personfamily tripdeckwifi2013vacation homeevil winsweekend getawayweekend tripbutt crackfilming sexhit on the head with a hammeropening creditsplaying with a dognude woman in showermasked attackerchase scenecovering up a murdermurdered with a hammercrazy personchased in the woodsclimbing down a cliffcoastal watersstorage roombroken toiletfrench bulldoghammer as weaponstealing a cell phonespike stripvacation gone wrong (See All) |
A small-town Oregon teacher and her brother, the local sheriff, discover a young student is harbouring a dangerous secret that could have frightening consequences.
Subgenre: | suspensefairy taleallegorybody horroramerican horrorfolk horrorcanadian horrormexican horror |
Themes: | supernatural powerdeathrevengemonsterinvestigationmemoryangerdysfunctional familyillnessbullyingcannibalismtraumadrug addictionwildernessmissing child …starvation (See All) |
Mood: | goreraindarknessmyth |
Locations: | lakewoodsforestschoolhospitalchurchsmall townpolice cartunnelschool teachertownschool bullyshedschool nurse |
Characters: | teacherfather son relationshippolicemother son relationshipfather daughter relationshipbrother brother relationshipboybrother sister relationshippolice officerbullynative americanteacher student relationshipbiblesheriffmayor …parent child relationshipcoronercrying boy (See All) |
Story: | looking at oneself in a mirrorhorror filmbloody footprintman murders a womanvoodoo dollframed photographscreaming womanbearded manlooking out a windowhomecrying womanscene during opening creditsreference to william shakespearedarkhouse …subjective cameramirrormale nuditynuditybloodone word titleflashbackgunfightphotographknifechasetelephone callvoice over narrationbased on bookcorpsefoodshootingrifledead bodyreference to jesus christclassroomtelephonehalloweengay slurflashlighteatingchild abuseapologydrawingcreaturegunshotflash forwardlegenddrug addictprologueattackbased on short storystorytellingmissing personpursuitcrosstrapbrotherbearpickup truckfireplaceice creamhunterwatching a moviefollowing someonegas maskpromiseseriesgrocery storenicknametrappedbackpackhungermedicationenvironmental issueproducersuperstitionmineabusive fatherbroken armdead motherkilling spreebeing followed12 year oldset upstuffed animalevictionmeatstairwayamerican indianevil spiritfruitfilm projectorrailwayblood stainschool principalflarecoughingmetamorphosistrain tracksfableguardianstation wagonoregonvegetablenervousnessoverhead camera shotradio newscoughing bloodlocked in a roomtrespassingdonutpolice sirenshelterflash cameramiddle schoolmoralshort storybegins with textflickering lightmistmethamphetamineyoungresentmentchild's drawingwatching someoneaccompliceplastic bagbeing watchedabandoned carbloody mouthabandoned mineskunktaleburned bodymissing womanstate trooperanimal trapdog fecesheroin addictionconveyor beltmine shaftmutilated corpsedehydrationfictional townmining towncoal miningchild neglectringing telephonedoor lock7 year oldocdbody partsmeth labwarrantlocallocked upcarvingbody transformationgrowlingfirst featurewendigolaw and orderlumbershushinghomeschoolingrag dollwalking on train tracksbeating heartpick up truckantlerbanging on a dooreating ice creammissing boynative american legendill childstenchreference to goldilocks and the three bearslosing a jobopening creditssupernatural creatureexit signcaution taperail trackcoal industryice cream shopsetting a trapstuffed bear toy12 year old boybody torn in halfminer's helmetmythological beastschool deskscreaming boytraumatized child (See All) |
A group of contest winners arrive at an island hotel to live out their dreams, only to find themselves trapped in nightmare scenarios.
Subgenre: | supernatural thrillersupernatural horrorblack comedysuspense |
Themes: | supernatural powernear death experienceself sacrificegrieffearmurderdeathrevengesurrealismkidnappinginfidelitybetrayaltortureescapehero …deceptionextramarital affairredemptionunfaithfulnessbullyingpanicregret (See All) |
Mood: | nightmaremysterious |
Locations: | woodsforestbarbeachrestaurantswimming poolhotelairplanewaterelevatorapartmentcavejungletunnelbeach party …apartment fire (See All) |
Characters: | husband wife relationshiphomosexualfather son relationshippolicefather daughter relationshipmother daughter relationshiptattoozombiesoldierpolice officerhostagelittle girlbullyasian americanterror …russianout of control (See All) |
Period: | 21st century2020s |
Story: | horror moviehorror filmproduction companyfeature filmjumping off a clifflostscene during opening creditsdarktragic eventslow motion scenedreamcell phonebloodviolencetwo word title …gunfightphotographtitle spoken by characterexplosionpartyknifesurprise endingpistoltelephone callfireshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestblonderemakeshot in the headshotgunrescuepunched in the facecamerawritten by directorbattlegunfightbikinibrawllettershowdownheld at gunpointdead bodyinterrogationneighborhallucinationislandcombattelephoneshot in the backf wordsurvivalgay slurflashlightassassinbound and gaggeddisguisemansionstabbed to deathstabbed in the chesttied to a chairmapsnakeapologydouble crossunderwater scenefemme fatalemarriage proposaldrowningshot in the foreheadracial slurattempted murderhotel roombased on tv seriesdangerstabbed in the backprologuewidowerelectrocutionmissionrace against timechristmas treeopening action sceneshot in the shoulderbodyguardexploding bodyneck breakingmercenaryshot in the armobscene finger gesturefireworkscheating wifebattlefieldhenchmanak 47hand grenadegrenadeburned aliverevelationdesireassassination attemptgay charactermachetebeardvillainessrocket launchercrying manback from the deadmasked mangun battleserieshaunted by the pastunfaithful wiferesurrectionmuteshot in the facedeath threatplot twistescape attemptspecial forcesexploding headassault riflecommandodead mantitle at the endraised middle fingermustachelens flarerescue missionwishethnic slurlasersightsurgeonrpgburned to deathsmokemoral dilemmaprequelprivate investigatorengagement ringdrugged drinkdoppelgangerblood on camera lensface maskfinal showdownfire extinguishertruthex copset upsurgical maskshot in the neckname callingcomic reliefbully comeuppancestabbed in the armblackflaskcommando unitresortfacebookshot in the eyecrystalcommando missionassistantstrong languagetelevision showpool partyski masktwo way mirrordisc jockeygenietragic pastvaultdrug cartelcamera phonecoughing bloodpsychotronic filmexploding airplanehalf brothergrindhouse filmspeedoarmorymad doctorproposalstairwellbandanahands tieddecomposing bodydog tagwish fulfillmentseaplanefantasiesrescue attemptdinner datetruth or daremost dangerous gamefunrebootnumbertorturerreference to muhammad aliplaying2012remote islandwhite suitreality vs fantasypig maskreanimated corpsesonymouth sewn shutclown maskhit squadreference to tupac shakurelbowed in faceisland lifemale bondage20102013reference to jodie fosterideawishing welljeffroach20152017lead pipemysterious islandpanic roomshot on locationstabbed through the backsurface to air missleblack bloodspring wateraide de campmacaroni and cheesethe secretvacation gone wrong (See All) |
A young woman, traumatized by a tragic event in her past, seeks out vengeance against those who crossed her path.
Subgenre: | black comedyconspiracydark comedyrevenge plot |
Themes: | depressionfeardrinkingsuicidemurderlovefriendshiprevengerapemoneydrunkennessweddinginvestigationdeceptionmemory …guiltdatinghumiliationbullyingtraumavengeancefalling in loveforgivenessmurder investigationregretrape and revenge (See All) |
Mood: | poetic justicebittersweet ending |
Locations: | barhospitalnew york cityrestauranthotelnightclubstrip club |
Characters: | female protagonistfriendafrican americanpolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipdoctorsingerteenage girlstudentdetectivedancerphotographer …lawyerbest friendreference to godbullyhitmanwaitresspolice detectiveemployer employee relationshipfiance fiancee relationshipself justicepolice dogrevenge motiveasking for forgivenessrevenge seekerpolice interview (See All) |
Story: | looking at oneself in a mirrorunexpected visitorman murders a womanframed photographtext messagewatching a videomourningwoman in jeopardyhomecrying womanscene during opening creditsblack americantragic eventwinedrink …mirrorcell phonesexf ratedbloodviolencekissdancingphotographsingingthree word titlesurprise endingpantiestelephone callsongtitle directed by femalefoodcomputercamerawritten by directorarrestundressingshowdownliedead bodycafehandcuffsreference to jesus christstrippertelephonef worddisguisemontageeatingcocainedinerinternetapologyfemme fatalenecklacecoffeeone against manyhotel roommicrophoneprologuebusinessmanchampagnesuitcasemissing personcover upattempted rapemanipulationwigdirectorial debutstrong female characterpickup trucksurgerymachismofriendship between mensexual attractiongossipcrying manpromisehaunted by the pastnicknameattorneycynicismhypocrisyironysexismfeministscissorsmakeuplaughterpanties pulled downsalesmansexual assaultinjusticemisogynywedding receptionpromiscuitydrugged drinkcoffee shopbad guywedding ceremonydirector cameotriple f ratedpromiscuous womanbirthday presentohiomental breakdownmale friendshipname callingdouble lifeyoung womanvigilante justiceteenage daughterheld captivemedical studentlip synchingbachelor partyoverhead camera shotundressing someonetitle produced by femalecrime investigationcriminal investigationsocial injusticeanti heroinepolice sirenvillain arrestedsexual humiliationmissing daughterwedding cakedrunken womandrinking alcoholsexual predatoraspiring writerobsessed fanrearview mirrormakeup artistfemale objectificationwatching someonefemale empowermentbeing watcheddouble standardmedical schoolspiked drinktall mansex crimedefense lawyermissing womanpenis slursexy nursetire ironaudio flashbackfemale bare feethonking a car hornmale chauvinismtaking off underwearhandcuffed to a bedpediatricianstrong female protagonistwoman director30 year oldmusic fanfemale vigilantesmothered with a pillowcon gamedrinking champagnechildhood friendsreference to london englandsmothered to deathbead curtainfan the personhospital waiting roommale chauvinistreference to anal sexsocietal hypocrisywatching a video on a computerpretending to sleepturning the tablesadult living with parentsreference to paris hiltonburning a dead bodyvibrating cell phone29 year old30th birthdayasking someone out on a datebaristagender in titlemissing persons casepredator turns victimincriminating evidencemoving ongetting drunkex classmate ex classmate relationshipnaive girlid badgeoutdoor weddingrapist comeuppancerevenge from beyond the gravelost cell phonesafe wordhandcuffed mansmashing a windshield4 year oldasking for directionsginger alemale doctorunpunished crimeassertive womancovering up a murdergender inequalityvideo evidencemale male embracenice guybikini modelbritish actress playing american charactercheating on fianceemeeting the parentsmurder cover uppsychotic breakspilling winewoman's revengearrested for murderbait and switchpsychotic episodemissing person reportpicking up a strangerpretending to be drunksmeared lipsticktaking off a woman's pantieswedding engagement (See All) |
A young boy finds himself pursued by two assassins in the Montana wilderness, with a survival expert determined to protect him, and a forest fire threatening to consume them all.
Subgenre: | black comedysuspenseconspiracypsychological dramapsychological thrillerdisaster film |
Themes: | near death experiencegrieffeardrinkingmurderdeathrevengepregnancytorturedrunkennessescapegangsterdeceptionbrutalityredemption …guilthome invasionpanictraumacouragewildernessregret (See All) |
Mood: | nightmarepoetic justice |
Locations: | woodsforestbarhelicopterairplanepolice cartruckmotelcampfirestormschool bussuvfire truckforest fire |
Characters: | husband wife relationshipfemale protagonistafrican americanfather son relationshippolicemother son relationshipteenagerbrother brother relationshipboybrother sister relationshipteenage boypolice officerhostagehitmanwaitress …snipersheriffuncle nephew relationshipolder woman younger man relationshipex boyfriend ex girlfriend relationshipsniper riflepregnant womanself mutilationsingle fatherpregnant wifecrying boy (See All) |
Period: | 2020s |
Story: | waking up from a nightmarelooking at oneself in a mirrorman murders a womanframed photographman kills a womanlaptop computerwoman in jeopardycrying womanblack americantragic eventsecretdrinkmirrorcell phonef rated …bloodviolenceflashbackgunkissfightcigarette smokingphotographexplosionknifechasepistoltelephone callfireshootoutbeatingcorpseshot to deathblood splatterfoodmachine gunhorsecar accidentshot in the chesturinationshot in the headshotgunrescuewatching tvcomputerarrestgunfightbrawlfalling from heightshootingshowdownlierifleheld at gunpointbeersunglassesinterrogationcafehandcuffstelephoneshot in the backf wordsurvivalfoot chaseorphanflashlightassassinambushaxedisguiseambulanceeatingstabbed to deathdinerstabbed in the chestapologyradiodisarming someonedouble crossunderwater scenepolice officer killedsearchnews reportcoffeeshot in the foreheadfive word titlepainon the runflash forwardattempted murdertreeorganized crimemicrophonedangerstabbed in the backwidowerperson on fireon the roadrace against timeevil mantough girllightningshot in the shoulderscarpursuitwitnesssadnesscharacter says i love youthreatened with a knifeprofanitysilencersleepingtrustarsonsingle parentstrong female characterpickup truckcrime bosschainsawdisastertv newsfireplaceburned alivehead buttassassination attemptbreaking and enteringwoundsociopathwalkie talkiebeardfloridastrong female leadaction heroinefemale warriorreverse footagehaunted by the pastnicknamestealing a carthunderbraverybackpackfight to the deathpartnermercilessnesspower outageassault rifleevidenceparachuteblood on shirttitle at the endthirty somethingbulletproof vestdisfigurementmustachedark pastlens flarelasersightburned to deathgunfiresmokefirefightersouthern accenttracking devicefiremanhorseback ridingimpersonating a police officershot through a windowbarbed wireearphonesaccountant12 year oldfinal showdownrepeated scenestairwaysuit and tiehikingname callingabandoned housemotel roomwhisperingflarehired killerinterracial marriagecigarettedeputydistrict attorneycabin in the woodsamericanastabbed in the shouldercontract killercowardpersecutioninterracial coupleoverturning cartitle same as bookexploding housetragic pastgame playingtextingdistrustradio newsman on fireprivate jetone woman armyburn victimneo westernman hits a womankicking in a dooranti heroinemontanagas explosionbrother in lawforty somethingchild swearingfoot pursuitmodern westernsexual innuendoyoung boytruck stopcar wreckdouble entendretoasterrearview mirrorstabbed in the footdoorbellbrother in law brother in law relationshipman fights a womandark heroinecreekoxygen maskstruck by lightninghead bandageblood on handsdeputy sherifffirefightingpickaxetire ironhand woundprotectorrefugeduffel bagsurvivalistjumping from an airplanecar falling off a cliffhand bandagefireplace pokerstrong female protagonistwoman murders a manfire departmenttelescopic rifleautomatic rifleashbarbed wire fencefire pokermale female fightsecret messagespray canface burnlocustwildfirebrushing one's teethlightning stormlimping manwoman shoots a manfort lauderdale floridatongue twisterfacial woundcongratulationsopening creditsjacksonville floridasurvival skillschanging a flat tirefemale firefighterwriter director producerfoot woundtv news crewradio transmitterlimping womanlookout towerthreat to murder (See All) |
The Shadow Mountains, 1983. Red and Mandy lead a loving and peaceful existence; but when their pine-scented haven is savagely destroyed, Red is catapulted into a phantasmagoric journey filled with bloody vengeance and laced with fire.
Subgenre: | cult filmsuspense |
Themes: | grieffeardrinkingmurderdeathloverevengesurrealismkidnappingdrugsreligiontorturedrunkennessdancememory …naturepsychopathbrutalityobsessiondrug useinsanityhumiliationsadismevilabductionvengeancemadnessreligious cult (See All) |
Mood: | nightnightmaregoredarkness |
Locations: | lakewoodsboatforestchurchhelicoptermotorcyclerural settinggas stationcampfireusacar on firealone in the woods |
Characters: | husband wife relationshipafrican americantattoosingerbrother sister relationshipprostituteartistreference to goddriverblonde girlreligious sect |
Period: | 1980syear 1983 |
Story: | walking in the woodslooking at oneself in a mirrorbearded mancrying womanscene during opening creditsblack americansubjective cameradrinkslow motion scenemirrordreammale nuditysexbloodviolence …one word titleflashbackmale frontal nuditydogbare chested maleguncigarette smokingdancingtitle spoken by charactermale full frontal nuditysingingchasepistolfirecryingbeatingunderwearblood splatterblondeshotgunrescuepunched in the facewatching tvfalling from heightmaskshootingbookhand to hand combatsunglassesbeddead bodybathroomdemonhallucinationhandcuffsreference to jesus christmale pubic hairrevolvertelevisioncriminaldecapitationbedroombound and gaggedcaliforniastabbingmontagethroat slittingimpalementcocaineweapontied to a chairdinnerapologysevered headcultone man armydrawingfishingjourneyvanpaingunshotduelcostumescreamingreadingbraceletlong takespeechamerican flagpursuitcrossrock 'n' rollneck breakingtied upcabinsleepingsacrificearsonfreeze framecouplerecord playerhenchmanmaniacchainsaweyeglassespot smokingburned alivehead buttelectronic music scorecagelistening to musicragecrucifixtemplebeardhammerdesperationcovered in bloodstrangercrying manapplemasked manbikerrampageredneckrear entry sexnicknamecrossbowhippieanimated sequencemercilessnessrejectionconvenience storeinsectcigarette lighterscene after end creditshit on the headlaughtersketchfogshadowcapturetigergasolineintruderinsultfamily dinnerlens flarenervous breakdownbriefschaincharacters killed one by onearrowbonfiredaggersymbolismchildhood memorysurprise after end creditstelepathybarbed wirebreak indead animalhead woundlong hairtv commercialname callingvery little dialogueanimal crueltycabin in the woodsbody bagwhite briefsrussian roulettestation wagongraphic violencerighteous ragereference to ronald reaganwaking upman on firetelevision setpsychotronic filmbiker gangcar rollovermurder spreedriving at nightgrindhouse filmsome scenes animateddrug triplumberjacktied to a treetalking to oneselfbegins with textflickering lightbloody facebattle axecult leaderdirt bikewearing sunglasses insiderecovering alcoholicbody armorlong black hairred lightmotorcycle ridingdemonicmidnight moviescreaming in painprogressive rockheavy breathingbell 206 jet ranger helicopterscreaming manskull crushingcurly hairdollar billcremated remainshandcuffed to a pipeglass shardpillow talkbox cutternail through handtext on screentrailer housesticking out one's tonguetraumatic childhoodsetting a firethe color redeye dropslistening to a car radiohead crushingspurting bloodanimated scenesharing a bedcar stereobegging for mercyblue lightcult memberhuman remainspick up truckradio towerscenic beautybaby birdwoman slaps a womananimal carcassmolten metalwoman on firedrug labshooting oneself in the headburning corpsechainsaw fighthysterical laughterpsychedelic drugwasp stingcross necklaceone dollar billpost credits scenereference to black sabbathbreaking freetouching someone's facebengal tigercolor tintsawing down a treeshooting oneselfreference to jupiter the planetdeformed personfalse colorfruit bowlillegal entrylong haired womanlp recordmocking laughterreference to motley cruereference to saturn the planetsweaty armpitwoman with long hairgushing bloodhit with a lead pipereference to the carpentersripped shirtthe shadowtv static (See All) |
A thief makes a disturbing discovery in the house where he breaks in. Later, when he returns to the same house with his partner in crime, things are no longer how he expected.
Subgenre: | suspense |
Themes: | mental illnessmurderdeathfriendshiprevengekidnappingmoneytortureescapeinvestigationrobberytheftpsychopathbrutalityobsession …drug useinsanitysadismsurveillanceevilabductionhome invasioncrueltyunemploymentvengeancepolice investigation (See All) |
Mood: | nightmarerainpoetic justiceone nightfilm noir style |
Locations: | woodsboatforesthospitalrestauranthotelcarbathtubpolice stationpolice carsuvlog cabin |
Characters: | serial killerfriendafrican americanfamily relationshipsfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipteenage boygirlpolice officerstudentdetectivepolicemanphotographer …thiefbest friendreference to godlittle girlkillerpolice detectivestepfather stepson relationshipblonde girl (See All) |
Story: | drinking winelooking at oneself in a mirrordream sequencehorror filmscreaming womantext messagelocked doorserial murderlaptop computerremote controlwoman in jeopardyhomehousesecretslow motion scene …cell phonebloodviolenceflashbackbondagedogtwo word titlegunsex scenefightcigarette smokingphotographexplosionknifechasepistolshowertelephone callfiretopless female nuditycryingbeatingshot to deathhorseshot in the headpunched in the facewatching tvcomputercamerashootingbeersunglassesbombrunningbirthdaydead bodybathroomhandcuffscriminalf wordreporterfoot chasebound and gaggedaxemansionbridgeprisonerimmigranttied to a chairinternetmapdinnerfalse accusationapologyanti heronecklacecoffeegunshotconfessionattempted murdergraveargumentstalkerbusinessmankeyfbipay phonemissing personevil manreadingbaseball batcollege studentscreamringmanipulationscarinjectionthreatisolationtrappremarital sexsuspicionmurderercabinvigilantegaragemaniacpickup truckeyeglassessabotagesyringefireplacebreaking and enteringcagefriendship between mensociopathsecurity camerajail cellcaptivevandalismfbi agentbeardhidingdesperationservantvisitgaggedfollowing someonecompassionscambald manhomicidedebategas maskdamsel in distressseriesburglarswitchbladetrappedbreakupbuddymobile phonewhipimpostormercilessnessshovelframe uphit on the headblack eyesurprisechairtied feetfamily dinnerbriefcaseplayroombruiselightchildhood memoryfemale detectivearroganceflat tiretracking devicehit with a baseball batbeing followedstolen carpsychopathic killertaking a showeryellingtaking a photographinvestigatorbreak inhiding in a closetrobberset uprepeated scenehuman monsterlecturesuit and tiealarmmale friendshipstepfathertelling someone to shut upwoodsocial mediabroken windowanimal crueltysecuritysolitudehospital roomcottagehugcredit cardfacebookvaletvigilante justicecigarettecabin in the woodsstreet fighttaking off shirtsawhumormercedes benzstation wagonoregonvolkswagenhit with a shovelcountdownfemale police officermurder attemptfrightmanipulative behaviormurder by gunshotexploding houseplancellcustomertied up while barefootpasswordcashspoonvisitorhoodiemass graveaccusationpsychotronic filmdeath by gunshotsmoking marijuanawindowmass murdererportland oregondriving at nightman hits a womangrindhouse filmgaglockpointing a gun at someonequestionticketwrapped in a towelcat and mousecaptivitycheckselfiebricksmartphonerich mandrinking from a bottlechopping wooddecisioncityscapepublic phonepunchingtalking to oneselfgpstime bombbloody facefired from a jobshackrearview mirrorlearning the truthyoungsuspensionbritish actor playing american characterpretending to be someone elserescue attemptlocked inlootaccomplicehysterical outburstsockspadlockflash driveraincoatsteamcarrying someoneentrapmentred cartalking to an animalvoice mailitalian restaurantscarred facesmilemissing womanid cardincarcerationdobermanboundbroken windshieldmanipulative mansinkwoman in a bathtubcounting moneydog collartalking to a dogflashing breastsinstructiontearoutburstscreaming manwood chopping911 callhiding in a cartaking a selfieauditoriumchased by a dogrubber glovespublic telephonesearch warrantmurder disguised as suicideprivate investigationtrust fundhair dyedisbeliefdrivelorrymoney countingmurder by shootingicicleitalian immigrantkidnapped womanreal lifechequebirthday giftcoming homenavigationfemale fbi agentprofessionalreplacementserialbanging head against wallpartner in crimemalicebaseball cap worn backwardsitalian abroadthoughtdying hairpolice investigatorcriminal as protagonistviolent manalmost hit by a carcalling the policehospitalizationdemandhouse of cardshysterical mansmall time crooksociopathystepsonblack and white photographcompromising photographgagged womanman wrapped in a towelfrontier justicehole in the groundirish immigrantstolen gunpantingone breast exposedbolt cutterempty roommale bondagemistaken belief that someone is deadvalet parkingwoman tied to a chairopen windowprivate propertythrowing a cell phonearrogant mandoing the right thinghuman in a cagesadistic crueltysense of humorbroken car windowtied up and gaggedbreakman tied to a chairstruggling artisttied handsschool auditoriumtied up womantouch screenwashing one's facewoman bound and gaggedstrapped to a chairvillain as protagonistvisible breathbruised facedrinking coffeefemale bondageplaying the pianopleading for helpcomputer monitorcyber crimeman versus dogtied womanwaiting for someoneback doorcomputer hackingfemale investigatorstupid copcutting wooddestroying a cellphoneentering through a windowfake telephone callkicking a carphotographer as protagonistreference to betty whitesmelling someonetied up man (See All) |
Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen …ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)
Subgenre: | family tragedyindependent filmsuspensetragedypsychological thriller |
Themes: | mental illnessgrieffearlovefriendshipmarriageinfidelitybetrayaladulterypregnancyescapeinvestigationdeceptionmemoryextramarital affair …angerdivorcebrutalityparanoiaguiltunfaithfulnessillnesspanictraumaamnesiaforgiveness (See All) |
Mood: | nightmareneo noir |
Locations: | schoolhospitalhotelairplanelondon englandairportelevatorkitchenpolice carenglandfire truck |
Characters: | husband wife relationshipteacherfemale protagonistfriendfather son relationshipmother son relationshipdoctorboyteenage boybabybest friendlittle boypsychiatristex husband ex wife relationshippregnant woman …self discoverydoctor patient relationship (See All) |
Period: | 1990s2000s2010syear 1999year 2013year 2007 |
Story: | looking at oneself in a mirrordream sequencelocked doorhusbandfriendship between womencrying womanhousesubjective camerasecretslow motion scenemirrordreamcell phonesexfemale nudity …based on novelnuditybloodviolenceflashbacksex scenekissfemale rear nudityfightcigarette smokingphotographpartychasesurprise endingshowertelephone callcryingbeatingblood splatterfoodface slappunched in the facecamerawritten by directorarrestbare buttletterlierunningbedsex standing upbathroomhallucinationbritishtelephonef wordfoot chasebedroomstrangulationambulancemontageeatingaccidentfalse accusationapologyno opening creditsdrawingdouble crosssearchon the runflash forwardparkattempted murderargumenthotel roomdangerscreamingkeyattackliarcharacter's point of view camera shotknocked outdiarydomestic violencescarinjectiondeath of sonreunionsleepingtrusttherapygaragefreeze framesyringerevelationwarehousehypodermic needleheavy rainlistening to musicsociopaththerapistnosebleedbarefoot malepsychologistparking garagefalse identitypresumed deadreverse footagetensionbloody nosemobile phoneblood on faceintrigueloss of sonimpostorbroken glasshousewifeescape attempthit on the headevidencesurprisewedding ringvoice over letternotepierbruisebenchnewspaper clippingholding handsmannequinphoto albumfast motion sceneclose up of eyesfiremanmemory lossanniversarymental patient12 year oldclosetnotebookmedical maskviolence against womenrepeated sceneschemeassumed identitydoubtfake identitytwist endinghospital roomhospital bedwhisperinghearing voicesnewspaper articlehead injuryscene of the crimedomestic abuseseizurecamcorderrepeated linefacial scarmanipulative behaviorfirst person titlehiding placehitchcockiandistrustfully clothed sexwaking upwet clothesflashback within a flashbackbrain damageclose up of eyefade to blackman hits a womanwedding anniversaryman slaps a womanwrapped in a towelred herringman slaps womanloss of memorycityscapevideo diaryconcussionfire alarmlearning the truthdigital camerapretending to be someone elseman hits womanpsychological manipulationrepeated eventman fights a womanrepressed memorywine bottlehysterical outburstleft for deadbloody mouthhidden truthman punches a womanvideo recordingobservatoryreconstructionsedativefemale star appears nudepenis slurkiss on the foreheadhummingmanipulative mandead sonoutburstpeepholeprivate investigationbirth certificatedisbeliefrepeated dialoguemysterious event40 year old8 year oldmentally unstablename tagfacial bruisechloroformedmale female fightwindshield wiperamnesiacmristanding in the rainviolent manmentally unstable womanbrushing one's teethclose up of handmentally unstable protagonistwoman wrapped in a towelhusband hits wifehusband slaps wifelocking a doorwrapped in a bedsheetbreaking a glassshort term memory losswedding photographlost memorymeningitiswaking up nakedgaslightingmistaken belief that someone is deadshoeboxill wifeshort term memorycamera shot of eyessick wifeanterograde amnesiareunited with familysearching for the truthskiing accidentage regressionhit with a lampchemistry teachermedical reportsick womanlooking through a peepholetalking to a camerasinging along to music (See All) |
In a small town in Massachusetts, four high school girls perform a ritual in an attempt to debunk the lore of Slender Man. When one of the girls goes mysteriously missing, they begin to suspect that she is, in fact, his latest victim.
Subgenre: | supernatural horrorpsychological horrorsupernaturalsuspensevideocreature featureteen moviesurvival horrorteen horror |
Themes: | supernatural powernear death experienceself sacrificefearmurderdeathfriendshipsurrealismkidnappingdrunkennessescapemonsterinsanityevilhome invasion …panicmadnessmythology (See All) |
Mood: | high schoolnightnightmaredarkness |
Locations: | woodsforestschoolhospitalcemeterysmall townpolice carschool bustown |
Characters: | husband wife relationshipfemale protagonistfamily relationshipsfather daughter relationshipteenagermother daughter relationshipdoctorteenage girlteenage boypolice officernursesister sister relationshipbest friend |
Period: | 2010s |
Story: | looking at oneself in a mirrorhigh school studentoccultritualsubjective cameraslow motion scenecell phoneviolenceflashbacktwo word titlekissphotographtitle spoken by characterchasesurprise ending …showercryingarrestdemonhallucinationsurvivalflashlightstrangulationinternetfalse accusationdrawingcreaturetransformationtreelibrarydangerscreamingproduct placementmissing persondisappearancelaptopblindfoldobscene finger gesturelove interestgothicyoutubevictimteenage protagonistinterracial friendshipfull moonvisionmercilessnesspower outageescape attemptraised middle fingersuspecttext messaginghysteriaurban legendevil spirittentaclemassachusettsmacabrecamera phonepsychotronic filmstupid victimgrindhouse filmmissing daughterpanic attackvinylskypemissing person posterscreaming girlshape shiftingslender manschool tripscience classgender in titlemysterious creaturegirl in perilopening creditssupernatural creaturered haired girlsummoning a demon (See All) |
A famous horror writer finds inspiration for her next book after she and her husband take in a young couple.
Themes: | mental illnessfeardrinkinglovefriendshipmarriageinfidelitybetrayaladulterypregnancydrunkennessinvestigationdeceptionextramarital affairinsanity …unfaithfulnesswriting (See All) |
Mood: | nightmare |
Locations: | woodstrainbathtubkitchensex on a train |
Characters: | husband wife relationshipfriendteenage girlnursedancerbabywriterprofessorjewwitchcrying babydeath wish |
Story: | drinking winelooking at oneself in a mirrorsound designframed photographsuicidal thoughtshusbandfriendship between womenscene during opening creditsreference to william shakespearehousewinesubjective camerasecretdrinkslow motion scene …mirrordreamsexone word titleflashbacksex scenekisscigarette smokingdancingpartytelephone callvoice over narrationtitle directed by femalefoodcatbooksex standing upcollegehallucinationclassroomtelephonenewspapercookingmontageeatingdinnerflash forwardlibraryauthorprologuesuitcasemissing persondisappearancesuspicionclasstypewriterhealthnewspaper headlinerecord playerfemale stockinged legslistening to musicrecordingwitchcraftgossipanti semitismnicknamewindsexismcigarette lighterlaughterpridecliffbonfirenewspaper clippingfemale stockinged feetintimidationmental healthunhappy marriageforename as titlelecturestairwayname callinglibrarian17 year oldfoot closeupcigarettefootsie under the tablemushroommanuscriptcrotch grabcollege campuspost officelesbian subtextkiss on the cheekcocktailmortalityagoraphobiafemale writerfemale to male footsie playingunwed pregnancyreference to sigmund freudshort storydinner tableyoungvermonthand kissingmanipulative womanco edshakespearean quotationcribrudenesstrailsmoking in bedkiss on the foreheadwoman in a bathtubtypingmentalsex with a pregnant womanbrief topless female nudityfile cabinetporch swingscotch whiskeywoman directorreal lifehextarot cardstelling a storycollege deanreading in bedreflection in a mirrorlecture hallhouse cleaningfried eggvoice over writingpounding on a doorthrowing something at someonebased on real peoplecup of teawoman on top sexauthoressdishwashingdissertationfacultyhorror writer201717 year old girlsetting a tablestoned to deathforce of naturefemale to female footsie playingreference to geoffrey chaucer (See All) |
Anthony and his partner move into a loft in the now gentrified Cabrini-Green. After a chance encounter with an old-timer exposes Anthony to the true story behind Candyman, he unknowingly opens a door to a complex past that unravels his own sanity and unleashes a terrifying wave of violence.
Subgenre: | supernatural thrillersupernatural horrorghost storysupernaturalblack comedysuspensepsychological thrillerslasher horror |
Themes: | supernatural powerfearghostsuicidemurderdeathrevengesurrealismkidnappingdrunkennessartinvestigationracismbrutalityobsession …povertyinsanityevilbullyingabductionpanictraumapolice brutalitymythologymissing child (See All) |
Mood: | high schoolnightmaregoreslasherdarkness |
Locations: | hospitalrestaurantelevatorurban settingapartmentpolice carcityslum |
Characters: | african americanhomosexualpolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshippolice officerbabyhostageartistkillerinterracial relationshipvillain …gay relationshipslasher killersuicide by jumpingpolice violencesuicide by jumping out a window (See All) |
Period: | 2010syear 1977 |
Story: | waking up from a nightmarebroken mirrorlooking at oneself in a mirrorhigh school studenthorror filmthe other sidespecial effectshauntingritualsecretmirrorcell phonecharacter name in titlebloodviolence …one word titlesequelflashbackdogbare chested maletitle spoken by characterchasesurprise endingfiretitle directed by femaleshot to deathblood splatterremakewatching tvpaintingshowdowndead bodybathroomhallucinationf wordmontagethroat slittingstabbed to deathtoiletstabbed in the chestpainterdrawingpolice officer killednews reporttransformationracial slurpoint of viewlibrarylegendbeaten to deathdangerstabbed in the backprologuescreamingcover upevil manbrotherprofanitygay coupleundeadtv newsburned aliverevelationrace relationstape recorderfourth partsevered handproduced by directorart gallerysocial commentaryback from the deadblack womanhaunted by the pastreincarnationanimated sequenceghettoinfectionshadowtitle at the endstabbed in the eyeinjusticeethnic slurkilling spreebonfireburned to deathchallengeabandoned buildingreal estate agentinvisibilitypresentcandyliving deadlevitationfolklorekilling a dogold dark houseurban legendscene before opening creditsinspirationblack manevil spiritbeelaundromatblackurban decayantoffscreen killinghandcuffedrazor bladeafrican american womann wordwoman kills a mangay brotherhandsocialart exhibitionblaxploitationbloody violenceracial discriminationsegregationpsychotronic filmmurder spreecriminal investigationfade to blackimmolationbreaking a mirrorgrindhouse filmhookcaptivityshort storydevelopmenthands tiedcuriositydecomposing bodyfranchiselearning the truthracial segregationbrother in law brother in law relationshipgentrificationart dealerheadrottweilertrapped in an elevatorpublic restroominvisible manhousing projectrebootracialafrican american manhousingfansboogeymanhorror iconhand woundwhitecrime victimnew homeracial violenceurbanvengeful ghostbee stingdisbelieforal historywhite womanfourth in serieslaundry roommemestoriesabandoned churchpillow talkracial injusticeapartment complexfirst filmlegendstenementorigin storyvisualart criticabandoned apartmentanti racismhole in the wallchance encounterperspectiveclassicgirls' bathroomfinestabbed with a penthroat slashedhousing developmentsummoningpolice coverupkilling in self defenseurban gothichomosexual couplekilled by policereference to halloweenart curatorart gallery ownerderelict buildinghook for a handideapresent dayrevenge from beyond the gravebackstorybased on urban legendglass elevatorhole in a walljumping to deathnew generationstrongsweetsyear 2019life imitates artreal worldreference to joy divisiondifferent face in mirrorforce of naturelow income housingold timervengeful spiritart imitates lifeinternet searchslashed throatstorm cellarmental health issuesopen woundvisual artistart reviewdoing laundryhistory repeats itselfmissing babyscreaming child (See All) |
In a small town in Maine, seven children known as The Losers Club come face to face with life problems, bullies and a monster that takes the shape of a clown called Pennywise.
Subgenre: | supernatural horrorcoming of agesuspenseepic |
Themes: | supernatural powernear death experiencegrieffearmurderdeathfriendshiprevengesurrealismkidnappingbetrayaljealousyescapemonsterdeception …memoryangerracismpsychopathbrutalitydysfunctional familyguiltinsanitysadismevilbullyingabductioncrueltypanicfalling in lovecourageregretmissing childunlikely friendshipschool bullying (See All) |
Mood: | goreraindarknesshorror movie remake |
Locations: | lakewoodsforestschoolsmall townbicycletunnelschool bustownsewerabandoned factory |
Characters: | serial killerfriendafrican americanfather son relationshippolicemother son relationshipfather daughter relationshipteenagerchildrenbrother brother relationshipteenage girlteenage boyzombiepolice officeralien …hostagelove trianglelittle girlbullykillerlittle boyvillainfathergrandfather grandson relationshipself mutilationsingle fatherchildhood friendfrench kissdream girlblonde girlbar mitzvahjewish americanmean girlevil father (See All) |
Period: | 1980s1950ssummeryear 1989year 1988 |
Story: | horror moviehorror filmwind chimefeature filmschoolteacherserial murderlostscene during opening creditstragic eventhouseslow motion scenecell phonebloodviolenceone word title …flashbackkisscigarette smokingphotographtitle spoken by characterchasesurprise endingpistolbased on bookbeatingcorpsearcade gameshot in the headrescuepunched in the facewatching tvbattlefalling from heightbookvomitingshowdownrunningbathroomhallucinationtelephoneswimminggood versus evilnewspaperbedroomflashlightgangdisguisemontageimpalementstabbed to deathstabbed in the chestweaponfalse accusationapologychildanimaldouble crosscreaturepolice officer killedshot in the foreheadon the runflash forwardlibrarycursedangerstabbed in the backportraitcostumeprologueclownsuburbproduct placementstatuemissing personkicked in the facetough girlscreamattempted rapefarmermanipulationdeath of brotherpianistdisappearancestalkingbasementbrotherstagefirst partthreatened with a knifesevered armgraffitinewspaper headlineredheadgaragesingle parentstrong female charactermaniacholidaynerdhuggingfireplacekilling an animalballoonwoundstreetheavy rainsociopathwalkie talkiemovie theaterblockbusterwristwatchgossipcampclassical musicpsychojumping from heightsevered handcovered in bloodsheepcrushmind controlparadetorchinterracial friendshipchokingseriesswitchbladeface painttarget practiceshopliftingbraveryresearchstabbed in the throatobesityhatredstabbed in the neckfalling to deathbutcherlove at first sightheadphonesstabbed in the headfirst kisshit on the headlaughterpedophilewisecrack humorslaughtercliffrefrigeratorstabbed in the eyechairabusive fatherclassmatebroken armbruiseriding a bicycleswearingholding handssunbathingpsycho killerposterhit with a baseball batexplorationheroismunderdogpetbad guylevitationfinal showdownoutcastbandageglovesold dark housepostcardlockerstairwayautographname callingwoodabandoned househomicidal maniaccomic reliefbully comeuppanceroller coasterwelltomboysleepasthmadomineering motherrumorpharmacyunconsciousnessbare chested boycigarettekiss on the lipsbaseball cappatricidemarching bandchild kidnappingpiperetrosummer vacationdomestic abuseunderage smokingstation wagonteamworkdisfigured facemusic boxtitle same as bookmenacefacial scarjumping into waterclawcleaningshapeshiftingmonumentstutteringbloody violencereference to michael jacksonmainekidssadistic psychopathaccusationpsychotronic filmkiss on the cheekgarbage canold housemurder spreeanimal killinggrindhouse filmchild abductiondeterminationevil clownkeyboardfleeingslimekicked in the groinred hairarm slingfictional cityregenerationknife held to throatfacesidewalkglobejumpsynagoguetauntingcutting hairdeeply disturbed personmovie posterarm ripped offfalling through the flooradaptationchild swearingtalking to oneselfpharmacistboom boxbucketdutch anglestabbed in the mouthwashingkiller clownnail gunoatharchival photographchevroletquarryreanimationinvulnerabilityyoungfamily photographvideo arcadecamaraderiecreekmarionetteslide projectorsweatingbeaten upironhead bandagemarchingguilty consciencehypochondriacraincoatorigamichemisttrailconvulsiontarget shootingsynthesizerbustdemonichit with a rockmissing person posterboogeymandistractionhorror iconschoolmateson murders fatheryearbookwashroomworryingkayakplayingantique dealersibling relationshipimplied incestduffel bagjack in the boxarm castmulletold couplepolice officer stabbedrainy daystatisticssunflowercadetfarewellchild neglectbitten in the facefootbridgeteen smokingthrowing a rockincest subtextinhalerslidewallpapermullet haircutoverweight womancarvingcirclecontainertraumatic childhoodcargoolder brotherviolence against a childcobwebcry for helpsheetstorm drainblack boyslideshowcongregationleperlife lessonmini seriesnew kidsuburbiahorror storyradiatorreference to metallicawaxbeheadedredheaded girlchild hostagediversiongroup hughiding in a bathroomlamp postplaceboprojectorreference to the lone rangerschool projectfighting backironing boardpantrytown squaretraumatic childhood experienceblood oathgroup of childreninanimate object comes to lifekiss on cheekrailroad bridgered balloontape measureovercoming fearsmiley facechildhood crushgarage doorpublic libraryroad constructionserial child murdershapeshifterbarred windowbranchchoking someonecliff divingcovered bridgedilapidated houseevil creaturebaton twirlingsplashsuspended by armsglowing eyetrans amwhiskey bottle2013slut shamingsneak attackstained glassevil smileideameasuring tapereference to clark kentsplashing watertrain trackbullying victimdead treefloating in the airforce of evilgutteroverweight boypill boxroad mapstompingsuspended mid air2017light switchmeasurementboarded up windowcutting one's own hairdaughter kills fatherprescription bottletouching genitalsbody slamkilling a sheepreference to molly ringwaldsitting in a bathtubtalking to an inanimate objectdeath in the familydoor ajarflooded homefriends fightingmissing person flyermunchausen syndrome by proxypaper boatportrait comes to lifesun tanningthrowing a stonebodily fluidschained doorcleaning a bathroomcovered with blooddeserted housegray tabby catkicking in doorrolling downhillslaughter housestreet signback doordemonic presenceface to facemurder in self defensepet hamsterposter on the wallreference to lois lanereference to new kids on the blockshower capspreading rumorthrown against a wallarm bitten offbare chested teenage boybarefoot boycarving into human fleshcassette tape recorderchicken fightchild eaterclown dolldemonic entityflag wavinggroup photographhistory bookhome schooledhugging one's friendmaking a dealscared childsuspected child abusewandering off (See All) |
The pediatrician Alexandre Beck misses his beloved wife Margot Beck, who was brutally murdered eight years ago when he was the prime suspect. When two bodies are found near where the corpse of Margot was dumped, the police reopen the case and Alex becomes suspect again. The mystery increases when Al …ex receives an e-mail showing Margot older and alive. (Read More)
Themes: | griefdrinkingsuicidemurderdeathlovefriendshipkidnappinginfidelityrapepoliticsadulterytortureescapewedding …investigationvoyeurismmemoryextramarital affaircorruptiondeath of fatherobsessionblackmaildrug useguiltunfaithfulnesssurveillancedeath of wifeforgivenesspolice brutalitymurder investigationpolice corruptionmysterious deathmurder of father (See All) |
Mood: | night |
Locations: | lakewoodsforestbarhospitalrestaurantparis francebusairportelevatorpolice stationpolice carfrancerooftop |
Characters: | husband wife relationshipserial killerfriendfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipdoctorboybrother sister relationshipgirlpolice officernurse …detectivepolicemanphotographerbabylawyerwaitresskillerfrenchamericanpolice chasechildhood friendcoronerfather in law son in law relationshipmother in law son in law relationshipboy girl kiss (See All) |
Story: | walking a dogapple computercircular staircasemourningsubjective camerasecretdrinkslow motion scenemirrorcell phonemale nudityfemale nuditybased on novelnudityblood …violencefemale frontal nudityflashbackmale frontal nuditymale rear nuditydogbare chested malegunfemale rear nudityfightfemale full frontal nuditycigarette smokingphotographmale full frontal nuditylesbian kisschaseshowertelephone callcryingbeatingcorpseshot to deathunderwearfoodhorsecar accidentface slapshotgunpunched in the facewatching tvcomputercameraarrestundressingbare buttshootinglierifletearsrunningdead bodycafejailvoyeurmale pubic hairrevolvertelephoneshot in the backswimmingcleavagegay slurnewspapervideo cameramansioneatingfemale pubic hairinternetnonlinear timelinefalse accusationapologyman with glassesscantily clad femalecoffinassassinationforeign language adaptationsearchvanlatex glovesflash forwardconfessionparkskinny dippingsmokingbinocularsprologuekeymissing personcover upbaseball batfemale full rear nuditylong takegymdisappearancepursuitcountrysidedeath of sonthreathorse ridingsadnessratsuspicionmurderertied upflowerhandguntypewritergraffitiheroinapplausetv newsbow and arrowrevelationinjuryred dresswalkie talkieloss of loved onedrug abusehidingloss of wifedesperationdriving a carfaked deathstreet lifeclockhomicidepresumed deadpassportretirementcamera shot of feetdivingphoto shoothaunted by the pasttensioninnocencesurveillance cameraplaygroundburglarylesbian coupleautopsye maildeerhighwaycellphonesuspectpolice raidduckbruisenude woman murderedbenchsports cartan linechildhood memoryframed for murderdead dognude swimminganniversaryhandshakedark secretcremationstreet gangrepeated sceneabuse of powerstairwaystreet marketbitternessgun held to headframedtraffic jamfemale lawyermale rapehired killernude girlcigarettefallingscene of the crimeplaying a video gamednastableemergency roominsurancebody bagnaked dead womandocumentmurder of wifemultiple murderhitchcockiandead catanguishwoman undressingchild rapecriminal investigationtreadmillclimbing out a windowfinding a dead bodysurveillance footageintercomtelephone numbertrophy wifecrotch shotfemale in a showerstun gunhand kissingpocket knifealibistreet kidwife abusesafe deposit boxman undressingpokiesperjurydoor bellwood carvingequestrianransackinghitting a womanphoto studiosidewalk cafeaudio recordingbroken windshieldblood sample911 callwall safeinternet cafewiretapdead body in a car trunki.d.pediatricianbox cutterchildhood lovearm injuryprime suspectinsurance policyhemophiliahorse jumpingplanted evidencewatching a video on a computergarbage dumpsterbreaking a glassbluffingslipping and fallingwife beatingbandstandhorse stableidentifying a dead bodybody in a car trunkhunting accidentparisian outskirtsballisticsstreet riotoff screen suicidecar pileupcomputer storehiding in a dumpsterstate senatorcomputer searchhunting trophymounted deer headautopsy reportflower deliverymidnight swimdna sampledragged by hairheroin userinternal bleedingparc monceau paris (See All) |
In 1999, retired Argentinian federal justice agent Benjamin Esposito is writing a novel, using an old closed case as the source material. That case is the brutal rape and murder of Liliana Coloto. In addition to seeing the extreme grief of the victim's husband Ricardo Morales, Benjamin, his assistan …t Pablo Sandoval, and newly hired department chief Irene Menendez-Hastings were personally affected by the case as Benjamin and Pablo tracked the killer, hence the reason why the unsatisfactory ending to the case has always bothered him. Despite the department already having two other suspects, Benjamin and Pablo ultimately were certain that a man named Isidoro Gomez is the real killer. Although he is aware that historical accuracy is not paramount for the novel, the process of revisiting the case is more an issue of closure for him. He tries to speak to the key players in the case, most specifically Irene, who still works in the justice department and who he has always been attracted to but never pursued due to the differences in their ages and social classes. The other issue is that Gomez is still at large, no one aware if he is alive or dead. But as Pablo at the time mentioned that passion is one thing that cannot be changed in behavior, Benjamin learns now that that premise still holds true. (Read More)
Subgenre: | legal drama |
Themes: | self sacrificegrieffeardrinkingmurderdeathlovefriendshiprevengekidnappingrapedrunkennessescapeinvestigationmemory …angercorruptionobsessionhumiliationsurveillanceabusecrueltydeath of wifevengeancewritingjusticepolice brutalitypolice investigationmurder of husbandrape and murder (See All) |
Mood: | darkness |
Locations: | bartraincemeterytaxielevatorpolice stationcourtroomofficetrain stationschool teacher |
Characters: | husband wife relationshipteacherfriendpolicemother son relationshipgirlpolicemanphotographerwriterlawyersecurity guardalcoholicyounger version of characterself justicepolice dog …writing a novelpolice interview (See All) |
Period: | 1970s2000syear 1974 |
Story: | walking a dogframed photographman kills a womanschoolteacherbearded manhusbandalarm clockoccultsubjective camerasecretdrinkslow motion scenecell phonemale nudityfemale nudity …based on novelnuditybloodviolencebare breastsfemale frontal nudityinterviewflashbackmale frontal nuditydoggunsex scenekissfightcigarette smokingphotographchasesurprise endingtelephone calltopless female nudityvoice over narrationcryingbeatingcorpsetesticlesmachine gunurinationpunched in the facearrestbare buttletterbooktearsrunningdead bodyinterrogationcafejailalcoholtelevisioncleavagefoot chasebedroomsoccerdeath of friendmontagefootballprisonernonlinear timelinejudgeman with glassessearchold womancoffeelatex glovesconfessiongraveprologuewidowerattackundercoverpassionfull frontal female nuditybankflowerscourtlong takepursuitdeath of husbandpigratsleepingtypewriterrecord playertwenty somethingflirtingmachismoeyeglassestv newshuggingtearevelationbreaking and enteringdresscagefriendship between meninjurywoman with glassesrecordingjail cellcrucifixloss of loved onebeardloss of wifeassaultpuzzledead womanbosshomicideretirementwatching televisionwhiskeycrime scenehaunted by the pasttensionargentinaconstruction sitemobile phonepastpartnerco workernovelistfootball playerfrustrationevidenceaerial shotsurprisecaptureprison cellsuspectmustacheintruderstadiumrelease from prisoninjusticebruisepolice inspectordeath of loved onemelancholycrowdphoto albumimprisonmentdead girlmysterious maninvestigatornotebookgatedark secretforced sexconstruction workerlocal blockbustermen's bathroomsuit and tiemale friendshiptelevision newswhistleanimal crueltyno title at beginninglatin americadistrict attorneystakeoutwrathdeath penaltymacguffinwriter's blockshort skirtprosecutorsouth americamurder of wifesoccer playersoccer matchold photographcapital punishmentin medias resanguishbuenos aires argentinainspectorfemale bossretributionman hits a womanwrongful arresteyesflash cameraleg injurysleeping on a couchdignitycourthousescottishdrinking alcoholreading a lettersoccer fanaspiring writerbody part in titlealcohol abusenightstickdeath of partnerman punches a womanpublic restroomlong black hairred rosejudicial systemfandomfootball stadiumhitting a womantoilet stallfalse confessionharvard universityjudicialjudiciarykiss on the foreheadjudgmentbloody handcivil servantlegal systemsoccer gameunsolved crimeclimbing a fencesoccer stadium23 year oldangry manargentineemasculationbank clerkmusic score features pianoclosing eyes of dead personforced confessionjealous manthe pastlife imprisonmentsleeping on couchmaking lovereference to the three stoogeshierarchyvoice over writingunreliable flashbackmale sitting on a toiletsurprise visitangry bossgood cop bad coprotary phonehands upreference to don quixotedeductiondirty warkilling the wrong personreference to prince charmingbloody corpsefalse pretenseoperation condorinternal strugglekicking a dogblack and white televisiondate with coworkerdesk lampflashback montagefood traygoodbye at train stationkicking a doorsecluded housetouching handsco worker co worker relationshipcocking a guncornell universitydog barkingdog walkingmispronounce namepen and paperconfession under tortureneck scarfseeking justicecoerced confessionexposing one's penisillegal entrylong haired womanmurder of partnerprivate conversationwoman with long haircriminal courtfemale emasculating a malejudicial misconductshirt and tiewalking alone at night (See All) |
A deaf woman is stalked by a psychotic killer in her secluded home.
Subgenre: | slasher horror |
Themes: | murderdeathfriendshiphome invasionexploitation |
Locations: | woodsforestrural settingpolice carbackwoods |
Characters: | neighbor neighbor relationshipserial killerfemale protagonistfriendsister sister relationshipkillerdeafnesswriting a book |
Period: | 2010s21st century |
Story: | dream sequencehorror filmproduction companysound designdisembodied voiceframed photographscreaming womantext messagelocked doorserial murderlaptop computerwoman in jeopardycrying womanhouseslow motion scene …cell phonef ratedbloodviolenceone word titleflashbackfightcigarette smokingphotographknifechasecryingcorpseshot in the chestpunched in the facecomputercatfalling from heightmaskbookdead bodybathroomcriminalsurvivalfoot chasebedroomflashlightcookingstabbingstabbed to deathvoice overshot in the legauthorscreamingfantasy sequenceevil mancabinsubtitled sceneredheadstrong female characterbow and arrowbreaking and enteringwoundhunterhammerchokingmasked mandamsel in distressseriestensiontrappedcrossbowstabbed in the neckmutehit on the headlipstickarrowsign languagemasked killerflat tiredeafset upminimal castrepeated scenealarmalonevery little dialogueshot with an arrowbroken windowearringself defensehearing voicescigarettecabin in the woodsbreaking a windowbleedingbleeding to deathcrying femalelighting a cigaretterooftextingiphoneinternet chatman hits a womanclimbing out a windowleg injuryman slaps a womanfemale writertalking to oneselfdeaf mutebloody facefire alarmwoman punches a manwriting in bloodsecretly observinghand injurypretending to be someone elseskypehome alonebroken handbroken fingergarlicbreaking a car windowcollartalking to an animalwoman hits a manfantasizingsilent protagonistlimpingcar alarmsmall castfantasy scenetaking off pantsdragging a dead body2012disbeliefjackhammermurder by stabbingonionc wordinner voiceisolated housearm injurycorkscrewdeaf womanmini seriesmale female fightbiting someonespurting bloodwriter as protagonistdragging someonestranglingviolent manescape out a windowreference to stephen kingclimbing in a windowlimping manlocking a doorsprayclimbing up a buildingmeningitistourniquetcrying for helpwriting in lipstick2013roof chasetalking to a catclimbing on a roofdeaf personmasked intruderslapped in the faceslashed tirevictim fights backweb chatbroken car windowescape by the windowmoving a dead body20152017sitting on the floorfinger injurytalking to a dead bodyemergency callhearing impairmentlying on the floorarrow in the backbarricading a doorpretending to be a policemanfeeding a catslamming a door on someone's handstanding on a rooftopstepping on someone's handchekhov's gundisinfecting a woundhunter and the huntedstolen cellphone (See All) |
High school loner Bird Fitcher has no idea what dark secrets are tied to the mysterious Polaroid vintage camera she stumbles upon, but it doesn't take long to discover that those who have their picture taken meet a tragic end. Bird and her friends must survive one more night as they race to solve th …e mystery of the haunted Polaroid before it kills them all. (Read More)
Subgenre: | ghost storycreature featuresurvival horrorurban fantasy |
Themes: | supernatural powerghostsuicidemurderdeathrevengekidnappinginvestigationpsychopathhumiliationbullyingabductiontraumamysterious deathsupernatural being |
Mood: | high school |
Locations: | schoolhospitalsmall townpolice stationpolice carschool bully |
Characters: | husband wife relationshipfemale protagonistfriendfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipdoctorteenage girlteenage boypolice officernursestudentpolicemanphotographer …bullysheriffsuicide by hangingcrying girlgay best friend (See All) |
Period: | 1970syear 1974 |
Story: | looking at oneself in a mirrorhigh school studentbelief in ghostsjump scarediscovering a dead bodyframed photographhauntedscreaming womanlocked doorserial murdercrying womanwidowslow motion scenef ratedblood …one word titleflashbackdogphotographtitle spoken by charactertelephone callcryingremakepunched in the facecameraarrestfalling from heightshootingcriminalf wordhalloweensurvivalflashlightdinerforeign language adaptationpolice officer killedold womangunshotlibrarycursecostumeelectrocutionscreamhalloween costumescarsplit screengiftvigilantenewspaper headlineredheadundeadbreaking and enteringgay characterlistening to musicsexual abusehammervisitteenage protagonistback from the deadfull moonphoto shootpet dogfalling to deathhit on the headsexual harassmentatticfemale doctorpublic humiliationriding a bicyclenewspaper clippinghalloween partymysterious mantaking a photographfire extinguisherstabbed in the handoutcastdead fatherlighterpolaroidhospital roomcostume partynewspaper articlepocket watchvigilante justiceelectric shockbased on short filmcrying femalelighting a cigarettescarfdance scenememorialman on firevisitorantiquepolaroid cameraarchiveneuroticsilhouettefinding a dead bodypointing a gun at someoneselfiedrinking from a bottleshower roomtalking to oneselfpassive aggressive behaviorantique shopsecretly observingposing for a photographhand injurypassive aggressive womanrepeated eventlocked insocial outcastintrovertfemale photographerhanged womanclassmate classmate relationshiphospital visitkiss on the foreheaddeath by electrocutionantiquityprojectiontaking a selfiescreaming girlprivate investigationburning a photographdisbeliefunreliable narratorhand bandagedying repeatedlymysterious eventphoto sessionreference to little red riding hoodcut in halfarm injurydead daughterlesbian charactermalicestabbed with a pencilclimbing a ladderdragging someoneprojectorunreliable flashbackcompromising photographfrontier justiceamateur photographerhanged to deathschoolmate schoolmate relationshiptraumatic memorywoman on firerevenge from beyond the graveopening creditsantique storehole in handsitting on the floorburned handgrim reaper costumeunpunished crimearm bandagelittle red riding hood costumelying on the floorpassive aggressive girlmysterious figureanimal senses evilneck scarskeleton mask (See All) |
A family is forced to live in silence while hiding from creatures that hunt by sound.
Subgenre: | psychological horrorsuspensepost apocalypsedystopiacreature featuresurvival horror |
Themes: | supernatural powernear death experienceself sacrificegrieffearsuicidemurderdeathlovemarriagepregnancyescapemonsterguiltillness …surveillancepanicblindnessregretghost town (See All) |
Mood: | nightnightmaredarkness |
Locations: | woodsforestbathtubwaterrural settingfarmrunning in the forest |
Characters: | husband wife relationshipfemale protagonistfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage girlgirlaliendancer …babylittle boyterrorengineercrying babybaby boyactor director writeralien monster (See All) |
Period: | near future21st century |
Story: | looking at oneself in a mirrorbloody footprintnew york statebearded manlooking out a windowmourningwoman in jeopardycrying womantragic eventmirrorbloodviolenceflashbackgundancing …photographchasethree word titlesurprise endingfirecorpseblood splatterfoodshot in the headshotgunrescuecamerafalling from heightshowdownriflerunningrivertelevisioncleavagesurvivalnewspaperflashlightcandleold manaxebridgeeatingimpalementweaponfishdinnerapologyradiodrawingchild in perilcreaturesearchold womanpainflash forwardmicrophonedangerprologuerace against timetough girlscreamfarmerlong takedirected by starpursuitcountrysidestalkingcrosschildbirthbasementcharacter says i love youwaterfallfireworksnewspaper headlinesubtitled scenestrong female characterpickup trucksisterhuggingmedicineinjurylistening to musiccrucifixtoybeardoverallshidingwristwatchbarefoot malejumping from heightteddy beartorchfull moonstupiditypromisealien invasionbarefoottensionfloodpillssufferingsurveillance camerabackpackcigarette lighterwedding ringrefrigeratorfemale doctorbarefoot femalelanternlens flarecellarbonfiresign languagenewspaper clippingholding handsarrogancetorso cut in halfvideo surveillancedeafwritten by cast memberminimal castdirected by cast memberabandoned housevery little dialogueanimal crueltytrain tracksnewborn babyfilmed killinggame playingoverhead camera shotboard gameparentingpsychotronic filmkiss on the cheekanimal killingalien creatureleg injuryflickering lightrearview mirrorrescue attemptextrasensory perceptiontraffic lightoxygen maskwater towerred lightham radiomissing person posterkiss on the foreheadhearing aidwoman with a guncandlelight dinnerhome schoolingreference to new york cityalien life formstocking capreflection in a mirroramateur radioamerican sign languagepregnant woman's water breaksmysterious creaturewalking on train trackslighter fluidolder sisterabandoned townactor director producer writerear piecegas lampsnapping fingersreal life husband and wife play husband and wifebarefoot girlwhite boardhanging mobilesmart girlopening creditscrying teenage girlbloody bathtubjean jacketsplashing water on one's faceabandoned storecochlear implanttoy rocketsignal firestepping on a nailwalking in a forestbritish actress playing american charactercarrying a childfoot woundsilent sceneaudio feedbackcatching fish by handgrain siloprescription drugradio transmitterwading through watershorthaired girl (See All) |
Madison is paralyzed by shocking visions of grisly murders, and her torment worsens as she discovers that these waking dreams are in fact terrifying realities with a mysterious tie to her past.
Subgenre: | supernatural thrillersupernatural horrorpsychological horrorsuspensemurder mysterybody horrorslasher horror |
Themes: | supernatural powerthe devilnear death experiencemental illnessfearmurderdeathrevengesurrealismkidnappingprisonpregnancyescapemonsterinvestigation …deceptionbrutalityevilhome invasionadoptionpanictraumaamnesiadevilmurder investigationpolice investigation (See All) |
Mood: | nightmaregoredarkness |
Locations: | hospitalhotelbathtubwheelchairurban settingapartmentpolice stationpolice caroceantunnelkitchen knife |
Characters: | night terrorhusband wife relationshipserial killerfemale protagonistpolicemother daughter relationshipdoctorbrother sister relationshipprostitutepolice officerdetectivehostagesister sister relationshipbullysecurity guard …police detectiveterrorpolice shootoutpregnant womanpolice chasedoctor patient relationshipslasher killer (See All) |
Period: | year 1994year 1985year 1993year 1992 |
Story: | horror filmscreaming womanserial murderwoman in jeopardywidowsecretslow motion scenedreamcell phonebloodviolenceone word titlephotographknifechase …surprise endingpistolcorpseblood splattershot in the chestblondeshot in the headshotgunrescuewatching tvarrestshowdownbirthdayjailf wordgood versus evilsurvivalfoot chaseambushmassacreambulancethroat slittingstabbed to deathprisonerstabbed in the chestbrunetteradiodrawingbirthday partypolice officer killedflash forwardattempted murderone against manyhotel roomdangerstabbed in the backprologuescreamingrace against timelightningdomestic violencelong takeneck breakingsuspicionthreatened with a knifeprofanitystylized violenceflirtingsurgerybirthday cakerevelationelectronic music scoregothicheavy raincomajail cellvideotapehome moviemind controlbroken legduct tape over mouthdamsel in distressvisionfight to the deathstabbed in the throatmercilessnesspower outagemental hospitalpolice officer shotwomen's prisonbased on storyatticrainstormeye gougingfemale doctordark pastbody countbroken armtrophykilling spreeabusive husbanddaggermiscarriagepsycho killerseattle washingtonmemory lossabandoned buildingblood on camera lensmental patientcartoon on tvhead woundlong hairscene before opening creditssuper strengthmajorimaginary friendhospital bedsplit personalityhearing voiceshead injurydomestic abusetour guidepsychiatric hospitalmacabredisfigured facefemale copfemale police officerparasitesuperhuman strengthstabbed in the faceoverhead camera shotsubterraneanadopted daughtersiblingsbloody violencegiallohappy birthday to youpsychotronic filmold housemurder spreeblack copcriminal investigationman hits a womanwrongful arrestgrindhouse filmtrenchcoatpsychosiswomen in prisonbrain tumorcaptivitydeeply disturbed personevil childpolice partnercoercionfalling through the floorvideo diarytumorenglishwoman abroadmass killingrepressed memoryevil twinflash driveadopted childheart conditiontranquilizer dartdefibrillationdefibrillatorstabbed with a swordgiallo esqueabsurd violenceholding cellafrogory violenceevil laughtermulletpolice officer stabbedkilled with a swordblenderringing telephoneinside the mindpathologistmullet haircutpsychiatric patientunderground tunneladoptive mothersecurity guard killed8 year oldreference to wikipediawaking up from a comaconjoined twinsdead body in a bathtubreference to nirvanaresearch facilitytranquilizer gunpolice officer throat slitrecordstelephone terrorsequel baitingpsychic visionreconstructive surgeryseattle space needleadopted sisterwalking backwardsadopted girltraumatic memorypacemakeryear 2020evil brotherpsychotic killerreference to pearl jampacific coastblood on headdifferent face in mirrorwriter director producerdevil childpolice officer killed in police stationconnect the dotsarm chopped offevidence roomred telephoneserial killingshared universesolving a crime (See All) |
A group of families on a tropical holiday discover that the secluded beach where they are staying is somehow causing them to age rapidly – reducing their entire lives into a single day.
Subgenre: | psychological horrorsuspensesurvival horrorpsychological thrillerbody horrorcorporate conspiracy |
Themes: | supernatural powernear death experiencemental illnessfeardrinkingmurderdeathfriendshipsurrealisminfidelityadulterypregnancyescapedeceptionmemory …extramarital affairdivorceinsanityunfaithfulnesssurveillancepanicpolice investigation (See All) |
Mood: | night |
Locations: | beachhotelhelicopterwaterseacaveoceanjunglecampfirelaboratorysinging in a carsinging on a bus |
Characters: | husband wife relationshipfriendafrican americanfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctorchildrensingerboybrother sister relationship …teenage girlteenage boygirlpolice officernursedancerbabysister sister relationshiplittle girllittle boyuncle nephew relationshipgrandmother granddaughter relationshipaunt niece relationshipaunt nephew relationshipmother in law daughter in law relationshippregnant teenagermuseum curator (See All) |
Period: | 2020s |
Story: | looking at oneself in a mirrordifficulty breathingdiscovering a dead bodyscreaming womanmourningcrying womanblack americansubjective cameradrinkslow motion scenemirrorcell phonefemale nuditynudityblood …violenceone word titleflashbackdogbare chested malefemale rear nuditytitle spoken by charactersingingknifechasesurprise endingcryingsongcorpsefoodcomputercamerawritten by directorarrestbikinifalling from heightbased on comicdead bodyislandscienceswimmingsurvivalfoot chasebased on comic bookold manvideo camerastabbingeatingstabbed to deathstabbed in the chestfalse accusationapologyunderwater scenevanold womandrowningpainskinny dippingattempted murderargumenthotel roomdangerstabbed in the backscreamingvacationrace against timesuitcasedollmissing personskeletonlong takedisappearancechildbirthtrapthreatened with a knifetrustteenage sexcheating wifeheart attackterminal illnessholidaysurgeryexperimentapplauserockmedicinerevelationwounddrugdiseaseaginghidingassaultfraudcheftimepsychologistbuttcrying manschizophreniabreakfastbroken legpresumed deadpassportbarefootnicknametelescopesandold ageunfaithful wifehungerfalling to deathescape attemptrapperinfectionfriendship between boyshealingmarital separationcorporationbroken armgrowing upsurgeonsunbathingdrugged drinkmemory lossenglishman abroaddirector cameosandwichgatetwist endingreading aloudblackoutlizardself defensemarried couplewhisperingcoastinterracial marriageresortsicknessclimbingunconsciousnessbased on graphic novelracial prejudiceswimming underwaterreading a bookrole reversalnewborn babyseizuremacabrecodeinterracial coupleoverhead camera shot11 year oldbreastdeath by drowninghuman experimentpsychotronic filmscience fictionepilepsyheadachecriminal investigationrock climbingdreadlockscocktailhide and seekmortalityextreme close upcaptivityregenerationjet skitalking to oneselfpassing outmedical experimenttumordecomposing bodyenglishwoman abroadfalling off a cliffcorporate executivesenilityhuman experimentationoverheard conversationpocket knifedead babyfamily vacationscientific experimentbeach volleyballmale nursestabbed with a knifegraphic novelreference to marlon brandomultiple sclerosismedical researchpastacandy barcoastlinepharmaceutical companyelderly couplescreaming mansecret laboratoryrealizationcomic book artisthuman skeletonold couplestatisticsfoaming at the mouthcoffee tableexperimental drugbeach resortmysterious disappearancereefsecret experimentwoman murders a mansandcastlecardiac arrestescape planmedical treatmentcoral reefepileptic seizurecoralelderly people6 year oldbody transformationwading in waterclaustrophobicpharmaceutical industryreference to jack nicholsonchanging clothescoded messagedrug testinghemophiliahuman guinea pigheart surgeoncardiologistholding one's breath underwaterrapid agingsecret messageoldchild as adultexplanationstriking a matchtropicalcoveresort hotelbroken boneshivfictional druggraphictelephoto lensrapid healingdomestic disputemedical conditionmistaken belief that someone is deadface slashedfemale psychologistlighting a matchclinical trialseaside resortblurred visionemergency surgeryopening creditsremoving bikini topdomestic quarrelfloating bodyflying in a helicopterethical conflictgrowing oldmale doctorscientific discoverycovering a dead bodycrying teenage boydead body floating in waterdead nude female bodyresearch teamscience fiction writerfield surgeryfloating on waternature preserveswimming in the oceanbeach chairchief medical officerocean waveunethical practicewalking into a trapaction toybrittle bonesclimbing a cliffpharmaceutical labpsychotic episodetropical resortunwilling participantbeach umbrellabell uh 1 iroquois helicopterblacking outmedical trialnude corpseparents arguingplaying in the surfsingle daystabbed over and oversurgery without anestheticvacation gone wrongvacation resort (See All) |
The Black Phone Norman Gidney June 24, 2022. strong is one of the best horror films of 2022. Why? It has a simple story that allows room for nuance, a frightening villain, and a phenomenal hero. This paired with solid work from director and co-writer Scott Derrickson with co-writer C. Robert Cargill … and a set of great performances, The Black Phone will leave horror fans entirely satisfied. Set in the mustard-toned 70's we follow a suburban Colorado boy Finnley (Mason Thames) who is abducted by local serial killer The Grabber (Ethan Hawke) only to get assistance from his previous victims through a disconnected black phone deep within his captor's soundproof basement. Blending elements of true crime and paranormal thrillers, The Black Phone delivers suspense, horror, and that pristine hope that a sequel isn't attempted.. Based on a short story by Joe Hill (Stephen King's son and the little boy in Creepshow) the film opens at a baseball game. Finnley nearly strikes out the star hitter of the opposite team, Bruce ( Tristan Pravong) yet the two recognize each other's skill. After school Finnley and his sister, Gwen (Madeleine McGraw) make their way home to their alcoholic father Mr. Shaw (Jeremy Davies) and chat about the latest abduction. Like an invisible executioner, The Grabber picks local boys off, leaving behind black ballons and creating a palpable sense of dread among the youth. Then one fateful day, Finnley is abducted. He wakes up in a barren, subterranean concrete cell… (Read More)
Subgenre: | supernatural horrorpsychological horrorsupernaturalsuspenseteen horror |
Themes: | feardrinkingghostmurderlovefriendshipkidnappingtortureescapeinvestigationangerpsychopathbrutalitybullyingabduction …police investigationmissing childstarvation (See All) |
Mood: | nightmarerain |
Locations: | schoolsmall townbathtubbicyclepolice carbaseball |
Characters: | serial killerteacherfriendafrican americanpoliceteenagerbrother brother relationshipbrother sister relationshipteenage girlteenage boygirlpolice officerdetectivepolicemanreference to god …bullykillerasian americanfatheralcoholic fathercrying girl (See All) |
Period: | 1970syear 1978 |
Story: | horror movielocked doorbearded manserial murderscene during opening creditsblack americansubjective cameradrinkslow motion scenedreambloodviolenceflashbackdogfight …chasetelephone callbeatingfoodpunched in the facewatching tvarrestmaskliereference to jesus christclassroomcolor in titletelephonesurvivalgay slurnewspaperflashlightstrangulationaxeambulancemontageeatingtoiletchild abuseapologysearchvanflash forwardprologuesuburbwidowerbased on short storyevil manpursuitbasementneck breakingtrapclassnewspaper headlinestrong female characterrecord playersisterfireplacehead buttballoonlistening to musicrecordingice creamcrucifixskateboardteenage protagonistcrying manbreakfastmasked manpromiseswitchbladenicknamevisionthunderescape attemptlaughterslaughtercaptureraised middle fingerabusive fathercellardead motherphoneriding a bicyclemasked killervodkamemory lossmexican americanpsychopathic killerprayingbarking dogtrue crimemeatname callingblacksleepcolorado13 year olddripping bloodchild kidnappingmale protagonistmediumcluegame playingmasked villaindead wifesleeplessnesstelephone conversationreference to the virgin marystrangled to deathsadistic psychopathbaseball fieldkicking in a doorgrindhouse filmpolice sirenchild abductionguard doghardware storeshort storybloody facefreezerpinball machinesodavideo arcadepadlockdoor bellsadisticclassmate classmate relationshipdenver coloradomissing person posterpenis slurheavy breathingserial child killercoors beerscreaming mansibling relationshipplaying against typereference to bruce leeevil laughterpaperboyreference to the vietnam warscreaming girlcheeringhit on the head with a rockringing telephonerepeated dialoguebroken ankleboys' bathroomtalking to godclimbing up a wallattempted escapeserialarm woundpretending to sleeptelephone terrortalking to a ghostvagina slurlocked in a basementstabbed with a penschool bellserial child murderhome runtelephone hangupb wordblurred visiondigging a tunnelbiology classhit with a telephonearm bandagecrying teenage boyfood traytoy rocketcreaking doorstate of mindfellatio slurstorage roomreference to hellteenage boy with long hairtoilet stoolwearing a mask (See All) |
reviewed by: amber wilkinson "cinematographer stefan duscio's camerawork is crafty, often focusing on empty frames and spaces where adrian might be hiding, so that every scene becomes instantly tense." | photo: universal forget claude rains in bandages, hg wells' tale of an invisible criminal gets a … tense modern makeover in this adaptation by leigh whannell (saw, insidious), which sees the mad doctor reimagined as a domestic abuser. the tension is there right from the start - along with an enjoyable watery credits sequence - as elisabeth moss's cecilia kass drugs her controlling fiance adrian griffin (oliver jackson-cohen) and makes a very quiet run for it from the optical engineer's fortress-like home. the decision not to show any overt violence towards cecilia but to let moss exhibit a long gestating fear instead is a mark of whannell's trust in the imagination of the film's audience, which endures throughout. for most of the running time of the film, adrian himself isn't present with us, instead, left to make him visible in our mind's eye. we are often left to watch moss thinking as well, which is important because she talks a lot about the way that her abusive ex did that too. we are in her head every bit as much as adrian is. escaping with her sister emily (harriet dyer), cecilia takes refuge with emily's friend james lanier (aldis hodge) and his daughter sydney (storm reid)- an attempt at picking the post up from the end of the drive saying more about her state of mind … (Read More)
Subgenre: | supernatural thrillersupernatural horrorsuspensepsychologicaldomestic drama |
Themes: | near death experiencefearsuicidemurderdeathfriendshiprevengesurrealismmoneypregnancytortureescapedeceptionvoyeurismbrutality …obsessionsurveillancehome invasionpanicwealthinheritance (See All) |
Mood: | goreraincar chasedarknesspoetic justicehorror movie remake |
Locations: | hospitalrestaurantkitchenpolice stationpolice carsan francisco californialaboratorykitchen kniferunning through the woodskitchen fire |
Characters: | female protagonistfriendafrican americanfamily relationshipspolicefather daughter relationshipteenagerbrother brother relationshipteenage girlpolice officerdetectivelawyersister sister relationshipbullysecurity guard …police detectivedaughterex boyfriend ex girlfriend relationshipself mutilationsingle fatherengineerbrother in law sister in law relationshipself inflicted gunshot wound (See All) |
Story: | looking at oneself in a mirrorhorror movieupside down camera shotscreaming womanlooking out a windowlaptop computerwoman in jeopardycrying womanarchitectblack americansubjective cameraslow motion scenemirrorcell phonef rated …bloodviolencedogfightphotographknifechasethree word titlesurprise endingpistoltelephone callbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestremakerescuepunched in the facecamerawritten by directorarrestbrawlletterlieheld at gunpointrunningbedinterrogationhandcuffsscientistshot in the backf wordflashlightcookingcaliforniathroat slittingstabbed to deathchild abusefalse accusationapologydisarming someonedouble crossvanshot in the legpoint of viewflash forwardattempted murderstalkerdangerprologuescreamingsuburbelectrocutionchampagnerace against timesuitcaseevil mankicked in the facedomestic violencelong takemanipulationinjectionpursuitstalkingbasementlaptopsuspicionnewspaper headlinegaragehatepowersingle parentsisterwaiteranswering machinemass murderhypodermic needlegothicheavy rainlistening to musicsociopathfaintinglifting someone into the airsecurity cameramad scientisthidingswat teamladderfaked deathinterracial friendshiphitchhikingcelebrationpromiseseriesreverse footagehaunted by the pasttensionnicknameattorneyinventorjob interviewpet dogmercilessnessmental hospitalplot twistframe upattice mailcellphonefemale doctorpolice raiddark pastbriefcaselasersightframed for murderdrugged drinkinvisibilityharassmentfire extinguisherclosettaserhiding in a closetlast will and testamentstairwayalarmhomicidal maniachangoverpregnancy testsleepfemale lawyerpolice interrogationteenage daughterdruggedbeach houseoffscreen killingmailboxwoman kills a mandomestic abusestabbed in the shoulderpsychiatric hospitalfilmed killingcarjackinghigh techsushioverhead camera shotwoman fights a manpsychological torturesleeplessnesscamera phonebloody violenceabusive boyfriendgolden gate bridgehoodiepsychotronic filmurnpenscience fictionfade to blackwrongful arrestagoraphobiafootprintdeeply disturbed personjoggermacetalking to oneselfabusive relationshipdinner tabledoorbellbritish actor playing american charactersecurity systempepper spraymale female friendshipevil scientistcondominiumbeaten upnarcissistrebootchemistlifting a female into the airchemicalsedativehandcuffed womansteakcar alarmhorror iconfake suicidedog collarheavy breathingbank account911 callpsychological abusewoman in perilcontrol freaktrust fundpsychiatric patientwoman murders a manbattered womanclimbing up a wallfountain penspoken inner thoughtsfaked suicidesuburbiataseredfootstepshorror storypacking a suitcaseclassicleather glovestestamentlast willreference to zeussmashing a car windowvibrating cell phonebody suitinvisibility cloaktest tubeuberfainting womanlocking a doormodern architectureevil geniusgender in titleportfoliowearing a wireclimbing over a wallthrown to the floorgaslightingsecurity videomace sprayozploitationthroat slitdoberman pinscherpill bottlewater faucetyear 2020girl in perilopening creditsafro americanfalling to the floorsitting on the floorstrapped to a bedstrongbacon and eggsuniversal monstersthrown across a roomliterary characterlying on the flooropen doorshock collarstate of mindslammed against a wallwhite paintdark universedog bowlhigh tech suitpunching through a car windowuber driver (See All) |
We begin in the back of an ambulance in circumstances so messy and miserable that, taking this together with the chaos that follows immediately afterwards, we might easily believe that we're in some future dystopia, maybe a few years from now when the pressures of worsening weather, shrinking fresh …water supplies and decreased habitable land mass have roughed up the world a little more - but we're not, and understanding what that means is key to getting one's head around Justin Benson and Aaron Moorhead's latest genre thriller.. Remember the ending of Bill And Ted's Excellent Adventure? 'The best place to be is right here and the best time to be is right now.' Well, maybe it was. It's harder to think that way today. There's not much about the major crises facing today's world that science fiction failed to predict, but what's harder to reckon with is the damage done by cynicism itself, the way that every crisis has the potential to be magnified by despair. Synchronic breaks with formula by offering what is ultimately an optimistic narrative, one focused on the fact that, as paramedic Steve (Anthony Mackie) puts it, 'the past really sucks.'. Life as a paramedic has always sucked to some extent. Never mind the shortage of equipment and the disorganisation that our heroes have to deal with - they're also faced, day to day, with life at its ugliest and most self-destructive. Drug deaths are nothing new but lately they've been seeing something unusual. Little black packets marked … (Read More)
Subgenre: | psychological horrorindependent filmsuspense |
Themes: | near death experienceself sacrificegriefdrinkingsuicidedeathfriendshipsurrealismmarriagepregnancydrunkennessescapeinvestigationmemorytravel …angerracismtime traveldrug usecanceralcoholismdyingtraumaphilosophyradiation (See All) |
Mood: | raindarkness |
Locations: | barhotelbathtubdesertelevatorurban settingshiprooftopstrip clubjunglecampfire |
Characters: | husband wife relationshipfriendafrican americanpolicefather daughter relationshipteenagermother daughter relationshipdoctorteenage girlprostitutepolice officerdetectivebabybest friendalcoholic …police detectivecrying babygay doctor (See All) |
Story: | looking at oneself in a mirrorapple computerscreaming womanremote controlcrying womanblack americantragic eventsubjective camerasecretdrinkslow motion scenemirrorcell phonebloodone word title …flashbackdogfighttitle spoken by characterexplosionpartyknifechasesurprise endingpistolfirecorpserescuewatching tvcomputerwritten by directorswordvomitingrifleheld at gunpointbeerbirthdaybeddead bodyhallucinationreference to jesus christrevolverscienceflashlightambushvideo cameraambulancebasketballmontagebridgesnakeapologycoffinnews reportshot in the legtalking to the camerabartenderracial slurtreedrug addicthotel roomprologueproduct placementrace against timemissing personbaseball batlong takedisappearanceinjectionpursuitexploding bodyprofanityobscene finger gesturesacrificesubtitled sceneheroinbattlefieldrecord playerterminal illnessicetv newsgolfburned alivespearbreaking and enteringelectronic music scorehypodermic needlejeepdruglistening to musicrecordingcowboy hatwristwatchwomanizercrying manfateinterracial friendshiprealityslavedrug overdosepromiseseriesnicknameface paintthunderpastpartnernew orleans louisianajunkiemiracletitle appears in writingswampevidencebalconytriberaised middle fingerbarbecueethnic slurmarital problemburned to deathcoinholding handsteleportationprivate investigatorpillfiremanteenage pregnancyhandshakeneedlehiding in a closetbirthday presentlouisianarepeated scenedoubtgolf clubsocial mediahangover18 year oldurban decayparamedicstethoscopestretcherteenage daughterwhistlingblizzardferris wheelreference to albert einsteinamerican civil waralligatorluckgurneycamcorderroofoverhead camera shotreference to james bondfictionamuletcavemanradio newsku klux klanmorphinepsychotronic filmburn victimscience fictionsnake bitepolice sirenleg woundtrenchbrain tumormissing daughtervinylchemotherapylandmineflintlock rifledrinking from a bottlehappy birthdayvideo diaryfather daughter reuniontumorbayouboulderchancechemistburned bodytime travelermissing person posterknife woundcold the temperatureice agewhitescreaming mansudden deathtwo directorsfrostbitevinyl recordpain killerreference to stephen hawkingreflection in a mirrorprehistoric animalayahuascaambulance driverfraternity housefreezing to deathlawn chairmritrippingcreoleconquistadorlatenesselevator crashspontaneous human combustion30th birthdaybrain cancerlimping manreference to louis armstrongspeaking frenchapparent suicidefictional drughuman remainsquantumabandoned amusement parkrandomnessreference to chuck berryreference to charlie sheenearplugsb wordchest woundopening creditsfight between friendshysterical laughterpabst blue ribbon beerpsychedelic drugdesigner drugheroin overdosereference to nina simonepineal glandfemale college studentsunday morningfailure to communicatereference to claude debussysmelling a flower (See All) |
Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing … voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)
Subgenre: | suspense |
Themes: | supernatural powerfearghostmurderdeathfriendshiprevengemarriageinfidelityadulteryvoyeurismextramarital affairangerunfaithfulnesspanic |
Mood: | rain |
Locations: | lakeboatrestaurantswimming poolsnowcemeterybathtubrural settinglaboratoryyacht |
Characters: | husband wife relationshipteacherfriendfather son relationshipfather daughter relationshipmother daughter relationshipteenage girlstudentmusicianteacher student relationshippsychiatristprofessorghost in a mirror |
Period: | 2000s |
Story: | haunted househaunteddocklaptop computerhomeocculthauntinghousewinesecretmirrorcell phonebloodinterviewdog …photographpartythree word titlesurprise endingshowertelephone callcryingcar accidentwatching tvcomputercattearsbathroomcollegeneighborcandlewomanbathunderwater sceneroommategraveyarddrowninggravebinocularskeyelectrocutionpossessionmissing personcollege studentdeath of husbandratsuspicionmurderergardentherapyrunawaypickup truckteafireplacegothicmousehammertherapistblockbusterdrug overdoseresearchboston massachusettspet doganxietyspyingpieropening a doorphoto albumvillain played by lead actorseancefireballphysicianfencesailboatparamedicshoedruggedcelloouija boardgeneticshitchcockiansleeplessnesspet catpoltergeistcellistfootprintmissing girl911power failurevermonthair dryervisionswriting on a wallsteamcocktail partyouijasource musiclock of hairvaliumglass shardmurder by drowningalimonyprinceton universityempty neststepping on glasssound systemhair dryer falling into a bathtubreference to jonas salkreference to madame curie (See All) |
The outcast teenager Carrie White is bullied by her classmates at high school. Her mother, Margaret White, is a pious and paranoid woman that sees sin everywhere and the need of self-inflicting punishment. When Carrie has her first period, she does not understand what is happening to her and her cla …ssmates humiliate her in the changing room. The spiteful Chris Hargensen videotapes Carrie with her cell phone and posts it on the Internet. Their teacher Ms. Desjardin punishes the students, but when Chris challenges her, she is suspended and consequently is banned from the prom. Meanwhile, Carrie discovers that she has telekinesis and learns how to control her ability. Sue Snell, one of the girls that tormented Carrie, feels bad and asks her boyfriend Tommy Ross to invite Carrie to go with him to the prom to make up for what she did to Carrie. But Chris and her boyfriend Billy Nolan plot an evil prank with her friends to seek vengeance for Carrie. (Read More)
Subgenre: | coming of agesuspenseteen movieteen horror |
Themes: | supernatural powernear death experienceself sacrificedepressionfearsuicidemurderdeathfriendshiprevengesurrealismrapereligionpregnancydance …angerdeath of motherredemptionguilthumiliationpoetrybullyingcrueltypanicvengeanceregretpsychological trauma (See All) |
Mood: | high schoolnightnightmaregorerainhorror movie remake |
Locations: | schoolhospitalswimming poolcarcemeterysmall townbathtubbicyclewaterpolice cargas stationschool bussex in a carfire truckschool dance …school fire (See All) |
Characters: | teacherfemale protagonistteenagermother daughter relationshipboyfriend girlfriend relationshipdoctorteenage girlnursestudentbullysingle motherteacher student relationshipbibleterrorself mutilation …religious fanaticpregnant teenagerreligious zealotself injurymother versus daughterreligious mothervomiting girl (See All) |
Period: | 2010s |
Story: | high school teachercracked mirrorbroken mirrorlooking at oneself in a mirrorhigh school studentlocked doorscene during opening creditstragic eventslow motion scenecell phonef ratedcharacter name in titlebased on novelbloodviolence …one word titlebare chested malesex scenekissdancingtitle spoken by characterexplosionknifesurprise endingshowerfireblood splattercar accidentface slapremakesex in bedvomitingclassroomprayerf wordbedroomflashlightstrangulationmassacreambulancestabbingmontageimpalementstabbed to deathstabbed in the chestchild abuseexploding cargraveyardlatex glovesattempted murderlimousinegravelibrarystabbed in the backprologuescreamingsuburblocker roomperson on fireelectrocutionlightninggymamerican flagcrosschildbirththreatpigsadnessschoolgirlstagecharacter says i love youthreatened with a knifeclassteenage sexsingle parentpoemnerdfalling down stairssabotageteen angstdestructionburned alivekilling an animallifting someone into the aircrucifixyoutubecovered in bloodfemale killercrushed to deathhomicideearthquakereverse footagepower outagescissorsstabbed in the leglaughterroseaccidental killinglonerclassmatebody countpublic humiliationjuvenile delinquentalienationcharacters killed one by onesurgeonsports cartelekinesistext messaginginterrupted sexteenage pregnancyshynesslevitationstabbed in the handclosetmenstruationoutcastmedical masksurgical maskcafeterialong hairabuse of powerfemale teacherfireballbully comeuppancefemale psychopath17 year oldwhistlecrownstabbed in the armcameramandental maskdomineering motherknocked unconsciousteasingteenage daughterteenage sexualitypromnewborn babydeath of boyfriendsewing machinepsychic powerfrightmatricidedeath of title charactercamera phonepool of blooddetentionsledgehammerdisturbed individualwoman wearing black lingerietauntingdeeply disturbed personbucketdutch angletamponstabbed multiple timeswashingfemale in a showerfemale studentcliquemissionary positionsurgical gownhostilityburning houselord's prayerperiodhigh school dancehigh school principalseamstresstwin sistersdead teenagergym classgym teachervillainess played by lead actressthrown through a windshieldcuttingwoman in a bathtubbloody handteenage romancewoman in a towelmenstrual bloodpsionic powerhigh school promlacrosseteen lovefemale bullylesbian slurstretch limousineexploding gasoline stationrepeated scene from a different perspectiveparty dressmultiple stabbingoverprotective parentalternate endingbanging head against wallparanormal phenomenonwhite rosefalling off a bicycleshy girlcruel jokecyberbullyinginferiority complexprom nightteen sexwoman murders a womanprom queenfirst menstruationprom dresshome birthtroubled teenage girldaughter murders motherhit by a falling objectimax versionstabbing a womanwoman on fireteenage prankstertrampledwomen wearing a one piece swimsuitcollapsing housedeath by falling objectprom kingreference to samsonwomen's locker roommother murders daughtersanitary napkinpig bloodteen pregnancybucket of bloodtragic villainessclothes shoppiggeryreference to tim tebow (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | supernaturalsuspenseparanormalpsycho thriller |
Themes: | supernatural powerthe devilmental illnessfearghostsuicidemurderdeathkidnappingmarriagerapeprisontortureescapememory …psychopathparanoiadrug useinsanitysurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonmurder of husbandrape and murder (See All) |
Mood: | nightnightmaregorerainneo noirslasherdarkness |
Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
Characters: | husband wife relationshipserial killerfemale protagonistfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoonursepolicemanlawyerreference to godkiller …security guardvillainpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | distorted soundfootprintsserial murderwoman in jeopardysubjective cameramirrordreamcell phonesexfemale nudityf ratedbloodviolencefemale frontal nudityinterview …flashbackbare chested malegunkissfightphotographexplosionknifechasesurprise endingpistolshowertelephone callfirecryingcorpseblood splattercar accidentshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreporterswimmingsurvivalfoot chaseflashlightaxevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorswimming gogglescell blockchained to a bedwoman on fireanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Kevin Lomax, a ruthless young Florida attorney that never lost a case, is recruited by the most powerful law firm in the world. In spite of his mother's disagreement, which compares New York City to Babylon, he accepts the offer and the money that comes along. But soon, his wife starts feeling homes …ick as she witnesses devilish apparitions. However, Kevin is sinking in his new cases and pays less and less attention to his wife. His boss and mentor, John Milton, seems to always know how to overcome every problem and that just freaks Kevin right off. (Read More)
Subgenre: | cult filmallegory |
Themes: | supernatural powerthe devilmental illnessgrieffearsuicidemurderdeathmarriagerapereligionmoneyartincestseduction …angercorruptionobsessionguiltinsanitygreedpanicdevilmythologymurder of family (See All) |
Mood: | goresatirebreaking the fourth wallambiguous ending |
Locations: | barhospitalnew york citychurchsnownightclubelevatorwheelchairapartmentcitycourtroomusaslum |
Characters: | husband wife relationshipchristianteacherafrican americanfather son relationshippolicemother son relationshipsingerteenage girlnursestudentdancerphotographerbabypriest …lawyerjewishreference to godsingle motherchristianitylustteacher student relationshipbiblecatholic |