Please wait - finding best movies...
In this ultra-violent, fantasy epic, ancient dark magic falls into sinister hands and unleashes ages of suffering onto mankind. A group of heroes from different eras and cultures must band together in order to defeat it at all costs.
Subgenre: | epic |
Themes: | mythologymagic |
Mood: | night |
Locations: | cave |
Characters: | warrior |
Story: | class warfarewarrior womanrotoscoped animationflash gordoncomic bookshigh conceptmagical landbloomsubjugationwarriorsmythosprimitiveanimatedwarfaresavagery …mysticmedievalsinistersorceryadventure herobarbarianguardianswordsmansufferingheavy metaloccultmountainnudity (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
Subgenre: | epicmartial artssword and sorceryalternate historysword and fantasy |
Themes: | magicmurderdeathrevengesuicidekidnappingjealousypregnancytortureescapeherodeath of fatherbrutalitysupernatural powerdeath of mother …crueltydeath of wifevengeancedeath of daughtermurder of fatherdeath in childbirth (See All) |
Mood: | gore |
Locations: | snowboatwoodscastlecampfirewalled city |
Characters: | warriorhusband wife relationshipfather son relationshipfather daughter relationshipboysoldierthieftough guyaction herowitchsingle fatheryounger version of characterdancing girl |
Story: | warrior womanadventure herobarbarianswordsmanmountainfemale nuditycharacter name in titlebloodmale nudityviolenceflashbackbare chested malesex scenefightexplosion …knifechasethree word titlefireshot to deathblood splatterfistfighthorseshot in the chestremakeshot in the headrescueslow motion scenebattleswordfalling from heightmaskbased on comicshowdownhand to hand combatinterrogationdemonfightingcombatshot in the backdecapitationgood versus evilfoot chaseassassinbound and gaggedsword fightbased on comic bookambushname in titleaxemassacredisguisethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headnunno opening creditsanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreatureshot in the legprincessdrowningone against manybeaten to deathstabbed in the backkeyperson on fireattackevil mankicked in the facetough girlscarchildbirthexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarywaterfallsevered armbattlefieldfreeze framesingle parenthenchmanpiratebow and arrowburned alivekilling an animalhead buttspearassassination attempteggcatfightslaverymutilationkicked in the stomachjumping from heightmonkanimal attackgoatinterracial friendshipcrushed to deathback from the deadslavecelebrationfemale warriordamsel in distressadventurerdual wield3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdark herodungeoncapturedisfigurementeye patchpassionate kissdemonic possessionsword duelblack magicburned to deathdaggerstick fightpipe smokingpalacedriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationshot with an arrowmegalomaniacsorcerertaverntentacletestcrushed headsword fightingsword and sandalslingshothammockchainedprehistoric timesarcherfacial scarrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipshot with a bow and arrowstarts with narrationhorse chasewagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All) |
It is many thousand years in the future. Vampires once ruled the night but have seen their numbers reduced by fearless bounty hunters. One such hunter is D, the halfbreed son of a human mother and vampire father. When a girl from a rich family is taken from her home by the vampire Meier Link, her fa …ther contracts both D and the Markus brothers (a rival group of hunters) to race to retrieve her. As the heroes fight their way through Meier's hired guards, they begin to suspect that the girl may have gone with him willingly. (Read More)
Subgenre: | independent filmmartial artscult filmsupernaturalpost apocalypsemelodramadystopiaadult animationdark fantasy |
Themes: | murderdeathloverevengesurrealismkidnappingmoneybetrayalghostfearescapefuneralmonsterdeceptionracism …brutalitysupernatural powerredemptioninsanityrivalryunrequited lovehome invasionpanicself sacrificenear death experience (See All) |
Mood: | nightgoreneo noiranimedarknesspoetic justicehalf vampire |
Locations: | cavebartrainchurchforestsnowmotorcyclecemeterysmall towndesertelevatorwoodswheelchairjapancastle …gas stationtunnel (See All) |
Characters: | warriorfather son relationshipfather daughter relationshipzombiehostagetough guyvampireaction herosheriffhomeless manhuman versus monsterself healing |
Period: | future |
Story: | swordsmanoccultmountaincharacter name in titlebased on novelbloodviolenceflashbackdoggunfightexplosionknifechasesurprise ending …pistolcorpseshot to deathblood splatterhorseshot in the chestremakeshotgunrescuebattleswordbrawlfalling from heightletterbased on comicshowdownrifleheld at gunpointhand to hand combatbombinterrogationdemonhallucinationrevolvercombatdecapitationgood versus evilassassinsword fightambushmassacredeath of friendbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestweaponsevered headno opening creditsanti heroone man armycoffindouble crossspaceshipritualcreaturesearchfemme fatalegraveyardcigar smokingshot in the legtransformationon the runflash forwardattempted murderone against manygravetreebinocularsdangerstabbed in the backprologueperson on fireelectrocutionbased on mangafugitivemissionrace against timetough girltankmanipulationscarbodyguardinjectiontragic eventexploding bodycharacter says i love youmercenarypsychicundeadstylized violencehenchmanwerewolfgoldcard gamedestructionbow and arrowrevelationhypodermic needlegothicheavy rainmutantloss of loved onespacecraftvillainessdesperationjumping from heightlaserhonorrocket launcherburialaction heroinemexican standoffback from the deadfemale warriorfull moonwoman in jeopardydwarfvisioncorsetcrossbowkatana swordfight to the deathdual wieldliteraturemercilessnesschaosresurrectionshot in the faceimmortalitystabbed in the legdark herorivaldiscriminationknife fightshadowbounty hunterknife throwinglonerdark pastrescue missiontragic herohorse and carriagedeath of loved onedaggermoral dilemmaprequelteleportationengagement ringsouthern accenttelepathybatspellsatellitebazookaillusionliving deadfinal showdownkendomusclemanstrongmaneyehuman sacrificeshot with an arrowamputeetrue loveclimbing through a windowfemale vampirefortresshanging upside downhearing voicesshot in the eyesaloonfilm starts with textdeputyspace shuttleman kills a womanbitten in the neckfinal battleparasitetragic loveshape shifterstabbed in the facetragic pastimmortalvampirismpool of bloodvampire huntermind readinglifting person in airanti heroineglowing eyesgogglesman with no namex rayed skeletonregenerationearth viewed from spacevampire slayerlifting female in airhorse drawn carriagedutch angleinvulnerabilitymoral ambiguityrescue attemptwestern towncountessdark heroinecollapsing buildinghidden doorprosthetic limbgiant creaturegreen hairsunlightanti villainpulp fictionhenchwomanelectromagnetic pulseout of body experiencewuxia fictionsatellite dishvampire human lovesearch and rescuehalf breedlovers on the lambloodlustshape shiftingfanghole in chesthalf humanrocket shiplong swordx ray visioneternal loveinanimate object comes to lifefemale mercenarysupernatural hunterobeliskfemale bounty hunterhuntressblack hathuman animal hybridsucking blooddhampirneck bitewhite lightblack cloakastralfemale vampire hunter (See All) |
Shang-Chi must confront the past he thought he left behind when he is drawn into the web of the mysterious Ten Rings organization.
Subgenre: | martial artssuperherosword and fantasywuxiaurban fantasy |
Themes: | magicmurderdeathloverevengesurrealismmarriagefearescapeweddingfuneralmonstergangsterherodeception …brutalityobsessionsupernatural powerterrorismredemptiongriefsurveillancecourageself sacrificenear death experiencechinese mythology (See All) |
Mood: | nightcar chase |
Locations: | cavebarrestaurantforesthelicoptermotorcycleairplanebuswaterelevatorvillagewoodsapartmentchinasan francisco california …tunnelsuvbus drivercar motorcycle chasesea monstercity bus (See All) |
Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendbrother sister relationshipteenage girlteenage boysoldierlawyertough guyaction herobest friendlittle girl …little boymothervillainsniperasian americanchinesefatheramerican abroadsniper rifleaunt niece relationshipaunt nephew relationshiptruck driverchinese americanhuman versus monsterevil monster (See All) |
Period: | 1990syear 19962020s |
Story: | magical landguardianmountaincharacter name in titlenumber in titleviolencesequelflashbackbare chested malefightphotographtitle spoken by characterexplosionknifechase …surprise endingvoice over narrationcell phonebeatingfistfightcar accidentshotgunrescueslow motion scenepunched in the facebattleswordbrawlsecretfalling from heightbased on comicshowdownhand to hand combatbombcar crashdemonhallucinationfightingcombatkung fugood versus evilfoot chaseassassinsword fightbased on comic bookgangambushterroristmassacremontagearmymixed martial artsprisonerweaponmapanti heroanimaldisarming someoneone man armydrawingunderwater scenecreaturenecklacetrainingflash forwardattempted murderone against manyorganized crimebeaten to deathdangerprologuekaratewidowerproduct placementninjadragonrace against timekicked in the facetough girlopening action scenebraceletringscene during end creditsmanipulationscarmartial artistexploding bodyautomobilethreatened with a knifewaterfallsubtitled scenebattlefieldpowerstylized violencehenchmansistereavesdroppingdestinycard gamemartial arts masterbow and arrowspearassassination attemptmachetespin offcaptivetemplebeardexploding buildingkicked in the stomachblockbusterdriving a carparking garageaction heroinemasked maneaten alivefemale warriorbarefootreverse footageshieldcameohaunted by the paststealing a cartarget practiceexplosivebraveryinvasionconstruction sitecrossbowfight to the deathmercilessnesskaraokekicked in the crotchimmortalityescape attemptexilescene after end creditsmarvel comics3dpunched in the chestdark herolionknife fighthologramtitle at the enddark pastkingdomtragic herodead mothersports carstick fightteleportationroundhouse kicksurprise after end creditskarate kicklaptop computerenglishman abroadreflectionfemale soldierkung fu fightingsidekickterrorist groupface masklevitationfighterfinal showdownmysticismgatedark secretmazefemale fighterpostcardarmored cargiant monsterfireballportalcomic reliefsecret societyshot with an arrowamputeeskyscraperarcherycheering crowdfemale lawyerhearing voicessorcerervaletartifactreluctant herotentacleflight attendantinternet videofemale martial artistvehicleleadermale protagonistwoman kills a manfinal battleshot in the throatpart computer animationarcherbladetragic pastwoman fights a mangarbage truckaircraftimmortalshrinecamera phonewarlordgolden gate bridgeone woman armypsychotronic filmbo stafffather son conflictforce fieldanti heroinewu shuhummerbilingualismthrown from a carepic battlecrime lordartsslow motion action sceneleadershipmagical powerparallel worldsurprise during end creditspretending to be deadwoman punches a manpendantflaming arrowkaijucage fightingjumping from a carprosthetic limbbody armorgiant creatureorganizationorbtraining montageunderground fightinganti villainbambooliverpudlianmarvel entertainmentover the topprotectorsupervillainalternate worldmarvel cinematic universewuxia fictionalcatrazrunning away from homespeeding vehiclekaraoke barfight clubsecret tunnelancestryinvadermammalcar falling off a cliffstereoscopicsea creaturecage fightorigin storyleft behindmagical objectninja armywarrior racelovecraftianmagical creatureeternal lifebus crashcompoundflying dragonvigilcriminal organizationjoyridescaleshirtless malearm in a slingbeaconbus passengerparking attendantinvading armyactor reprises previous roleenemiestransamerica pyramidreformed criminalcage fighterdeceased motherfemale archerscaffoldingtenbrother sister conflictchinese dragonflying monsterliverpool accentmotor caropening creditsgatewaymartialthespianwinged creaturepost credits scenefather son fightbow the weaponplaying deadsuperhero origindriving a busestranged siblingsfather versus songambling winningsham actorlong haired womansoul eatertentacled monsterassumed namemystical creatureparking valetshared universe (See All) |
A village is attacked by the evil ruler of the Snake Cult, Thulsa Doom ('James Earl Jones' (qv)) and his evil warriors, when Thulsa Doom and his warriors kills his parents, a young boy named Conan ('Jorge Sanz (I)' (qv)) is enslaved. Years later, Conan grows up and becomes a mighty warrior and is tr …ained as a fighter. After years as a slave and as a gladiator, Conan is set free. Conan sets out on a quest as he vows to avenge his parents and solve the riddle of steel. Joined by a archer named Subotai ('Gerry Lopez (I)' (qv)), a beautiful thief who falls in love with Conan, Valeria (sandahl Bergman') and a Chinese wizard ('Mako (I)' (qv)), Conan and his companions sets out to rescue Princess Yasmina ('Valerie Quennessen' (qv)), daughter of King Osric ('Max von Sydow (I)' (qv)), from the Snake Cult, and get his revenge on Thulsa Doom and avenge his parents. (Read More)
Subgenre: | epicmartial artscult filmsword and sorceryalternate historysword and fantasychrist allegory |
Themes: | mythologymagicmurderdeathfriendshiprevengesuicideghosttorturefuneralseductiondeath of fatherbrutalitydeath of mothercannibalism …vengeanceself sacrificesamuraimurder of fathermurder of mother (See All) |
Mood: | gorepoetic justice |
Locations: | desertseatown |
Characters: | warriorfather son relationshipmother son relationshipboythieftough guyaction herowitchsamurai swordrevenge motiverevenge seeker |
Story: | warrior womanwarriorsbarbarianfemale nuditycharacter name in titlebloodviolencefemale frontal nuditybare chested malesex scenefightthree word titlevoice over narrationblood splatter …face slapshot in the headbattleswordfalling from heightshowdownhand to hand combatdemonorgycombatkung fudecapitationgood versus evilsword fightname in titleaxethroat slittingarmyimpalementstabbed to deathstabbed in the chestsnakesevered headcultanti heroone man armypart of seriesnarrationfictional warkingfemme fataleprincessperson on firefirst of seriesevil manpremarital sexsacrificebattlefieldrunawaytwenty somethingwolfbow and arrowathletekilling an animalspearslaverymutilationwitchcraftsevered handpart animationserieskatana swordfight to the deathcannibalwizardpsychotronicbooby trapcapturesword dueldeath of loved oneblack magiccamelheroismnarrated by characterbreak incrucifixionkendomusclemannarratorstandoffmegalomaniacsorcererarenahypnotismmasteractual animal killedsword fightingsword and sandalfinal battlehandfamous scoreprehistoric timesarcherorchestral music scoregladiatorharemwarlordquotationcounter culturevultureloinclothalternate versionstabbed in the mouthinterspecies sexfuneral pyreserpentdeath of petreference to friedrich nietzscheevil powerstone ageancientgiant snakesteelevil sorcererfilm starts with quoteeating human fleshtwo against oneavengerquotewarrior racehead on a stakerevenge killingmongolmuscleskilled by a dogpeplumman beastsymphonic music scorecannibal cultblueberrybroken swordfilm starts with a quoterobert e. howardavengebased on pulp magazinelotusbased on multiple workspaleolithic agesnake pitman versus beast10000 b.c.100th century b.c.hyborian agemute villainsacrificing own lifesword forging (See All) |
This post-apocalyptic future story is based on the 8th century Saxon epic poem about the knight who battled a monster in a medieval castle. In this story, Beowulf is a wanderer who learns about a man-eating creature called Grendel which comes in the night to devour warriors trapped at the Outpost. T …he Outpost is ruled by Hrothgar. He has a daughter, whose husband may have been murdered by the Outpost's master of arms. (Read More)
Subgenre: | epicindependent filmmartial artspost apocalypsesword and sorcerysword and fantasy |
Themes: | monsterherofuture warmurder of son |
Mood: | night |
Characters: | warriortough guyaction hero |
Period: |
Story: | warriorsmedievaladventure herosexcharacter name in titlebloodone word titlepistolshootoutfistfighthorsebattleswordbrawlhand to hand combat …demoncombatsword fightmassacremixed martial artsweaponanti herodisarming someonekingdragonkissing while having sexbattlefieldstylized violencespearexploding buildingknightfemale warriorcrossbowdual wielddark herosword dueltragic heroparkourshot with an arrowacrobatacrobaticsbased on poemsuccubusbased on legendbeowulf (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
Subgenre: | epicmartial artscult filmtragedysword and sorcerysword and fantasy |
Themes: | magicmurderdeathlovefriendshiprevengekidnappingpregnancytortureescapeweddingmonsterherodeceptionmemory …death of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeancecourage (See All) |
Mood: | rain |
Locations: | forestvillagewoodsfarmlakecastle |
Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guyaction herovillainuncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All) |
Story: | warrior womansorcerymountainbloodviolenceflashbackkissfightexplosionknifechasefirecryingblood splatterfood …horserescueslow motion scenebattleswordfalling from heightbookshowdowntearshand to hand combatrunningneighborcombatsubjective cameragood versus evilsurvivalwinecandlesword fightaxemassacrestabbingthroat slittingbridgeeatingarmymixed martial artsprisonermapdisarming someonefictional warkingprincessnecklaceduelgravelibraryattackpoisonninjapassionreadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralbattlefieldchild murderdestinybow and arrowspearmachetecaptivestabbed in the stomachwitchcraftgenocidehonorburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardmedieval timespridedungeoncapturearmorraidsiegelieutenantkingdomsword duelblack magictelekinesissmokedaggerimprisonmentcrowheroismpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downsorcererfantasy worldsword and sandalheirclimbing a treetitle in titleflamearcherdeath of grandmotherfacial scarman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekshot with a bow and arrowbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsedefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
The modern world holds many secrets, but the most astounding secret of all is that witches still live amongst us; vicious supernatural creatures intent on unleashing the Black Death upon the world. Armies of witch hunters battled the unnatural enemy across the globe for centuries, including Kaulder, … a valiant warrior who managed to slay the all-powerful Queen Witch, decimating her followers in the process. In the moments right before her death, the Queen curses Kaulder with her own immortality, forever separating him from his beloved wife and daughter in the afterlife. Today Kaulder is the only one of his kind remaining, and has spent centuries hunting down rogue witches, all the while yearning for his long-lost loved ones. However, unbeknownst to Kaulder, the Queen Witch is resurrected and seeks revenge on her killer causing an epic battle that will determine the survival of the human race. (Read More)
Subgenre: | epicblack comedyconspiracysupernaturaldark fantasychristian horror |
Themes: | magicmurderdeathrevengesurrealismkidnappingbetrayalprisontortureescapefuneralmonsterinvestigationdeceptionmemory …supernatural powerapocalypseblindnessvengeancenear death experiencemurder of family (See All) |
Mood: | darkness |
Locations: | cavenew york citybarchurchsnowairplanetaxikitchenapartmentcatholic churchschool bus |
Characters: | warriortattoosoldierpriesthostagetough guyaction herowaitressbiblewitchcatholic priestevil witch |
Story: | occultmountainbloodviolenceflashbackfightexplosionknifesurprise endingpistolfirevoice over narrationcell phonedreamcorpse …shot in the chestshotgunrescuebattleswordfalling from heightshowdownheld at gunpointinterrogationhallucinationshot in the backgood versus evilassassincandlestrangulationaxemassacredeath of friendimpalementstabbed to deathprisonerstabbed in the chestno opening creditsanti heroone man armycoffinassassinationchild in perilfictional wardouble crosscreaturefemme fataleflash forwardtreecursestabbed in the backprologueattackmissionrace against timecover uplightningopening action sceneshot in the shouldermanipulationbodyguardexploding bodythreatened with a knifequeenarsonstylized violencetraitorbow and arrowburned aliverevelationassassination attemptgothicheavy raincrucifixwitchcraftimpersonationirishmind controltorchend of the worldback from the deadbar fighteaten alivepresumed deadretirementcrime scenepump action shotgundamsel in distressreverse footageresurrectionimmortalitycigarette lighterdark heroheartaerial shotlonercanedark pastdressing roomtragic heroblack magicburned to deathtelekinesisteleportationtelepathyimprisonmentspellenglishman abroadsuffocationnarrated by characterillusionfire extinguisherstabbed in the handbongold dark housegiant monsterhitlerbrooklyn bridgegun held to headcomic reliefplaguesecret societyflycrystalgreenhousepocket watchbakerydruggedman kills a womanoffscreen killingmacguffinpotionfashion showaltered version of studio logosole black character dies clichetimes square manhattan new york citycathedralmaggotopen endedrighteous ragetragic pastdeath of familysubterraneancamera phonesymbolfemale bartendermind readingpentagrampenrookieglowing eyesheart in handmagic spellchrysler building manhattan new york cityregenerationselfiechantingdiscovering a dead bodybattle axedecomposing bodyenglishwoman abroadsecret doorsecret organizationchemistryarsenalman fights a womanrepressed memorypossewarlockirongiant creaturehand through chestcherrycouncilcatwalkstalinalternate worldlucid dreamswarmstabbed through the chestinside the mindweather manipulationfacial cutshape shiftingbiographeraxe throwingnapoleonarsenicblowing smoke in someone's facehuman brandingsiamese catclose up of handflaming swordwitch hunterlife forcesword throwingrapid healingsnapping fingersgiant treeair hostessmental manipulationdead flystabbed through the backweapons cabinetblack plaguefalling down a holecircumscribed pentagramwoman wearing lingeriegummy bearman holding a babyswarm of flies (See All) |
Set against the coming of Christianity, this is the story of the last hero: in 507, a monstrous troll wreaks havoc in the mead hall of the Danish king, Hrothgar. He offers rewards for the death of Grendel, so Beowulf, a great and boastful Geat warrior, arrives with his thanes. Beowulf sets aside his … armor and awaits the monster; a fierce battle ensues that leads to Beowolf's entering the watery lair of Grendel's mother, where a devil's bargain awaits. Beowulf returns to Herot, the castle, and becomes king. Jump ahead many years, and the sins of the father are visited upon Beowulf and his kingdom. The hero must face his weakness and be heroic once again. Is the age of demons over? (Read More)
Subgenre: | epiccult filmtragedysword and sorcerycomputer animationcgi animationadult animation |
Themes: | mythologymagicmurderdeathfriendshiprevengesuicideinfidelityadulterydrinkingdrunkennessfuneralmonsterheromemory …seductioncorruptionbrutalityobsessionredemptioncannibalismvengeancecourageinheritance (See All) |
Mood: | gore |
Locations: | cavebeachchurchforestseashipcastleoceanstorm |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipsingersoldierpriestchristianitymermaiddeath of herohuman versus monster |
Story: | sexfemale nuditycharacter name in titlemale nudityviolenceone word titlefemale frontal nuditybare chested malekissfighttitle spoken by charactersingingchasesurprise ending …firebeatingdreamcorpseblood splatterslow motion scenereenactmentbattleswordbrawlfalling from heightdemoncombatdecapitationgood versus evilsword fightmassacrestabbingdeath of friendthroat slittingbridgearmyimpalementstabbed to deathapologysevered headno opening creditsritualkingcreatureduelgravelegendcursebeaten to deathstabbed in the backperson on fireactor playing multiple rolesdragonsadnessratsevered armqueendismembermenthatepowergoldloyaltybow and arrowburned alivespearquestfametold in flashbackmutilationdenmarktreasurebuttocksgiantservanthonorburialanimal attackeaten alivecelebrationpromisedwarfshieldfight to the deathloss of sonstabbed in the throatprophecystabbed in the headswampstabbed in the legdisembowelmentheartslaughterarmordisfigurementstabbed in the eyebroken armkingdomloss of husbandtragic herosevered legdaggersinshamereflectionnecrophiliavikingshot with an arrowarcherycrownstabbed in the armfortressburnt facetaverncrushed headtrollseductressstabbed in the shoulderbleeding to deathheirarchermartyrclawritedeformityheart ripped outburning buildingsailing shiploinclothexpressionismcustomrewardarm ripped offillegitimate sonbased on poemleadershipfeastsagabattle axefalling off a cliffhornaxe in the headsliced in twoorigin of herotreasure cheststabbed in the sidedanishfuneral pyrecoronationburned bodyfire breathing dragonfake bloodtorn in halfconquestnude fightlairchildlessnessmotion capturedeath by firesplit in twodesecrationdark agesfleethospitalityhero worshipcandlestickweaknesswenchavariceretellingspear through chestswimming competitionsword throwingdeath by swordnorsestabbed in chestwinged dragontrampled to deathfuneral riteseacoastancient sworddragon riderraider6th centuryragnarokhuman versus dragontest of characterrafterbare backburning churchburning citymonster childhuman fallibilityold englishbeast's heart (See All) |
Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t …o end all wars, Diana will discover her full powers and her true destiny. (Read More)
Subgenre: | epicmartial artscoming of agesuperherofish out of watersteampunkdark fantasysword and fantasy |
Themes: | mythologymurderdeathloverevengesurrealismbetrayaldrinkingfeartorturedrunkennessescapedeceptionmilitaryanger …corruptionpsychopathbrutalityobsessionsupernatural powerparanoiainsanitysadismhopepanicjusticecourageself sacrificegreek mythology (See All) |
Mood: | darknessgreek myth |
Locations: | cavebeachtrainchurchforestsnowmotorcycleairplaneparis franceboatlondon englandvillagewoodsshipcastle …campfirelaboratorytrain stationairplane chase (See All) |
Characters: | warriorfamily relationshipsmother daughter relationshipsingerfemale protagonistsoldierdancerphotographersister sister relationshiptough guyaction heronative americansingle motheralcoholicsniper …secretarygermanamerican abroadsniper rifleaunt niece relationshipfemale scientistamerican in the uk (See All) |
Period: | 2010s1910syear 1918 |
Story: | warrior womannudityf ratedcharacter name in titlemale nudityviolencesequelflashbacktwo word titlebare chested malefightcigarette smokingdancingphotographexplosion …singingpartyknifechasesurprise endingpistolfirevoice over narrationshootouttitle directed by femalebeatingcorpseshot to deathfistfightmachine gunhorseshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facedrinkbattleswordgunfightbrawlsecretfalling from heightpaintingbased on comicshowdownrifleheld at gunpointbeerhand to hand combatbombinterrogationpianoislandrevolverfightingcombatscientistshot in the backgood versus evilspysword fightbased on comic bookaxemassacredisguisemontagearmystabbed to deathmixed martial artspoliticianstabbed in the chestmapnonlinear timelinefalse accusationno opening creditsanti heroscantily clad femaledisarming someonepart of seriesdouble crossunderwater scenevanshot in the legprincesstrainingflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguebeaten to deathdangercostumescreamingelectrocutionfantasy sequencefactorypay phonepoisonmissionundercoverrace against timestatueevil manknocked outkicked in the facetough girllightningtankbraceletscardeath of brotherexploding bodylaptopsuspicionworld war onethreatened with a knifewaterfallshot in the armgeneralsecret agentlove interestpubqueennewspaper headlinesubtitled scenebattlefieldstylized violenceeavesdroppingropedestinycaptainhand grenadesabotagefireplacedestructionbow and arrowbulletrevelationspearassassination attemptwarehousesociopathhelmettold in flashbackmad scientistexploding buildingkicked in the stomachcaucasianvillainessblockbusterwristwatchphone boothpooldesperationjumping from heightculture clashstrong female leadfollowing someonehonorfateaction heroinebar fightcannonfemale warriorgas maskshieldbraveryinvasioncynicismfight to the deathdual wieldanimated sequencehatredimpostormercilessnesschaossuper villainpost traumatic stress disorderimmortalitymentorpunched in the chestdynamitejumping through a windowdeath of sisteraerial shotsuperheroinee mailtitle at the endundercover agentarmordisfigurementgasolinekingdomfemale directorsecret identitydc comicsloss of brothertelekinesissmokegatling gunprequelteleportationpipe smokingbullet timeclose up of eyesheroismfemale soldiertranslatormale objectificationface maskhistorical fictionlevitationalleyanti warfinal showdownnotebookfemale fighterassumed identityeiffel tower parissuper strengthfake identitytoweramerican indianworld dominationcomic reliefsailboatshot with an arrowmegalomaniacyoung version of characterarcherycrownidealismamazonno title at beginningsmugglerdepartment storebelgiumcrash landingexploding truckbehind enemy linesgirl powerfemale herobayonetsaving the worldwoman kills a manhumorsuper powerfinal battlegurneyhijackingloss of sisterevil womanflamebomberarcheropen endedsuperhuman strengthwoman fights a manvaultimmortaldistrustgodhuman experimenttalking about sexanecdoteone woman armyflashback within a flashbackottoman empirearmy basebiplanechosen oneexploding airplanehalf brotherforce fieldfake accentbilingualismmad doctorfratricidetrenchrevolving doorearth viewed from spaceoverhead shotepic battlescottish accentparadisehorse drawn carriagesexual innuendopayphonesuit of armorwoman kills mandouble entendrescotsmanwoman punches a mansuper speedgerman armyinvulnerabilityorigin of heroflaming arrowbig ben londonman fights a womansharpshooterwalking stickevil scientistgalachemistdisobeying ordersgas grenadepoison gasstudent teacher relationshipgunpowdersultanbritish intelligencemass deathspear throwingthrown from heightturkwatchtowerantique dealermatriarchybell towergreek godbackfliptrench warfareevil godwartimealley fightbowler hatdeath of auntflamescostumed heroescalationamazon tribeend of waralliteration in titlemoroccanwarrior racechemical weaponsfeztower bridge londonmachine gun nestaxe throwingdc extended universesuperhuman speedcasualty of warchemical weapontough womanprequel and sequelwestern frontwonder womanarmisticereference to zeuslightning boltamazon warriorhydrogenintelligence officeramazon womanfemale superheromilitary jeepdeath of mentorfemale archergas attackarescyanide pillmustard gasfemale talking about sexgerman spyamazon queenloss of auntmagic swordreturning actress with different character (See All) |
When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth, …Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)
Subgenre: | epicsword and sorcerydark fantasysword and fantasy |
Themes: | magicmurderdeathfriendshiprevengesurrealismbetrayalghostpregnancyfeardrunkennessescapefuneralmonsterinvestigation …deceptionangercorruptionbrutalitysupernatural powersadismexploitationhopeself sacrificeregret (See All) |
Locations: | churchforestsnowvillagewoodscastle |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshiptattoobrother sister relationshipsoldierbabyhostagetough guyaction herosingle fatherpregnantengineer |
Story: | mysticguardianmountainbased on novelbloodviolenceone word titlebare chested malefightexplosionknifechasesurprise endingfirevoice over narration …beatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facebattleswordarrestbrawlfalling from heightbookshowdowninterrogationdemonrivercombatsubjective cameradecapitationgood versus evilsurvivalsword fightambushstrangulationaxemassacredeath of friendthroat slittingarmyimpalementstabbed to deathprisonerstabbed in the chestmapsevered headno opening creditsanti herobirdchild in perilfictional wardouble crossritualunderwater scenekingcreaturetransformationduelone against manytreelibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentevil manknocked outkicked in the facetough girllightningskeletonmanipulationscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled scenebattlefieldprincestylized violencesingle parenthenchmaneavesdroppingtraitorwolfloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetblockbustergiantpoolrebelsevered handcovered in bloodsheepskullknightmind controlhonortorchburialaction heroineanimal attackcrushed to deathslavefemale warriorfull moonguardbarefootdwarfreverse footageshieldinvasionfight to the deathloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationwizardstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the endcapturedeerdisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationsword duelblack magicwilhelm screamtelekinesisdaggerexorcismteleportationpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificetreasonportalworld dominationmegalomaniaccrowninterracial marriagesorcererhead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreathorse chasemacehorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All) |
A Journeyman ninja by name of Jubei stumbles upon a plague, an evil clan of demons, a national crisis, and a beautiful ninja girl.
Subgenre: | epicmartial artscult filmsupernaturaltragedyadult animationdark fantasy |
Themes: | mythologymagicmurderdeathloverevengesurrealismrapemonsterheroseductiontravelangersupernatural powerunrequited love …crueltyblindnessjusticesamurainear death experiencerape and revengesupernatural powers (See All) |
Mood: | goreneo noiranimepoetic justice |
Locations: | forestboatwatervillagejapanshipblood in waterdeath at sea |
Characters: | tattoojapanese womanaction herojapanesesamurai swordnear deathblood revengedeath of a girl |
Story: | swordsmannudityfemale nuditybloodviolencebare breastsflashbackbondagebare chested malegunsex scenekissfemale rear nudity …chasefirelickingcryingbreast suckingblood splatterhorserescuepunched in the faceswordkissingfalling from heightshowdownrunningdemonswimmingdecapitationgood versus evilspycandlesword fightambushold manstabbingbridgearmymapsnakeunderwater scenecontroversycreaturetransformationduelone against manytreescreamingelectrocutionattackpoisonmissionninjaopening action scenescreammartial artistgovernmenthorse ridingunderwatersacrificeespionageblood spatterpowerstylized violencegoldmartial arts masterdestructionhead buttwoundquestsexual abuserageenemybuttockscrying womanbuttfaked deathhonornaked womanchop sockyfemale warriorpromiseseriessevered fingerkatana swordblood on faceteamresurrectionevacuationimmortalitydark heroeye gougingstabbed in the eyeblind manbroken armsword duelarrowdaggerchallengeblindtorso cut in halfheroismbisexualitysaving a lifeelectricitykatanaviolence against womenbandagekung fu classicrunning awayschemelong hairsexual violencemegalomaniacponytailclimbingmessageninjitsuforeplaypoisoningfinger cut offtravelingaction violenceextreme violencetreacherygraphic violencetragic loverighteous ragebloodshedjumpinggrassimmortalcut into piecesspitting bloodbloody violencearm cut offcoughing bloodwoman undressingviolent deathtreesdeath of loverscreaming womanloinclothepic battlejumpdirtarm ripped offcutscrollantidotedrinking bloodhaydark heroineshurikenangryheadbandfemale ninjawaspcompanionmagical swordninja warriorfireflylife and deathstabbedbamboomass deathninja masterriding a horsedeath of main charactergory violencepoisonedtouching breastsfake deathviolence against a womanblood on mouthfeudal japantribalbloody sprayangry mandoomed loveflamescryelectrocutedbloodlustcut in halfdeath by firehole in wallwoman undressing for a mantoxinbloodystabbreast squeezingbreaking through a wallwoman electrocutedjapanimationviolenttasting bloodclimbing a wallcompanionshipancient timestragic deathbroken dreamlicking someoneblood spurtclimbdeath by swordkiss of deathlife savingcoughing up blooddeath of womanenemieshorse riderbloody liplong fingernailsbloodthirstyfaking a deathrock monstersnake womanblood dripbloody messbreaking through walldecapitatedultraviolencebamboo forestbloody waterchase scenetownspeoplejapanese governmentancient japanburn to deathnear death survivorsnakesanimated violenceclimbing a cliffdestroyed wallinsane violencetraveling companionburning shipcutting off fingerfingers cut offgushing bloodheroic deathmale companionpoisonerspit blood (See All) |
Nearly 5,000 years after he was bestowed with the almighty powers of the Egyptian gods—and imprisoned just as quickly—Black Adam is freed from his earthly tomb, ready to unleash his unique form of justice on the modern world.
Subgenre: | martial artssuperherochrist allegory |
Themes: | mythologymagicmurderdeathrevengesurrealismkidnappingbetrayalprisonescapeherodeceptionmilitarynatureanger …brutalitysupernatural powerterrorismredemptionrivalryexecutionhopejusticecourageself sacrificenear death experienceegyptian mythology (See All) |
Mood: | nightcomic book movie |
Locations: | cavehelicopterdesertapartmentfarmcitytrucksinging in a carcountrycave in |
Characters: | warriorfather son relationshipmother son relationshipboybrother sister relationshipteenage girlteenage boysoldierhostagetough guyaction herosingle mothervillainprofessoraustralian …uncle nephew relationshipself healingcomic book character (See All) |
Period: | futureseeing the futurethe future |
Story: | mountaincharacter name in titleviolenceflashbacktwo word titlebare chested malegunfighttitle spoken by characterexplosionchasesurprise endingpistolfirevoice over narration …cell phonebeatingfistfightmachine gunmirrorshot in the chestshotgunrescueslow motion scenepunched in the facewatching tvbattlebrawlfalling from heightbookbased on comicshowdownheld at gunpointhand to hand combatinterrogationdemonhallucinationcolor in titlecombatgood versus evilbedroomflashlightassassinbased on comic bookambushaxemassacredisguisemansionmontagearmywidowmixed martial artsweaponexploding caranti heroone man armyassassinationhit by a cardouble crossunderwater scenevannecklacetransformationattempted murderlimousineone against manydangercostumeprologueelectrocutionmissionrace against timestatuetough girllightningopening action sceneskeletonscene during end creditstragic eventexploding bodychampionmercenaryhandgunsubtitled sceneundeadbattlefieldpowersingle parenthenchmanak 47missiledestructionbow and arrowrevelationflyinghead buttjeepslow motioncomic bookhelmetslaveryspin offmagicianwalkie talkietempleexploding buildingkicked in the stomachblockbustergiantskateboardmind controlrocket launcherfateaction heroinesocial commentaryback from the deadbald manslavepresumed deadfemale warriorseriescameohaunted by the pastvisionthunderbraveryfanfight to the deathmercilessnessresurrectionsuper villainwizardspecial forcespunched in the chestdark heroblack and whitesurprisewisecrack humorsuperheroinehologramtitle at the endminedark pastdemonic possessionplaytragic heroblack magicdc comicsexploding helicoptergovernment agentmoral dilemmateleportationlaser gunpalacebullet timerocketexplorationheroismtombtranslatoroppressionpresentface masklevitationfinal showdownlouisianafemale fighterfirearmspiral staircasemetaphorarmored carsuper strengthfireballworld dominationcomicquick drawdronecomic reliefshot with an arrowmegalomaniaccrowncheering crowdtornadohelicopter crashsorcerercrash landingexploding truckartifactpremonitionuniversetyrantmacguffinsuperhero teamvehicleleaderaudio cassettefinal battlecapeteamworkarchercomicsopen endedtragic pastaircraftmasked heroracial stereotypeaerial combatcockney accentpsychotronic filmreference to supermanfreedom fighterreference to batmanforce fieldthroneregenerationwingsepic battlebaldnesshelicopter pilotmoralmaceslow motion action scenefictional countrymagical powerarchaeologistbattle axedecomposing bodysurprise during end creditssuper speedfemale pilotforcecollapsing buildingsuperpowerexploding motorcyclecouncilteenage superherolimousine driverelectriciantorn in halfheroeselectromagnetic pulsehockey stickplayingprotectorslave laborsupervillainblack herohovercraftinfra redfighting in the airincantationsuspended animationcostumed heroorigin storyastral projectionpushed from heightdc extended universeshot in the torsocaped superheroflying superherohero worshipurban combatancient historyarchenemysoldierssupercatchphraseduplicateteenage superheroineamphibious vehiclecup of teaactor reprises previous roleancient ruinsmomentbullet catchingpresent dayresidenceopening creditsfemale archaeologiststrongpost credits sceneskeleton warriorback to lifebald childbow the weaponforce of natureshot in the abdomenunderwater basecomic book movieswoman with long hairgood guyshared universe (See All) |
A former Australian policeman now living in the post-apocalyptic Australian outback as a warrior agrees to help a community of survivors living in a gasoline refinery to defend them and their gasoline supplies from evil barbarian warriors.
Subgenre: | epicindependent filmcult filmblack comedypost apocalypsedystopiaaustralian science fictionaustralian horrordocumentary footage |
Themes: | murderdeathfriendshipescapeheroevilcrueltyapocalypsecourage |
Mood: | nightcar chase |
Locations: | carmotorcycledesertaustraliatruckroad movieaustralian outbackcar motorcycle chasecar truck chase |
Characters: | warriorhomosexualfriendboytough guyaction herohomosexualityvillainaustralianpolice shootoutex policeman |
Period: | future |
Story: | warriorsbarbariancharacter name in titlenumber in titlebloodmale nudityviolencesequeldogbare chested maleexplosionchasesurprise endingshowervoice over narration …digit in titleblondebare buttshowdownbombsecond partnumbered sequelcriminalgood versus evilsurvivalgangambushwomanmontagethroat slittingexploding carapologyanti heroone man armylegendbinocularsperson on fireevil manopening action sceneexploding bodyautomobileisolationmachismokilling an animalsurvivorblockbusterpart of trilogydriving a carbikerfemale warriormiddle eastface painttelescopebootssevered fingerbraverycrossbowblood on facemutepsychotronicoilhighwaygasolinelonersequel to cult favoriteflamethrowermasked killershaved headmadmanex copdriftermolotov cocktailgang warkilling a dogsecond in seriesgunslingeranarchysawed off shotgunaction violenceauto mechanicmotorcycle gangmotorcycle copwarlordhappy birthday to youcommunepsychotronic filmbiker gangcolonydeath of loverfinding a dead bodyfortfuelparadiseblond manboomerangdeath of dogmohawk haircuthockey masksecond in trilogyleather pantsgang warfarepunk rockermuscle carblack leatherscreaming mananimal deathpet foodcorpse with eyes opensemi truckferal childtanker truckoil tankerdemolition derbysadomasochism clothingdriving alonemarauderwild child18 wheelercompound bowmad maxnordenfelt gungasoline truckrefineryhuman eats dog foodeating dog foodman's best friendferal boygyrocoptercattle dogscorched earth policy (See All) |
An American teenager who is obsessed with Hong Kong cinema and kung-fu classics makes an extraordinary discovery in a Chinatown pawnshop: the legendary stick weapon of the Chinese sage and warrior, the Monkey King. With the lost relic in hand, the teenager unexpectedly finds himself traveling back t …o ancient China to join a crew of warriors from martial arts lore on a dangerous quest to free the imprisoned Monkey King. (Read More)
Subgenre: | martial artscoming of agewuxia |
Themes: | murderrevengedrunkennessherorobberytime travelvengeancephilosophy |
Locations: | caveforestdesertvillagerooftopchinacampfire |
Characters: | warriorteenagertough guyaction herobullyvillainwitchamerican |
Story: | warriorsswordsmanmountainbased on novelbloodviolenceflashbackfighttitle spoken by characterchasebeatingdreamfistfighthorseshot in the chest …urinationbattleswordbrawlfalling from heightshootingshowdownhand to hand combatfightingcombatkung fushot in the backorphanflashlightwinesword fightstrangulationambulancestabbingmixed martial artsbirddisarming someoneduellegendkaratestatuemartial artistwaterfallwhippingstylized violencemartial arts masterbow and arrowspearquesttemplevillainessmonkchop sockykickboxinginterracial romancewhipboston massachusettsprophecyimmortalitymentorbounty hunterkarate chopkatanaalleyhairparkourshot with an arrowarcherywelldrumparamedicartifactpotionresponsibilitypawnshopinnmiddle ageswarlordbo staffcavalrystaffrelicwu shusecret loveshot with a bow and arrowslow motion action sceneshaolinsandstormteenager fighting adultturned to stoneoutnumberedprotectorwuxia fictionfighting in the airelixirsparrowunspoken lovemagical weaponburning villagemonkey kingrice paddysagecrescent mooncherry treereferring to oneself in the third person (See All) |
Lancelot lives by the sword. In fact, they're next door neighbours, so teaming up to fight for money comes pretty naturally. Lady Guinevere, on her way to marry King Arthur is ambushed by the evil Sir Malagant. Fortunately Lancelot is lurking nearby and he rescues his future queen. They fall in love …, but Guinevere still fancies the idea of wearing a crown, so she honours her promise to Arthur. Can Lady Guinevere remain faithful, or will this Pretty Woman become a lady of the knight? (Read More)
Subgenre: | martial artssword and sorcery |
Themes: | murderkidnappingmarriageadulteryweddingfuneralhero |
Locations: | cavevillage |
Characters: | warriorhusband wife relationshiplove triangledeath of hero |
Story: | adventure herobarbarianswordsmannumber in titleflashbacktwo word titletitle spoken by charactershot in the chestbattleswordshowdownhand to hand combatcombatmenage a troissword fight …ambushdisarming someonefictional warkinglegendopening action scenewaterfallqueenarsonbattlefieldlawknighttorchshieldcrossbowmedieval timesarmorraidpassionate kisssword duelhorse and carriagemain character diesage differencecremationstandoffshot with an arrowmiddle agesmain character shotstafflast standhorse chasebattle axeflaming arrowobstacle courseking arthursword and shieldcamelotexcaliburarthurian legendmace the weaponends with funeralknights of the round tableoubliette (See All) |
The tyrant Gedren seeks the total power in a world of barbarism. She attacks and kills the keepers of a powerful talisman just before it is destroyed. Gedren then uses the power of the talisman in her raid of the city Hablac. Red Sonja, sister of the keeper, sets out with her magic sword to overthro …w Gedren. The talisman's master Kalidor follows to protect her. Of course they fall in love - however Red Sonja's power bases on the oath to never give herself to any man... (Read More)
Subgenre: | martial artscult filmsword and sorceryalternate historyswashbucklersword and fantasy |
Themes: | magicrapewrestling |
Locations: | castlesea monster |
Characters: | warriorfemale protagonisttough guyaction hero |
Story: | adventure herobarbarianswordsmanfemale nuditycharacter name in titlebloodviolencebare chested malekissfightblood splatterhorseblondebattle …maskshowdownhand to hand combatfightingcombatdecapitationcleavagesword fightwomanmixed martial artsstabbed in the chestdisarming someonefictional wardueltough girlscarunderwatersevered armdismembermentbattlefieldbow and arrowspearlifting someone into the airvillainessaction heroinecrushed to deathfemale warriorguardcrossbowpsychotronicsiegesword duelteleportationbeheadingkendomusclemanstrongmanstandoffredheaded womanfencinggirl powerprehistoric timeslesbian subtextgiant spiderkiller robotbattle axetalismanstone agenipple sliphyborian agelava stream (See All) |
The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E …ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)
Subgenre: | epicmartial artscult filmsword and sorceryswashbucklersword and fantasy |
Themes: | mythologymagicmonsterherocourage |
Locations: | castle |
Characters: | warriorsoldiertough guy |
Story: | adventure herocharacter name in titlebased on novelone word titlefightbased on bookhorsebattleswordsecrethand to hand combatdemonfightingcombatsubjective camera …good versus evilambushdeath of friendmixed martial artsdisarming someonefictional warkingdueldragonbattlefieldbow and arrowspearegghunterknightdwarfwizardsiegekingdomsword dueltragic herodaggerstick fightelfheroismfantasy worldsword fightingsword and sandalopen endedchosen onestaffteenage heroshot with a bow and arrowfictional countrybattle axeteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All) |
The film tells the story of Will Stanton, a young man who learns he is the last of a group of warriors who have dedicated their lives to fighting the forces of the Dark. Traveling back and forth through time, Will discovers a series of clues which lead him into a showdown with forces of unimaginable … power. With the Dark once again rising, the future of the world rests in Will's hands. (Read More)
Subgenre: | epicsupernatural |
Themes: | mythologymagicchristmassupernatural powertime travelmissing child |
Mood: | darkness |
Locations: | schoolchurchsnowbusvillagewoodsenglandstorm |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage boysecurity guardvillainprofessoramerican abroaddream girlmerlin |
Period: | winterchristmas party17th century |
Story: | warriorsguardianbased on novelflashbackdogfightphotographtitle spoken by characterknifefirehorsepunched in the facecatbattlesword …bookbirthdayclassroomgood versus evilfoot chasebedroomdisguisemansionbridgesnakebirdchild in periltransformationactor playing multiple rolesknocked outchristmas treecollege studentfarmerhorse ridingsix word titlechickentwinpubpowerquesthunterhammervillainesswristwatchcrushteenage protagonistanimal attackshieldvisioncrossbowchild protagonistshopping mallimmortalitybutleratticraidlighttelekinesiscrowclose up of eyeschristmas presentbirthday presentstuffed animalstonetwin brotherschoolboyhuntkittentavernbellblizzardcrashing through a windowphysicsidentical twinscountry housewindmillbeltravenscarfcoldfamily homesaltclose up of eyechosen onechild abductionteenage heroyoung adultcryptknife held to throatsnowstormpendantsnowglobemanor housecollapsing buildingwhite horsestained glass windowchristmas dayclose up of mouththesisancientwildceltichuman skeletonhallfalling off horsepyrokinesisbodily possessiondisembodied voiceicicleback in timeskylightlong lost brotherbird attackinternet researchlong lost sonmissing brothertwisted anklebell ringingthrown from a horserapid agingmace the weaponthrown into waterartefactbutterfly knifeeternalflock of birdsbrother brother reunionflooded roomposing as a doctorloose adaptationsinging a hymndark versus lightcock fightturned into a bird (See All) |
This is the tale of Harry Potter, an ordinary 11-year-old boy serving as a sort of slave for his aunt and uncle who learns that he is actually a wizard and has been invited to attend the Hogwarts School for Witchcraft and Wizardry. Harry is snatched away from his mundane existence by Hagrid, the gro …unds keeper for Hogwarts, and quickly thrown into a world completely foreign to both him and the viewer. Famous for an incident that happened at his birth, Harry makes friends easily at his new school. He soon finds, however, that the wizarding world is far more dangerous for him than he would have imagined, and he quickly learns that not all wizards are ones to be trusted. (Read More)
Subgenre: | epiccult filmfairy taledark fantasy |
Themes: | magicfriendshipchristmasmoneyghostmonsterherosupernatural powerdysfunctional familycelebrity |
Mood: | night |
Locations: | trainforesttrain stationschool of magic |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendgirlbest friendlittle girlbullyteacher student relationshipprofessorwitchuncle nephew relationshipaunt nephew relationship |
Period: | 1990syear 1991year 1992 |
Story: | mysticsorceryoccultcharacter name in titlebased on noveldogtitle spoken by charactersurprise endingmirrorrescueslow motion sceneswordletterbirthdaygood versus evil …halloweenorphansnakechild abuseno opening creditschild in perilcreaturetransformationkeyuniformfirst of seriesmissiondragontough girlbankscarschoolgirlratfirst partpowerstrong female characterchesseyeglassesdestinygametalking animallifting someone into the airhatwitchcraftblockbusterfrogstrong female leadbreakfastdwarfreverse footagebraverycrossbowzoowizardimmortalityboarding schoolstadiumfamily secretowlelfspellinvisibilitylevitationparalysissorcererfantasy worldpotiontrollidentical twinsorchestral music scorestutteringtrapdoorschool lifeunicornbroomhuman becoming an animalcult figuremagic wandwoman in uniformchild herofemale ghostgiant creaturegrandfather clockbased on young adult novelinfirmarycloaknew homelifting a male into the airmagical mirrorcentaursteam locomotivemirror does not reflect realityevil wizardflying broombrick wallelitismhereditary gift of witchcraftpoetry recitationinvisibility cloakmagical bookattempted child strangulationforced perspectivebad parentsmagical broomstickfictitious sportbad parentingbildungsromanescher stairwayhobgoblinpet as giftquidditchportrait comes to lifetrain platformmagical cloak11th birthdayfaerie talehuman chessboardsnowy owltripping while fleeing (See All) |
A prehistoric epic that follows a young mammoth hunter named D'Leh's journey through uncharted territory to secure the future of his tribe. When a band of mysterious horse-riding warlords raid the Yaghal camp and kidnaps his heart's desire - the beautiful Evolet along with many others, D'Leh is forc …ed to lead a small group of hunters south to pursue the warlords to the end of the world to save her. Driven by destiny, the unlikely band of warriors must battle saber-toothed cats and terror birds in the Levant. (Read More)
Subgenre: | epic |
Themes: | magicmurderdeathlovefriendshipkidnappingbetrayalprisondancemonsterdeath of motherabusedyingblindnessself sacrifice …huntingdeath in childbirthmurder of motherfight for freedom (See All) |
Mood: | rain |
Locations: | snowboatdesertvillagelakejunglecampfire |
Characters: | warriorfather son relationshipmother son relationshipfriendboygirldancerpriestreference to godwitch |
Story: | warriorsmountainnumber in titlebloodkissfightdancingknifechasefirevoice over narrationcryingbeatingcorpsefood …horserescuepunched in the facebattlefalling from heightmasklietearshand to hand combatdead bodyjailhallucinationrivercombatorphanmassacrestabbingdeath of friendeatingarmyprisonerbirdacronym in titlefictional warritualsearchjourneyflash forwardtreelegendstabbed in the backprologuespiritualityliartentlightningskeletonscarpursuitstalkinggifttrapwhippingsubtitled scenemoongolddestinybow and arrowspearwoundinjuryquestslaveryjail cellcaptivehuntertempletorchburialanimal attackdinosaurslavepromiseshieldfloodface painttarget practicetelescopeconstruction sitewhiprejectionresurrectionfalling to deathbutcherprophecyfather figureabsent fathersuperstitionaerial shotfallrainstormtriberaidsmokeheroismspittingsunsetmysticismagriculturemeathuman sacrificesailboatshot with an arrowarcherywhistledrumhuntstretcherpyramidpremonitionblizzardprehistoric timesdeath of familyrevoltstealthritescoldingcavalryuprisingbonedreadlocksnegotiationpitrebirthvulturesailing shiploinclothchantingspiritualismcustomfloodingsnowstormnetmessiahhornanimal rescuefuneral pyrepharaohnorth africaexhaustionethnographytalking to an animaltrekcaught in a netseedstar gazingstone agecollapsestampedechantseparation from familythrown from heighttrackingpriestessblessingwar paintherdmammothancient cultureconstruction craneseerallycave womanstabbed with a spearcave drawinggiant birdwoolly mammothdying in someone's armsfalling objectmanaclesancient citydragged along the groundslave revoltlong fingernailssabertooth tigertrampledtransferencetribal warfarearmbandcauterizing a woundcheerprimitive artbuilding a firefalse godclub the weaponmedicine womansabre toothed catwhipping a slave10000 b.c.arrow in one's backrising from the gravethatched roofthe onewalking in circleshearthimpaled on a spearmurder of a kingslave uprising (See All) |
John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to …survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)
Subgenre: | martial artscoming of ageblack comedysword and sorcerydark fantasysword and fantasy |
Themes: | magicmurderdeathloverevengesurrealismkidnappingbetrayalghostfearescapemonsterdeceptionrobberysupernatural power …death of motherredemptionunrequited lovehopecourageself sacrifice (See All) |
Mood: | nightdarkness |
Locations: | churchforestsnowvillagewoodsfarmcastlecampfirewalled city |
Characters: | warriormother son relationshipmother daughter relationshipsoldiersister sister relationshiptough guyaction heroalcoholicteacher student relationshipwitchevil witchdeath of student |
Story: | swordsmanmountainbased on novelviolencedogfighttitle spoken by characterexplosionknifechasesurprise endingfirefistfighthorseurination …rescueslow motion scenebattleswordbrawlfalling from heightshowdownhand to hand combatdemonhallucinationcombatgood versus evilassassinsword fightambushstrangulationaxemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestno opening creditsanti herochild in perilfictional warunderwater scenecreaturefemme fataletransformationtrainingskinny dippingstabbed in the backprologueattackpossessiondragonrace against timelightningskeletonfarmerexploding bodypigthreatened with a knifewaterfallbearqueenbattlefieldstylized violencestrong female characterhenchmandestinybow and arrowburned alivespearassassination attemptheavy raincagecatfightvillainesseccentricgiantjumping from heightirishskullknightstrong female leadtorchaction heroinefemale killerbar fighteaten alivefull moonretirementvisiontarget practicebraverycrossbowdual wieldson3 dimensionalstabbed in the headoiltime lapse photographystabbed in the legdark heroaerial shotknife fightwisecrack humorrainstormdeerdisfigurementknife throwingdemonic possessiontragic heroblack magicburned to deathexorcismteleportationfemale fightergiant monstertwo man armyworld dominationfemale spyhired killertavernassistantpremonitionman kills a womantrollwoman kills a manstabbed in the shouldersole black character dies clichebladejumping into waterstabbed in the faceclawgravestonepitchforkchosen oneapprenticearmorypitregenerationvillain turns goodmentor protege relationshiptragic villainhorse drawn carriagenetgold coinaxe fightbrandingpendantleopardtalismanwarlockgiant creatureturned to stonebased on young adult novelcaged humancaught in a netwitch huntfemale thiefsilvercrisis of consciencetailtroubled productioncloakbell towerfighting in the airwoman murders a manmaster apprentice relationshipshape shiftingsororicidecauldronaxe throwingman murders a womanbookshelfgemstonesceptertough womanwoman murders a womanwitch hunterrolling down a hilltapestryfarmboydark forestwitch burningopening creditswoman kills a womanblood moongood witchcarry onrolling downhillcliffhanginglancashire (See All) |
After a power source for the community of Krypton survivors is accidentally whisked to earth, Kara-El, cousin to Superman and niece to Jor-El, chooses to go to earth to find it, and bring it back. Upon her arrival, she becomes just a powerful and Super as her cousin, but encounters dangerous battles … and unexpected obstacles when a mean spirited woman who practices rituals of the occult takes the power source for herself, and uses it to cause destruction and attempt zenith human status. (Read More)
Subgenre: | independent filmcult filmcoming of agesuperherofish out of water |
Themes: | magiclovefriendshipsurrealismkidnappingbetrayalprisonfeardrunkennessescapeweddingmonsterdeceptionsupernatural powerhope …courageself sacrificefirst lovespace travelescape from prison (See All) |
Mood: | poetic justice |
Locations: | cavenew york citybarbeachforestmotorcyclesmall townwoodsurban settingcitylakebaseballcastleouter spacegas station …school busschool teacherinner space (See All) |
Characters: | husband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlfemale protagonistalienphotographerhostageartistbullyteacher student relationshipwitchblonde girlevil witch |
Period: | 1980s |
Story: | sorceryoccultmountainf ratedcharacter name in titleviolenceone word titlesequelbare chested malekissfighttitle spoken by characterpartyknifechase …surprise endingshowerfirehorsemirrorblonderescuebattlebased on comicshowdowndemoncombatscientistsubjective cameragood versus evilbased on comic bookambushdisguisemansionmontagedinerprisonerdouble crossritualcreaturefemme fatalemarriage proposalone against manycostumeprotestpay phonecharacter's point of view camera shotmissionproduct placementrace against timestatueknocked outrabbittough girlcollege studentlightningbankbraceletscene during end creditsattempted rapemanipulationamerican flagdisappearanceschoolgirlcharacter says i love youthreatened with a knifewaterfallflowerpowerstrong female charactersabotagedestructionflyingheroinelooking at oneself in a mirrorspin offcaptivewitchcraftspidervillainessplanetservantstrong female leadmind controllasercarnivalaction heroinepicnicearthquakeslavefemale warriorrampagebraveryconstruction sitecynicismfemale leadsuper villainlove at first sightpsychotronicmentorsculptureswampfirst kissexilebutterflyaerial shotshadowsuperheroinecapturestadiumsecret identityblack magicdc comicstelekinesisteleportationhockeyfast motion scenespellenglishman abroadinvisibilityharassmentfinal showdownteachingconstruction workerassumed identitysuper strengthgiant monsterfireballportalworld dominationcomic reliefbully comeuppanceroller coastergardenerspeedbroken mirrorredheaded womanbeastschool principaltornadourban decayknocked unconscioussorcererunderworldcrystalassistantkiss on the lipsgirl powerfemale herocrashing through a windowmacguffinpotioncreationfinal battlecapevalentine's dayorchestral music scorealter egoshape shiftercrime fighterwoman fights a mansorceressmerry go roundone woman armyreference to supermanbulldozerphilosopherfast food restaurantdonutmagic spellalien racefictional cityshower roomgirls' schoolcoconutsurprise during end creditshuman aliensuper speedmosquitoinvulnerabilitymagic wandlawnmowerbouquet of flowerslaser beamsecret passagewaywoman in uniformwarlockwater towergargoylevolcanic eruptionencountergiant creaturered rosevortexmagical potionorbdual identitywoman hits a mancaged humanmuggerquicksandnew york city skylinebumper carsuper villainesssphereexplosive decompressionhumanoid alienvintage carmagical mirrortwo against onelove potioncostumed heroshape shiftingmagical objectgirl from outer spacedomegod complexred capeamusement park ridebox of chocolatesgirl heroineflying superherogroundskeeperhyper speedx ray visionfloating in spacekicked in the shinlaser visioncrushed carinanimate object comes to lifeprep schoolteenage superheroineflying womanleisure suitgardnerwalk on the beachextraterrestrial humaninvisible monsterabandoned amusement parkfloating islandfloating cityprotesterreference to clark kentnewspaper photographersupergirlwhirlwindlove spellmathematics teacherdomed cityfield hockeyappearing from waterheart shaped box of candysoftball gameart sciencesuperwomantrapped in a mirrorloss of powerreference to saturn the planetreference to venus the planetunearthed skeletoncaped superheroineenergy forcemaelstrom (See All) |
Set in 1935, a professor, archaeologist, and legendary hero by the name of Indiana Jones is back in action in his newest adventure. But this time he teams up with a night club singer named Wilhelmina "Willie" Scott and a twelve-year-old boy named Short Round. They end up in an Indian small distresse …d village, where the people believe that evil spirits have taken all their children away after a sacred precious stone was stolen! They also discovered the great mysterious terror surrounding a booby-trapped temple known as the Temple of Doom! Thuggee is beginning to attempt to rise once more, believing that with the power of all five Sankara stones they can rule the world! Now, it's all up to Indiana to put an end to the Thuggee campaign, rescue the lost children, win the girl and conquer the Temple of Doom. (Read More)
Subgenre: | martial artscult filmstop motion animationchrist allegorylow comedydieselpunk |
Themes: | magicmurderdeathlovefriendshipkidnappingtortureescapegangsterheroredemptionsadismcrueltyjusticestarvation |
Mood: | nightgorepoetic justice |
Locations: | airplanenightclubwatervillagejunglecampfireindiaairplane accidentnightclub shootoutmine car |
Characters: | warriorfather son relationshipchildrensingerboyaction herovillainamerican abroad |
Period: | 1930s |
Story: | adventure herooccultcharacter name in titlebloodviolencesequelbare chested malekisschasepistolfireshootoutfistfightblondeface slap …rescueswordgunfightfalling from heightriflesecond partrivercleavagesword fightbridgeprisonerstabbed in the chestsnakecultdisarming someoneone man armyargumentcursedangerperson on firepoisonevil manskeletonhangingstreet shootouttraplove interestmonkeycard gamebow and arrowspearballoonheroinegothiclifting someone into the airslaveryroyaltyelephanttempleblockbusterfemale singerpart of trilogyhonorcompassionmexican standoffcrushed to deathslaveeaten alivebarefootadventurerreverse footagediamondsevered fingerbraveryseven word titlewhipfalling to deathinsectfather figureairplane crashbooby trapheartfallmusical numbersexy womantuxedominepassionate kissvoodooprequelpalaceleather jacketheroismyellingbrainwashingspit in the facehuman sacrificecrocodilebugcomic reliefroller coasterforeignerraftfalling into watertriadlavaarcheologysoupunsubtitled foreign languagetyrantmacguffineyeballchild kidnappingkindnessfriends who live togetheralligatorperfumefamous scorearcheologistrighteous rageoutlaw gangshrineheart ripped outtommy gunsecret passagebanquetchosen oneexploding airplaneimmolationlifting person in airheart in handtap dancingfedorahinduismbeetlecaged animalchild laborgross out humorantidoteshacklesscreaming in fearfaminestudio logo segues into filmchild driving cartyrannychild actorindiana jonesemaciationrickshawhand through chestlifting male in airbolt action riflebritish empirevoodoo dollrope bridgeconveyor beltmine shaftbelchshanghai chinawinkriver rapidschild driving a carbelchingburpcremated remainsburpingdeath trapgongsprayed with wateryawningsuspension bridgeplaying pokerturntablebritish colonialcheating at cardsprequel and sequelhallucinogeniclive chickenfemale dancervictim invited to dinnermusical sequence in non musical worksleddingthompson sub machine gunbeating heartlife raftreligious ceremonyeating brainsopening champagneflying batjourney shown on a mapkalimedium breastsyawnore cartwhite tuxedosplitsyear 1857ancient ritualcliffhangingeaten by a crocodilegrindstoneriding an elephantinnocent deaths avengedred carnationthuggeewhite dinner jacket (See All) |
After being captured by Turks during the Crusades, Robin of Locksley and a Moor, Azeem, escape back to England, where Azeem vows to remain until he repays Robin for saving his life. Meanwhile, Robin's father, a nobleman loyal to King Richard the Lionhearted, has been murdered by the brutal Sheriff o …f Nottingham, who helped install Richard's treacherous brother, Prince John, as king while Richard is overseas fighting the Crusades. When Robin returns home, he vows to avenge his father's death and restore Richard to the throne. Even though Maid Marian, his childhood friend, cannot help him, he escapes to the Forest of Sherwood where he joins a band of exiled villagers and becomes their leader. With their help he attempts to cleanse the land of the evil that the Sheriff has spread. (Read More)
Subgenre: | sword and sorceryswashbuckler |
Themes: | magicmurderfriendshippregnancytortureweddingrobberytheftcourageprison escapemurder of father |
Mood: | poetic justice |
Locations: | forestvillageenglandcastle |
Characters: | warriorsingerbabypriestthiefaction herowitchcousin cousin relationshippregnant wifepoaching |
Story: | adventure herobarbarianswordsmanfemale nuditymale nuditymale rear nuditydogexplosionknifeshowerfirefistfighthorseshot in the chestface slap …shot in the headrescueswordbare buttfalling from heightlettershowdownhand to hand combatrivercombatshot in the backgood versus evilcleavagesword fightambushstabbingstabbed to deathstabbed in the chestdisarming someonekingdueldangerperson on fireattackpassionstatuekicked in the faceattempted rapedeath of brotherchildbirthloss of fatherarsonbattlefieldprincegoldbow and arrowstabbed in the stomachrebelknighttorchguardcrossbowhit in the crotchrowboatstabbed in the legmedieval timesoutlawknife throwingraidsiegesword duelarrowdaggerstick fighthorseback ridingwedding ceremonypeasantrobberbreadshot with an arrowjerusalemarcheryhideoutfalling into watercrashing through a windowfriends who live togethersword and sandalarchermiddle ageenglishmanfacial scaroutlaw gangmiddle agesbutt slapwriting a letterman on fireforced marriagemasshalf brothershot with a bow and arrowhorse chasemedallionbattle axecousinflaming arrowenglishwomanfall to deathkrav magawhite horsestained glass windowdevil worshipinterrupted weddinggunpowderstabbed with a swordmelonstabbed in the heartwind chimereturn homecatholic masskilled with a swordagainst the oddsballadeermistletoecrusadesking of englandsitting in a treesword and shieldfacial cutdeath of cousincorrupt priest12th centuryman murders a womanface woundfacial injurykneed in the crotchstabbed with a spearpublic hangingsaved from hangingspitting in someone's faceblack horseblood oathmoorsthrown out a windowfriarkilled with an arrownottingham englandhorseback chasehot candle waxriver battlemass hangingscars on backhiding in a treeantlerhit with a stickholding one's hand over someone's mouthvow of revengewoman slaps a womancut on faceoutdoor weddingdeer antlersplantagenetheld at sword pointswordsmanship1100senglish nobilityinability to swimquarterstaffreference to the prodigal sonvillage set on firepushed through a windowcan't swimcutting the palm of one's handdrum rollface scarsword held to throatunable to swim1190sband of outlawsexploding barrelfather's gravemurder of cousinstolen horsedagger held to throatlife debtscimitarsherwood forestchildbirth complicationking richard ioutlaw hideoutstabbed with a dagger (See All) |
While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga …to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)
Subgenre: | epicconspiracytragedysword and sorcerydark fantasysword and fantasy |
Themes: | magicmurderdeathrevengesurrealismsuicidekidnappingghostescapeweddingmonsterdeceptiondeath of fathersupernatural powerredemption …unrequited lovesamurairitual suicide (See All) |
Mood: | night |
Locations: | forestsnowcemeteryvillagewoodsjapanlakeshipcastlecampfire |
Characters: | warriorhusband wife relationshipfather son relationshipfather daughter relationshipsoldierhostagetough guyaction heroteacher student relationshipwitchself mutilationsamurai swordhuman versus monstersamurai warriorhunting party |
Story: | mountainnumber in titlebloodviolenceflashbackbare chested maletitle spoken by characterexplosionknifechasesurprise endingbased on true storyfirebeatingcorpse …digit in titleshot to deathblood splatterhorseshot in the chestshot in the headrescuebattleswordshowdowndemoncombatshot in the backdecapitationfoot chaseorphancandlesword fightambushaxemassacredisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacelegendstabbed in the backprologueperson on fireattackpoisondragonmanipulationexploding bodyneck breakingtraploss of fatherdirectorial debutshot in the armbare chested male bondagebattlefieldstylized violencebow and arrowburned alivespearheavy raintempleexploding buildingwitchcraftspidervillainessgiantforbidden lovecgihonortournamentburialslavepresumed deadguardarranged marriagecrossbowfight to the deathstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingsword dueltragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offarchermusketshape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
Subgenre: | epicmartial artsblack comedytragedyaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
Themes: | mythologymurderdeathloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionseductiondeath of fatherbrutality …supernatural powerredemptionfaithhopeapocalypseblindnesscourageself sacrificenear death experienceafterlifeunlikely heroegyptian mythology (See All) |
Mood: | darknesspoetic justiceaustralian supernatural |
Locations: | cavedesertelevatorshipouter spacejungleaustralian space travel |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guyaction heroex husband ex wife relationshipdeath of girlfriend |
Story: | mountainbloodviolenceflashbackbare chested malekissfightexplosionknifechasesurprise endingfirevoice over narrationbeatingcorpse …fistfighthorseshot in the chestrescueslow motion scenepunched in the facebattleswordbrawlfalling from heightshowdownhand to hand combatbeddemonorgycombatdecapitationgood versus evilsurvivalbedroomassassinsword fightambushold manaxemassacrebridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armyfictional wardouble crossunderwater scenekingcreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueevil manlightningopening action sceneskeletonbraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionbow and arrowburned aliveflyingspearassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
Themes: | mythologymagicmurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneral …monsterdeceptionrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrifice (See All) |
Mood: | rainnightmaredarkness |
Locations: | caveforestboatlondon englandwatervillagewoodsenglandlakeshipcastlebrothelsewer |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guyaction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
Story: | swordsmancharacter name in titlebloodviolenceflashbackdogbare chested malefighttitle spoken by characterexplosionknifechasesurprise endingfirebased on book …beatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressiondirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
All looks lost for the Rebellion against the Empire as they learn of the existence of a new super weapon, the Death Star. Once a possible weakness in its construction is uncovered, the Rebel Alliance must set out on a desperate mission to steal the plans for the Death Star. The future of the entire …galaxy now rests upon its success. (Read More)
Subgenre: | epicsuspensetragedyspace operascience fantasy |
Themes: | murderdeathfriendshiprevengekidnappingbetrayalpoliticsprisonfeartortureescapedeceptionangerdeath of fatherbrutality …supernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicblindnesscourageself sacrificeartificial intelligencespace travelprison escape (See All) |
Locations: | cavebeachdesertelevatorfarmouter spacespacespace stationspace battlebattle station |
Characters: | warriorhusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfemale protagonistsoldieralienhostagetough guyaction herolittle girlasiandirectorsniper …sniper rifleengineerrobot human relationship (See All) |
Story: | guardianswordsmannumber in titleviolenceflashbacktwo word titlefighttitle spoken by characterexplosionchasepistolfireshootoutcorpseshot to death …machine gunshot in the chestshot in the headrescuebattleswordarrestgunfightbrawlfalling from heightheld at gunpointbombinterrogationrobotcriminalcombatscientistshot in the backsubjective cameragood versus evilspysurvivalambushstrangulationmassacredisguisedeath of friendarmyimpalementstabbed to deathprisonerstabbed in the chesttied to a chairmapno opening creditsanti herochild in perilfictional wardouble crossspaceshipcreatureon the runflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguedangerstabbed in the backprologueelectrocutionattackcharacter's point of view camera shotmissionundercoverrace against timeevil manknocked outtough girllightningfarmerstreet shootoutshot in the shoulderexploding bodyloss of fathermercenaryex convictloss of mothershot in the armgeneralsecret agentsubtitled scenebattlefieldpowermoonstylized violencestrong female charactercivil wartraitorcaptainsabotagegrenadedestructionassassination attemptheavy rainsociopathhelmetlifting someone into the airspin offjail cellcaptiveloss of loved onetemplespacecraftsergeantexploding buildingloss of wifecaucasianplanetblockbusterrebeljumping from heightrebellionstrong female leadlaseraction heroinemexican standoffsocial commentarybroken legpresumed deadfemale warriorgas maskcameohaunted by the pasttensionveteranbraverycrossbowresistancehatredfemale leadmercilessnesspower outageevacuationfalling to deathescape attemptsenatorhit on the headdeath of protagonistassault rifleaerial shothologramundercover agentcapturedark pastblind manbody countwar veteranbroken armwilhelm screamtelekinesismoral dilemmaprequellaser gunheroismshot through a windowminingreturning character killed offbag over headbureaucracyfemale fighterfake identitytoweralarmcomputer crackerworld dominationcomic reliefmegalomaniacplane crashyoung version of characterbunkergovernorstar warsfemale spybearded manmessagecrystalfilm starts with textcrash landingspace shuttlefighter pilotbehind enemy linesdamman kills a womanoffscreen killingspace warlightsaberdisembodied headfight the systemfinal battlecapeempirefamous scoreopen endedtragic pasttragic endingexploding shipfemale criminalstarshipdistrustfemale prisonerfiring squadjailbreakadmiraldogfightarchivecockney accentmind readingpsychotronic filmbo staffresistance fighterforce fieldlifting person in airanti heroinegogglesknocked out with a gun buttinnocent person killedalien creatureextreme close uptotalitarianismepic battlescottish accenthumanlong haired malecapmushroom cloudsagasuit of armorstabbed in the footdeath of parentescaped prisonerfemale pilotmessengertransportair strikedark heroinecollapsing buildingprosthetic limbdefectorcollisiondisobeying ordersmass destructioncouncilthe forceblueprintescape podsuicide missioninsubordinationoutpostweapon of mass destructionspace westernbazaarmining townfictional planetcargo shipsecret weaponlock pickgalactic warjedidroidnight vision binocularsagainst the oddsstrong female protagonistdeath sceneexploding planetexploding tankextremistrebel leaderrobot as pathosinformation leaksecret baseroninstormtrooperspaceship crashdestroyed citystorm trooperman with a ponytailsuper weaponwarp speedblasterdeath starwmdleather gloveshyperspacesecret messagealien languageprequel and sequelsecret planstarfightercommunicationsintelligence officersentient robotalien intelligencebad guys wingunshiptragic heroinefemale convictinbetwequelevil empireaerial battleblack maskdarth vaderextremist groupheroine diesmale captainopening creditsswitchboardcontrol towerenergy shieldfather killedhuman maleschematichuman femalemale pilotspace pilottie fighterastromech droidhandheld communicatorsith lordspaceship name in titlefemale senatorplanet viewed from outer spaceshuttleultimate weaponx wing starfighterprotocol droidrebel basestar destroyerstardustat at walkerdeep voicedestroyed planetrebel starshipshuttlecraftspacecraft cockpitstarfighter pilotstolen planstransport starshipwarrior monkblaster pistoldefectdroid human relationshipforce chokegr 75 medium transportimperial shuttleimperial star destroyerimperial starshipimperial stormtrooperrebel soldierred blade lightsaberrogue oneshared universestarfighter cockpit (See All) |
They're rowdy, they're ragtag, they're misfits turned mercenaries for hire. Vox Machina is more interested in easy money and cheap ale than actually protecting the realm. But when the kingdom is threatened by evil, this boisterous crew realizes that they are the only ones capable of restoring justic …e. (Read More)
Subgenre: | epicsuperhero2d animationadult animation |
Themes: | magicloveherobrutality |
Mood: | gore |
Locations: | castletown |
Characters: | warriorvillainlove letter |
Story: | animatedbloodviolencegunfightknifebattleswordrifleguitargood versus evilaxeweaponanimalcreature …attackbearpowerbow and arrowseriesfanarmorkingdomrpgexplorationfantasy worldcampaignstafffunfansdungeons and dragonsbased on web serieseasy moneyfast pacedshort sighted (See All) |
Thousands of years ago, a race of beings known as Dark Elves tried to send the universe into darkness by using a weapon known as the Aether. Warriors from Asgard stop them but their leader Malekith escapes to wait for another opportunity. The warriors find the Aether and since it cannot be destroyed …, they try to hide it. In the present day, Jane Foster awaits the return of Thor although it has been two years since they last saw once another. In the meantime, Thor has been trying to bring peace to the nine realms. Jane discovers an anomaly similar to the one that brought Thor to Earth. She goes to investigate, finds a wormhole, and is sucked into it. Back on Asgard, Thor wishes to return to Earth but his father, Odin refuses to let him. Thor learns from Heimdall, who can see into all of the realms, that Jane disappeared. Thor then returns to Earth just as Jane reappears. However, when some policemen try to arrest her, an unknown energy repulses them. Thor then brings Jane to Asgard to find out what happened to her. When the energy is released again, they discover that when Jane disappeared, she crossed paths with the Aether and it entered her. Malekith, upon sensing that the time to strike is now, seeks out the Aether. He attacks Asgard and Thor's mother Frigga is killed protecting Jane. Odin wants to keep Jane on Asgard so that Malekith will come. Thor disagrees with his plan, so with his cohorts, he decides to take Jane away. He enlists the aid of his brother, Loki. Unfortun… (Read More)
Subgenre: | martial artssuperherodisneydark fantasyscience fantasy |
Themes: | magicmurderdeathrevengebetrayalprisondrunkennessfuneralmonsterdeceptionsupernatural powerdeath of motherdeath of wifeself sacrificespace travel …prison escapenorse mythology (See All) |
Mood: | darkness |
Locations: | caverestaurantlondon englandvillagepolice carenglandouter spaceearthabandoned factory |
Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipdoctorbrother brother relationshipsoldierpolice officertough guyaction herovillainamerican abroadbabe scientistfemale scientist …alien superhero (See All) |
Story: | warriorsnuditycharacter name in titlemale nudityviolencesequelflashbackbare chested malefightexplosionknifechasesurprise endingvoice over narrationcell phone …shot to deathfistfightcar accidentshot in the chestface slapbattleswordarrestbrawlbased on comicshowdownhand to hand combatsecond parthandcuffscombatscientistshot in the backgood versus evilsword fightbased on comic bookaxedisguisebridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestweaponmapexploding carno opening creditsone man armyhit by a carfictional warspaceshipkingcreaturejourneynews reporttransformationpublic nuditylibrarycharacter repeating someone else's dialoguestabbed in the backrace against timestatuetough girllightningopening action scenescene during end creditsexploding bodydatedarkneck breakingthreatened with a knifewaterfallsevered armsacrificequeensubtitled scenebattlefieldprincestrong female charactergamegrenaderacespearheavy rainhammerspacecraftenemyplanetblockbustergiantsevered handfaked deathknightgenocideend of the worldaction heroinecrushed to deatheaten alivefemale warriormental institutioncameoprison guardinvasionfairy3 dimensionalstabbed in the legscene after end creditsmarvel comicsinfectiondungeonhologramrainstormbody landing on a careye patchdaggerteleportationlaser gunsurprise after end creditspalaceelffemale soldiermale objectificationinvisibilityillusionlevitationfinal showdownreturning character killed offsuper strengthgiant monsterportalworld dominationmegalomaniacbearded mansorcerertavernfighter jetadopted sonmale protagonistheirstation wagonravenopen endedparasitefacial scarexploding shipshapeshiftinghit with a hammerwoman slaps a manpsychotronic filmforce fieldthronex rayed skeletonalien racehostile takeoverearth viewed from spaceepic battlestarts with narrationinternlong haired malecityscapeaxe fightbattle axesurprise during end creditshuman aliencrushed by a carcar keysstabbed in the sideone eyed manfuneral pyrebody armorgiant creatureturned to stonevortexobservatorycaught in the rainholding cellsparringmarvel entertainmentcliffhanger endingrusemarvel cinematic universestonehengedouble impalementpixilated nuditysee you in hellreturning characterwarrior racefake injurybound in chainsadopted brotherastrophysicistsequel baitingfalling objectactor reprises previous rolereference to captain americaopening creditsextraterrestrial alienwife killedcloaked shipmale doctorstan lee cameohorned helmetadoptive mother adoptive son relationshipdark worldpersonal journeypointy earsmother killedhammer as weaponlong haired womanwar hammerwoman with long hairpolice station wagonshared universe (See All) |
The warrior Deathstalker is tasked by an old witch lady to obtain and unite the three powers of creation - a chalice, an amulet, and a sword - lest the evil magician Munkar get them and use them for nefarious purposes. After obtaining the sword, Deathstalker joins with other travelers going to the B …ig Tournament to determine the strongest warrior. The false king holds the true princess in captivity, and plots to have Deathstalker killed, and Deathstalker must fight to free the princess. (Read More)
Subgenre: | independent filmcult filmconspiracysword and sorcery |
Themes: | magiclovefriendshipkidnappingrapemonstercruelty |
Mood: | gore |
Locations: | cave |
Characters: | thieflustwitch |
Story: | sorcerybarbariannudityfemale nuditybloodviolenceone word titledogbare chested malesex scenefemale rear nudityfemale full frontal nuditynippleswoman on top …blonderescuebattleswordbrawlorgydecapitationsword fightstabbingimpalementsnakebrunetteanti herobirdtransformationduelpublic nuditycursemistaken identitymoaningattempted rapesensualityfirst partlove interestslaverybuttockscamptournamentfemale warriorfight to the deathsuper villainwizardperversionattractionillusionsex slavesexual tensionbeastsorcerersex changemetamorphosistyrantarchergladiatoramuletshapeshiftingharemsorceresspsychotronic filmbroken neckman hits a womangrindhouse filmloinclothogrefire breathingmagical swordfalling out a windowstabbed with a swordbare midriffhomoerotic fightcloakgenerositymalletmud wrestlingevil kingcursedman disguised as a womanhospitalitybeheadedbound in chainsfalling from a windowchivalrypeplumimprape threatroasted pigchalicebound with ropewatching someone having sexbound at the wristsman turned into womanswinging from a chandeliertattoo on headbound woman (See All) |
A charming thief and a band of unlikely adventurers undertake an epic heist to retrieve a lost relic, but things go dangerously awry when they run afoul of the wrong people.
Subgenre: | martial artsheistsword and sorceryswashbucklersword and fantasyheist gone wrong |
Themes: | magicmurderdeathrevengesurrealismbetrayalprisonfearescapemonsterherodeceptionrobberysupernatural powerredemption …couragenear death experienceescape from prison (See All) |
Locations: | cavebeachforestcemeteryvillagewoodscitycastle |
Characters: | warriorfather daughter relationshipsoldierbabythieftough guyaction herolittle girlvillainwitch |
Story: | barbarianmountainviolenceflashbackfightexplosionsingingknifechasesurprise endingfirebeatingcorpsefistfighthorse …rescueslow motion scenepunched in the facecatwritten by directorbattleswordbrawlpaintingbookshowdownhand to hand combatdead bodyguitarcriminaldecapitationgood versus evilspyassassinsword fightambushaxedisguisemontagebridgearmyimpalementmixed martial artsprisonerstabbed in the chestsnakefishsevered headanti herobirddisarming someonedouble crossritualcreaturenecklacetransformationattempted murderone against manybeaten to deathdangerwidowerfantasy sequencepoisondragonrace against timestatueevil mantough girlopening action sceneskeletonscene during end creditslong taketragic eventrattied upsix word titlethreatened with a knifemercenaryfireworkssubtitled sceneundeadbattlefieldpowerstylized violenceampersand in titleteagamedestructionbow and arrowassassination attemptballoonheavy raintalking animalquesthelmetmagicianmousetreasurewitchcraftspidervillainessblockbusterskullknighttorchaction heroinesocial commentaryback from the deadbald maneaten alivefemale warriorrole playinganthropomorphismshieldcameohaunted by the pastprison guardbraverycrossbowteamhatredbased on video gamemercilessnessresurrectionevacuationwizardescape attemptstabbed in the headpunched in the chestjumping through a windowdungeonknife fightwisecrack humorhologramdeerarmortribeprison celldark pastkingdomstadiumsword duelblack magicowltelekinesismoral dilemmateleportationelfexplorationillusionliving deadlevitationfinal showdownmazefemale fighterfireballportalworld dominationsailboatmegalomaniacold flamecheering crowdflysorcerercornfieldtavernhand over mouthartifactwormfall from heightarenablizzardtentacletyrantrole playing gamemacguffinslingshotfinal battleevil womanteamworkpart computer animationmaggothot air balloonbettingplantragic pastwoman fights a manbowvaultfemale criminalshapeshiftingsubterraneansorceresspsychotronic filmpotatostaffforce fieldrelicanti heroinegiant animalhawkvillain arrestedfilmed on locationknife held to throathorse drawn carriagedecoybubblemagical powerbattle axedecomposing bodysurprise during end creditswoman punches a manlordpendantfrozen bodybased on gamegiant creaturecatapultnarcissistorbrebootconfidencecouncilfire breathing dragontidal wavefansfemale thiefstabbed in the hearttied to a poleplayingplatonic lovedruiddungeons and dragonstwo directorstime freezelittle personbald womandragonflyearthwormbaronessreanimated corpseformer spyamphitheaterscepterfighting the systemnecromancergiant fishflaming swordinanimate object comes to lifesequel baitingchancellorshapeshifterlutenecromancyengravingwizardrycollapsing bridgedouble edged swordhuman in a cageopening creditsback to lifewoman tied updigging up a gravein the momentgang of thievesmagic swordrobbery gone wrong (See All) |
It is the Taisho Period in Japan. Tanjiro, a kindhearted boy who sells charcoal for a living, finds his family slaughtered by a demon. To make matters worse, his younger sister Nezuko, the sole survivor, has been transformed into a demon herself. Though devastated by this grim reality, Tanjiro resol …ves to become a “demon slayer” so that he can turn his sister back into a human, and kill the demon that massacred his family. (Read More)
Subgenre: | martial artsdark fantasy |
Themes: | magicmurderdeathbetrayalfeartorturemonsterangerpsychopathbrutalitysupernatural powerpovertyguiltinsanitysadism …evilabuseexecutioncrueltydyingcannibalismblindnesssamurai (See All) |
Mood: | nightgoreanime |
Locations: | forestwoodsjapan |
Characters: | brother sister relationshipvillain |
Period: | 1910s20th century |
Story: | sufferingmountainfemale nuditybloodviolencefemale frontal nudityflashbackbare chested malefightcorpseblood splatterpunched in the facemasktearsrunning …dead bodydemoncombatdecapitationgood versus evilorphansword fightaxemassacreimpalementsnakechild abuseapologysevered headpaintrainingcursedangerbased on mangapoisonpossessionscarmartial artistexploding bodyneck breakingtraptied upsevered armpsychicdismembermentpowergamesyringemartial arts mastertalking animalsociopathfaintingmutilationenemyspiderdesperationcovered in bloodcrushed to deathmasked mantokyo japankatana swordfight to the deathdual wieldcannibalmercilessnesspunched in the stomachfalling to deathdespairimmortalityballexploding headdark pastdemonic possessionbruiseblack magictelekinesisbloodbatharistocratadolescentarrogancetelepathycrowtorso cut in halfhistorical fictionhead blown offhuman monsterquick drawdrumnihilismdripping bloodsunriseeyeballkindnessbleedingatrocitysword fightinghead cut offpsychic powersuperhuman strengthfacial scarbloodshedtragic pasttormentcut into piecesanguishspitting bloodarm cut offmind readingviolent deathdying wordsregenerationdeeply disturbed personcutbitingantidotebloody facehands tiedsuper speedinvulnerabilityruthlessnessforcehostilityboulderevil powerscarred facescreaming in painhands tied behind backshounenfiendcliffhanger endingcoin tosspoisonedscratcheating human fleshlong tongueman eatersteam locomotivefacial cutinhumanitysparrowdemon hunterdemonessleg ripped offclawscobwebwooden swordindecisionanimal maskfemale demonscarfaceviciousnessdark powertelepathsupernatural murderchild slaverydisturbed personpoisoned to deathwalking through a wallbloodthirstyheld at sword pointbruised facedeath by sunrisedemon in human formmultiple arms (See All) |
Set in the thick of the Cold War, Red Son introduces us to a Superman who landed in the USSR during the 1950s and grows up to become a Soviet symbol that fights for the preservation of Stalin’s brand of communism.
Subgenre: | martial artssuperheroadult animationalternate history |
Themes: | murderdeathrevengesurrealismsuicidekidnappingbetrayalpoliticsprisonfearescapeherodeceptionmilitarybrutality …supernatural powerhopecommunismcouragerevolutionself sacrificenear death experienceartificial intelligence (See All) |
Mood: | night |
Locations: | carhelicopterairplaneelevatorpolice carcityrooftopouter spacemuseumlaboratoryfire truckhelicopter chase |
Characters: | warriorhusband wife relationshippoliceafrican americansoldieralienhostagetough guyaction herolittle girlbullylittle boysecretaryrussianchinese …alien superhero (See All) |
Period: | 1980s1960s1940s1950syear 1983year 1967year 1961 |
Story: | comic booksanimatedmountaincharacter name in titlebloodviolenceflashbackbare chested malegunfightcigarette smokingdancingexplosionchase …three word titlesurprise endingpistoltelephone callfirebeatingcorpseblood splatterfistfightmachine gunrescuepunched in the facewatching tvbattlebrawlbookbased on comicshowdownriflehand to hand combatbombrobotcolor in titlecombattelephonescientistreporterfoot chasejournalistbased on comic bookambushterroristdisguisemontagearmycolon in titlemixed martial artsprisonerweaponmapfalse accusationone man armydouble crossspaceshipnews reportflash forwardattempted murderlimousineone against manybeaten to deathdangercostumeprologueelectrocutionrace against timecover upkicked in the facetough girltankopening action sceneringmanipulationamerican flagbodyguardsoviet uniongovernmentexploding bodytied upprofanitynewspaper headlinebattlefieldpowerwashington d.c.chessberlin germanyak 47cold warmissileropecaptainsabotagefireplacelgbtdestructionflyingwarehousepropagandacomic booklifting someone into the aircommunistspacecraftexploding buildingpress conferencemind controllasercompassionaction heroinecolonelsocial commentarybald manmasked manfemale warriorcyborgwoman in jeopardyseriesshieldprison guardsevered fingerbraveryinvasionu.s. armypower outagesuper villainballblack and white scenespecial forcespunched in the chestairplane crashsuperheroinedemocracyhologramalternate realitymustachepiersecret identitydc comicsflamethrowerdictatorgunfirecloneexploding helicoptergovernment agentsymbolismmoral dilemmagatling gunmedia coveragefirefighterpalacemoscow russiabatsatelliteheroismrevolutionaryextraterrestrialterrorist groupface masklevitationfinal showdownbrainwashingscene before opening creditsfirearmsuper strengthworld dominationcomicbully comeuppancewallidealismcornfieldfighter jetambassadorgenetic engineeringdamtentaclesuicide bombervehicleleadersaving the worldsouth koreacapeanarchistberlin wallsuperhuman strengthwoman fights a manaircraftexploding shipnevadasubterraneansymbolaerial combatone woman armypsychotronic filmtommy gunbaldfreedom fighteru.s. air forceexploding airplaneforce fieldradarx rayed skeletonhead ripped offfictional cityearth viewed from spaceepic battlefemale journalisthelicopter pilotminiaturizationadaptationdeoxyribonucleic acidkiller robotleadershippolitical assassinationdetonatordecomposing bodywoman punches a manhuman aliensecret service agentsuper speedsuperhumanreference to karl marxsuperpowergraphic novelorblifting a female into the aircubegulaglobotomybuilding on fireflying manslave laborsupervillainthrown from heightsearchlightsoviet army2012year 1955dissidentair force basepower suitrise to powerfighting in the airrobot as menaceexploding tankextremistrussian armycostumed heroescalationyear 1946kremlingeopoliticsalien robotrobot suitsuperhuman speeddeath by poisonfighting the systemx ray visionheat visionspace rocketjet aircraftamazon warriorself destruct mechanismflying womangraphicgunshipstalingradextraterrestrial human20102013exo suitaerial battleideasense of humorbat signaldirect to videohelicopter gunshipmale captainoriginal storythe white house2015extraterrestrial alienstrongmetropolis the citysonic boomartificial lifeformhydroelectric damenergy constructrussian presidentcomic book writer (See All) |
The Eternals are a team of ancient aliens who have been living on Earth in secret for thousands of years. When an unexpected tragedy forces them out of the shadows, they are forced to reunite against mankind’s most ancient enemy, the Deviants.
Subgenre: | epicmartial artssuperherosupernaturalscience fantasylive action and animation |
Themes: | magicmurderdeathloverevengesurrealismsuicidebetrayaljealousyfeardrunkennessescapedanceweddingmonster …herodeceptionmemorynaturebrutalitysupernatural powerredemptionmental illnessfaithunrequited lovepanicwritingcouragemadnessnear death experienceevolution (See All) |
Mood: | ambiguous ending |
Locations: | cavebeachchurchairplanedesertlondon englandbicyclewatervillageaustraliafarmpolice carshipouter spacejungle …indiamuseumalaskaaustralian outbackbus driverwalled city (See All) |
Characters: | warriorfamily relationshipshomosexualfather son relationshipafrican americanboyfriend girlfriend relationshipfemale protagonistteacheralienstudenttough guylove triangleaction herogay kiss …little boyvillainprofessorex husband ex wife relationshiptruck driverengineerdeafnessself doubtalien monsterself healing (See All) |
Period: | 1940syear 19452020s1500s |
Story: | warrior womanf ratedbloodviolenceone word titlesequelflashbackdogsex scenefightdancingtitle spoken by characterexplosionknifesurprise ending …firecell phonetitle directed by femalebeatingcorpsefistfighthorsecar accidentshotgunrescueslow motion scenepunched in the facewatching tvbattleswordbrawlsecretpaintingbookbased on comicshowdownrifleheld at gunpointhand to hand combatsunglassesbirthdaycar crashislandfightingcombatgood versus evilbased on comic bookambushaxevideo cameramontagebridgeimpalementstabbed to deathmixed martial artsstabbed in the chestweaponmapanti herodrawingfictional wardouble crossbirthday partyspaceshipunderwater scenecontroversycreaturenews reporttransformationflash forwardattempted murderone against manytreelegendbeaten to deathdangerstabbed in the backcostumeprologueattackmissionrace against timestatuekicked in the facetough girllightningopening action scenebraceletscene during end creditsfilm within a filmexploding bodypremarital sexreunioncharacter says i love yougardenfireworkslove interestgay couplesubtitled scenebattlefieldpowerstylized violencepizzabirthday cakedisastericetv newstraitorlgbtdestructionburned aliverevelationflyingspearheroinequestcatfightcomic bookcooktemplespacecraftmovie starblockbusteririshrebellionbirthmind controllasercompassionburialaction heroinegoatiraqmoralityearthquakeindianeaten alivemexicanfemale warriormechanicseriesshieldcameofloodbombingbraveryteamfight to the deathdual wieldinventormercilessnesspower outagemuteimmortalityensemble castscene after end creditsmarvel comicsexploding headsunfilm setwisecrack humorsuperheroinehologramtitle at the endboyfriendexistentialismburned to deathsign languagetelekinesisdaggermoral dilemmateleportationsurprise after end creditsfast motion sceneheroismenergyinvisibilitypresentextraterrestrialillusionsidekicklevitationfinal showdownset upfemale fightersuper strengthgiant monstercomiccomic relieffarmhouseatomic bombcrownsuper powerslaundromattornadolavaart filmvaletfilm starts with textartifactdiversitytentaclebitten in the neckpiesuperhero teamrio de janeiro brazilbollywoodleaderconsciencesaving the worldgoblinsuper powerfinal battlecapeteamworktreacherycamcorderpart computer animationcomicsmumbai indiasuperhuman strengthexploding housewoman fights a manreference to star warsimmortalshapeshiftingcamera phonecaveman10 year oldgodsorceresstsunamihappy birthday to youprivate jetcockney accentone woman armypsychotronic filmreference to supermanreference to charles darwinreference to batmanbakingnew agedreadlocksforce fieldanti heroinebilingualismalien creatureprotectionrainforestalien raceminimalismregenerationearth viewed from spaceepic battlescottish accentsmartphonehumanflintlock riflehumanityslow motion action scenedealdecoydocumentary filmmakerdeaf muteleadershipmushroom cloudarchaeologistsurprise during end creditshuman alienmutinysuper speedlearning the truthillusionistmatriarchsuperhumanempathymonstersstorytellerdouble decker busfuneral pyresequel mentioned during end creditshiroshima japanvolcanic eruptionfungiant creaturebanned filmbiblical referenceorbmagical swordnumberseedspit takeancientcosmosmarvel entertainmentheroesprotectorgreen bloodmarvel cinematic universespherecomic book artistlovers reunitedsurrogate familyaround the worlderased memoryfighting in the airhealing powerreference to peter pansecret revealedsouth dakotacostumed heroexcaliburlondon eyemulti ethniclovecraftianpushed from heightgauntletgiant waveindian oceanhiroshimareference to harry houdinisteam enginesuperhuman speedhuman rights abuseamazon rainforestancient worldflying superherolivingethnic diversitylaser visionmesopotamiababylonheat visionpiccadilly circus londonringtoneplowsuperbehind the cameraaztecdeaf girlflower petalabsorbing powerpushed off a cliffshapeshiftersuccessorreference to ikeacosmicrapid healingreference to king arthurvideographerreference to icarusunder attackfemale leaderreference to captain americababylon babyloniacreation storymute personnegativepresent dayreference to clark kenttenancient artifactopening credits1520sinterferencereference to iron manancient alienpost credits scenesuperhero versus superheroartificial lifeformreference to h.g. wellsmexican womanmelting glacierhusband husband relationshipbaking a piefixing a bicycleflying creatureflying through spaceracial diversityreference to athenashared universe (See All) |
Hellboy comes to England, where he must defeat Nimue, Merlin's consort and the Blood Queen. But their battle will bring about the end of the world, a fate he desperately tries to turn away.
Subgenre: | martial artsblack comedysuperherosupernaturalabsurdismsword and sorcerydark fantasysword and fantasysupernatural horrormedieval fantasy |
Themes: | magicmurderdeathfriendshiprevengesurrealismbetrayalghostdrinkingfeardrunkennessescapemonsterherodeception …militarybrutalitysupernatural powerwrestlingevilexploitationapocalypseblindnesscouragedevilnear death experience (See All) |
Mood: | goredarkness |
Locations: | cavebarbeachchurchforesthelicoptercemeterylondon englandelevatorwoodsapartmentpolice carenglandabandoned factory |
Characters: | warriorfather son relationshippolicezombiesoldierphotographerbabyhostagetough guyvampireaction heroprofessorwitch |
Period: | world war two1990s1940s2010s20th century21st centuryyear 1944year 1992seeing the future |
Story: | occultmountaincharacter name in titlebloodviolenceone word titlebare breastsflashbackdogbare chested malefightphotographtitle spoken by characterexplosionknife …chasesurprise endingpistolfirevoice over narrationcell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunhorseshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewatching tvcamerabattleswordgunfightbrawlvomitingbased on comicshowdownrifleheld at gunpointhand to hand combatrock musicinterrogationdemonhallucinationislandrevolverriveralcoholcombatshot in the backf wordsubjective cameradecapitationgood versus evilcleavageorphanflashlightbased on comic bookambushmassacreambulancemansionmontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestexploding carsevered headanti herofictional wardouble crossritualunderwater scenecreaturevanfemme fatalegraveyardnews reportnecklacetransformationshot in the foreheadbartenderflash forwardattempted murderone against manytreecursecharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologueelectrocutionattackfantasy sequencepoisonmissionproduct placementdragonrace against timekicked in the facetough girlopening action sceneskeletonscene during end creditslong takemanipulationscarinjectionexploding bodyhorse ridingreunionmercenarysevered armprofanitypsychicqueendismembermentsubtitled scenesplatterbattlefieldstylized violencemachismoidentitydestinydestructionbulletburned alivespeargothicheavy rainlooking at oneself in a mirrortalking animalhelmetcrucifixhunterbeardkicked in the stomachwitchcraftassaultvillainessswat teamgiantsevered handclubirishskullknighttorchfatemonkaction heroinebreakfastcrushed to deathback from the deadrealitymasked manapartment buildingeaten alivemexicanfemale warriorfull moongas maskanthropomorphismrampagereverse footagehaunted by the pastvisionbraveryinvasionfight to the deathstabbed in the throatscotlandsonmercilessnesschaosstabbed in the neckresurrectionshot in the facebroken glassevacuationsuper villainwizardprophecyimmortalitystabbed in the headfather figureblack and white scenespecial forcesstabbed in the legscene after end creditsexploding headpunched in the chestdark herosuperstitiondrunkmedieval timeswisecrack humorshadowhealingeye gougingbulletproof vestdisfigurementraidstabbed in the eyecanedark pastbody countmutationsevered legfortune tellerblack magicburned to deathgovernment agenttelekinesiswrestlerholding handsmoral dilemmasurprise after end creditspostertorso cut in halftext messagingdesert eagleblood on camera lensface maskfinal showdownburied alivearmored carsuper strengthgiant monstersuit and tieworld dominationsecret societyreference to the beatlesstabbed in the armfish tankbearded manfantasy worldsawed off shotgunone lineroffscreen killingmale protagonistpearl necklacefemale villainsaving the worlddisembodied headmercedes benzfinal battleevil womanextreme violencepart computer animationgraphic violencereference to twittercommando raidopen endedfur coatsome scenes in black and whitesuperhuman strengthshape shifterstabbed in the facetragic pastwoman fights a manbloody violencetongue in cheekcockney accentpsychotronic filmtommy gunsecret passagebroken neckanti heroinegrindhouse filmbody parthead ripped offdrinking from a bottletarot carddrinking alcoholthird reichrolls royceparallel worlddecomposing bodysurprise during end creditswrestling matchcrystal ballreference to winston churchillsecret doorwoman punches a manfire fighthidden doorbrass knuckleswrestling ringflesh eatinggiant creaturerebootmagical swordhuman skulltijuana mexicoscarred facemidnight moviepulp fictionlucha librefallen angeltroubled productionover the topsecret laboratorygory violenceevil queenvintage carhealing powerreference to alice in wonderlanddark horse comicsuh 60 blackhawk helicopterenglish countrysideshape shiftingarthurian legenddrunk mannazi occultismhalf humanmp 40 machine guntower bridge londondark agesreanimated corpsesecret government organizationripped in halfsecret headquartershuman brandinghousing estatefish and chipsflaming swordself injectionsequel baitingfight scenenazi hunterparallel dimensionrapid healingchannel surfingdisplay casegray hairopening creditssecret entrancewalking with a cane6th centuryapartment blocksword in stonedestroyed bridgeimpaled through eyesaving the world missionsecret chambersuperhero origintongue ripped outglass ballgun hidden under tableman's best friendreference to humpty dumptyamerican actress playing british characterface to facelong haired womanwoman with long hairmonster hunter (See All) |
The third Highlander movie takes place at 1994, which means it's a prequel of the second film. After the death of his beloved wife Heather some centuries ago, Connor MacLeod left the highlands of Scotland and wandered around the world. Finally, he got to Japan, where he met the famous sorcerer Nakan …o, who was an Immortal too. Soon, they became friends, and Nakano taught Conor some tricks. But one day, an old enemy, Kane, came to Japan willing to find Nakano's cave and kill him. Although he succeeded, after cutting Nakano's head the mountain collapsed and Kane was trapped. Now, centuries after, an excavation reveals Nakano's cave... (Read More)
Subgenre: | cult filmsword and sorcerydark fantasyswashbucklersword and fantasy |
Themes: | magickidnappingherosupernatural powersamurai |
Mood: | gore |
Locations: | cavevillagejapan |
Characters: | warriorboyfriend girlfriend relationshiptough guyaction herosamurai warrior |
Period: | 1990s |
Story: | swordsmanmountainsexfemale nuditybloodviolencesequelfemale frontal nuditybare chested malekissfemale rear nuditynipplesfirewoman on top …blood splatterhorseblondeswordcombatdecapitationgood versus evilsword fightnew yorkmixed martial artsanti herodisarming someonefictional warthird parttrainingduellightningkissing while having sexarsonbattlefieldkatana swordimmortalitymentordark herosword duelsequel to cult favoriteillusionkatanakendofencingsorcerermoroccoadopted sondisembodied headhead cut offimmortalbagpipesguillotinementor protege relationshiparchaeologistsliced in twoanvillong swordhighlandertrapped in a cave (See All) |
A barbarian named Kull unexpectedly becomes a king after an old king (whom Kull has just killed in a battle) gives his crown to him. But direct heirs of a killed king, trying to topple Kull and regain the throne, bring an old witch-queen Akivasha back to life. Their plan backfires, however, as Akiva …sha is going to allow their lords - demons - to rule the kingdom. The only thing that can stop her now is a breath of the god Volka. (Read More)
Subgenre: | martial artssword and sorcerysword and fantasy |
Themes: | murderbetrayalweddingseductionwrestling |
Locations: | castle |
Characters: | warriorhusband wife relationshiptough guy |
Story: | sorcerybarbarianswordsmansexfemale nuditycharacter name in titlemale nudityviolencekissknifefistfightbattleswordbrawlshowdown …hand to hand combatdemoncombatkung fusword fightambushstabbed in the chestbrunetteone man armykingduelone against manytough girlkissing while having sexwhippingbare chested male bondagequeenbattlefieldtraitordestinyspearwitchcraftshieldsword dueldaggerstrongmanfemale villainsword and sandalsorceressstaffarms tied overheadaxe fightbattle axeevil queenevil wizardgreco roman wrestlingpeplumplanetary alignmentrobert e. howardbased on pulp magazine (See All) |
With an entirely new set of actors, this movie continues the story from Swordsman (1990). Blademaster and his martial arts school decide to retire to a distant mountain. Before leaving, he visits his friends, a tribe of snake-wielding women warriors. He finds that they have been attacked, and their …leader, Princess Yin-Yin, toward whom he has some romantic feelings, has been abducted. The attacker is her evil uncle Fong, who years before overthrew Yin-Yin's father and took over their sect. Fong also has possession of a sacred scroll which tells how to achieve ultimate martial arts power. Blademaster decides to help Yin-Yin and her imprisoned father, and his romantic complications deepen when his childhood chum and Yin-Yin are joined by a new rival. Blademaster thinks she is an innocent village girl he has saved, but in fact she is Fong! The process of gaining ultimate martial arts power requires self- castration and transmogrification into female form. (Read More)
Subgenre: | martial artscult filmtragedywuxia |
Themes: | betrayalherotransgender |
Characters: | warriortranssexualaction hero |
Story: | warrior womanwarriorsswordsmanmountainbased on novelviolencesequelbased on bookfistfightswordbrawlshowdownkung fugood versus evilsword fight …mixed martial artsdisarming someoneduelmartial artiststylized violencemartial arts masterheroineaction heroinefemale warriorkatana swordsword duelkung fu fightingkendokung fu classickung fu masterfemale fightersex changebrotherhoodwu shudojotragic villainwing chunmessiahhapkidowire fuactress playing male rolewuxia fictionswordswoman (See All) |
Spain in the 1930s is the place to be for a man of action like Robert Jordan. There is a civil war going on and Jordan who has joined up on the side that appeals most to idealists of that era -- like Ernest Hemingway and his friends -- has been given a high-risk assignment up in the mountains. He aw …aits the right time to blow up a bridge in a cave. Pilar, who is in charge there, has an ability to foretell the future. And so that night she encourages Maria, a young girl ravaged by enemy soldiers, to join Jordan who has decided to spend the night under the stars. (Read More)
Subgenre: | epic |
Themes: | murderdeathmarriagerapeescapeself sacrifice |
Mood: | night |
Locations: | cave |
Characters: | boyfriend girlfriend relationshiptough guyamerican abroad |
Period: | 1930s |
Story: | mountainbased on novelviolencekissexplosionchasepistolshootouthorsebattlegunfightriflerevolverambushbridge …passionopening action scenecountrysidegeneralcivil wartraitorblockbustergypsyswitchbladebombingexplosivespanishattractionpeasantwar violencefascistmercy killingvolunteerspanish civil warstar crossed loverscavalryfreedom fighterguerrilladuplicitybolt action riflepolitical unrestabsinthepatrolguerrilla warfareloyalist (See All) |
In a post apocalyptic future that appears as a blend of World War II Europe and J.R.R. Tolkien's Middle-earth, a pint-size wizard named Avatar must save the world from a band of fascist mutants controlled by his evil twin brother, Blackwolf, who likes to confuse enemy armies by projecting films of A …dolf Hitler speeches during attacks. Painted live-action footage of advancing Nazi armies contrasts with Saturday-morning-cartoon-style animation of fairies and elves as Avatar travels through various magical and radioactive realms on his quest. Aiding him are the beautiful Fairy princess Elinore, hot-blooded warrior elf Weehawk, and Peace, a misunderstood robot rebelling against his Blackwolf-controlled programming. A bizarre and psychedelic meditation on magic vs. technology, this ultimate futuristic fantastic epic cult film still finds an audience on college campuses and will prove quite rewarding to viewers in the right frame of mind. (Read More)
Subgenre: | epicindependent filmcult filmpost apocalypsesword and sorcery2d animationadult animation |
Themes: | magicsurrealismterrorismend of mankind |
Mood: | goresatire |
Locations: | future earth |
Characters: | warriorboyfriend girlfriend relationshipprostitutehitmanalcoholichomeless man |
Period: | world war twofuture |
Story: | violencesurprise endingmachine gunlow budget filmrobotgood versus evilcleavageassassinsword fightterroristmassacreimpalementfictional warstabbed in the back …actor playing multiple rolesrace against timetwincult directorblood spatterelectronic music scorepropagandamutantbeardsocial commentaryfairywizardblack bradrunksexy womanenvironmental issueselfactress playing multiple rolessidekickswastikastock footagejazz musicjukeboxcomic relieftwin brotherfriends who live togethergoblinnuclear warsmall breastsoutlaw gangassassination plotberetvillain turns goodfat womanevil twindark futuretorturerrotoscopingconcubinedistant futurephantommultiple cameosoutrunning explosionmanmade environmental disasterpolitical commentaryballadeerscotchhired gunwraithstorm trooperevil robotanti nazinymphtechnocracyright hand mangang that lives togethermassive breastspsychadelic imageprimitivismstrapless dresswizards' duelknit cap (See All) |
The wandering barbarian, Conan, alongside his goofy rogue pal, Malak, are tasked with escorting Queen Taramis' virgin niece, Princess Jehnna and her bodyguard, Bombaata, to a mystical island fortress. They must retrieve a magical crystal that will help them procure the horn that legends say can awak …en the god of dreams, Dagoth. Along the way, Conan reunites with the wise wizard, Akiro and befriends the fierce female fighter, Zula. Together the heroes face ancient traps, powerful Wizards, plots of betrayal, and even the dream god, Dagoth, himself! (Read More)
Subgenre: | independent filmmartial artscult filmsword and sorcerydark fantasyalternate historysword and fantasy |
Themes: | murdermonsterherowrestling |
Locations: | desertcastle |
Characters: | warriorthieftough guyaction heroaunt niece relationship |
Period: | 1980s20th centuryyear 1984 |
Story: | adventure herobarbarianswordsmancharacter name in titlebloodviolencesequelbare chested malebeatingblood splatterfistfighthorsemirrorblonderescue …punched in the facebrawlshowdownhand to hand combatcombatsword fightambushname in titlethroat slittingmixed martial artsstabbed in the chestsevered headcultanti herodisarming someoneone man armyprincesstransformationvirginkeystatueopening action scenewaterfallqueenbattlefielddestinyhead buttspearmagicianstabbed in the stomachkicked in the stomachback from the deadchokingfemale warriorguardreverse footagedual wieldhit in the crotchwizardknife throwingkingdommutationsword duelsequel to cult favoritedaggerstick fightcamelspittingkendohuman sacrificesword fightingsword and sandalprehistoric timeschosen onestaffbeefcakekicked in the groinhorse chasesevered earaxe fighthornbreaking glasslast of seriesgodsasian manstone agespear throwingrenegadejapanese manfoolflying kickscratchchoke holdtwentieth centuryaxe throwingstabbed with a spearstatue comes to lifehall of mirrorsvirgin sacrificerobert e. howardbased on pulp magazinestabbed with knifeenchanted forestplainsfalse promisescratching someone's facepaleolithic agebody slamstabbed with a stickman versus beastwizards' duel10000 b.c.100th century b.c.grabhyborian agebear hugbloody scratches (See All) |
Young Mary Katherine (M.K.) returns to her eccentric scientist father's home, but his all-consuming quest to discover a tiny civilization in the neighboring forest drives them apart. However, M.K. soon finds herself shrunken down by Queen Tara of that forest who was mortally wounded by the putrefyin …g Boggans, and charged to deliver a pod bearing the new Queen to safety. Together with a veteran Leafman warrior, two goofy mollusks and a young maverick, M.K. agrees to help. As the villainous Boggan leader, Mandrake closes in, M.K. and her new friends must draw on the best of themselves together and discover what they have to save their world. (Read More)
Subgenre: | epicmartial artscgi animationsword and fantasy |
Themes: | magicfriendshipescape |
Locations: | foresttaxi |
Characters: | warriorfather daughter relationshipteenage girlfemale protagonistsamurai swordself doubt |
Story: | swordsmandogkisschasebased on bookrescuebattleswordbrawlshowdownhand to hand combatsciencescientistgood versus evilsword fight …ambushvideo cameraarmyno opening creditsbirdfictional warsearchdueltreeloss of motherlove interestqueenmoonbow and arrowtalking animalquesthelmetloss of friendmousefull moonsurveillance cameraloss of son3 dimensionaldeerarmorsiegeplantbatdoubtparkourshot with an arrowno title at beginningfantasy worldpunfinal battlesole black character dies clichewoman shotsnailstaffjumpminiaturizationipodsaddlesurprise attackdecaymild violenceminiature personslugmoonlightsudden change in sizedeath of queenfruit flyparchmentbat the animalbud (See All) |
Whilst crossing a ledge, 4000 feet above the earth, Gabe's friend's equipment fails to work and she slips out of his hand, falling to the ground. Almost a year later, Gabe is asked to go back to the same mountain range and rescue a group of 'stranded' people. The only catch is that these so called ' …stranded' people are in fact looking for three boxes filled with $100,000,000 and they need a mountain ranger to lead them to them!! (Read More)
Subgenre: | martial artscult filmsuspensetragedyheist |
Themes: | revengemoneyheropsychopathterrorismredemptionwildernessunlikely hero |
Mood: | night |
Locations: | cavehelicoptersnowcampfireairplane accident |
Characters: | warriortough guyaction herovillain |
Period: | 1990swinter |
Story: | mountainbloodviolenceone word titlechasepistolshootoutblood splatterfistfightmachine gunshotgunslow motion scenegunfightbrawlshowdown …hand to hand combatbombbritishgood versus evilfoot chaseterroristmixed martial artsweapondisarming someoneone man armyon the runone against manysuitcaseevil manrabbitdie hard scenariosemiautomatic pistolhenchmanmachismosociopathlifting someone into the airloss of loved onevillainessblockbusterdamsel in distressaviationmurder of a childterrorist plotdeath of loved oneexploding helicoptergovernment agentbatdesert eagleterrorist grouptimebombclimbinghelicopter crashcriminal gangtyrantmountain climbingexploding airplanenight vision gogglesmoney falling through the airc4 explosiveslootcold weatherhero kills a womanburning moneycliffhangerrocky mountainsinfra redairplane hijackfrostbitebase jumpingmountain climbersnowy landscapeacrophobiagunned downharnesshoming devicethousand dollar billitalian alpsmid air transferbomb onboard planeex cia (See All) |
In ancient China, before the reign of the first emperor, warring factions throughout the Six Kingdoms plot to assassinate the most powerful ruler, Qin. When a minor official defeats Qin's three principal enemies, he is summoned to the palace to tell Qin the story of his surprising victory.
Subgenre: | epicmartial artschrist allegorywuxia |
Themes: | lovefriendshipsurrealismsuicideinfidelitybetrayaljealousyfuneralherodeceptionredemptionexecutionhopevengeancecourage …self sacrifice (See All) |
Locations: | schooldesertlakechina |
Characters: | warriortough guyaction hero |
Story: | warrior womanswordsmanbloodviolenceflashbackmale rear nuditybare chested malefightsurprise endingvoice over narrationshot in the chestshot in the headslow motion scenebattlesword …showdownhand to hand combatfightingcombatorphanassassincandlesword fightarmystabbed in the chestone man armyritualkingshot in the legtrainingduelone against manylibrarylegendstabbed in the backkicked in the facepremarital sexstylized violenceflyingspearassassination attempttold in flashbackfaked deathhonorcompassionchop sockyfemale killersocial commentarydeath of protagonistrainstormsword dueltragic heroarrowmain character diespalacefemale assassinheroismlocal blockbusterlost lovetrue lovearcheryidealismfilm starts with textheritagetyrantkindnessresponsibilityrespectredescorttragic lovegreendeath of title characterpatriotundressing someoneflashback within a flashbackman with no namewu shurewardbluemale full back nuditynameless charactercalligraphywuxia fictionancient chinaunreliable narratordouble impalementwalking on waterbody searchunreliable flashbackunreliable narrationthrone roomcolor motif (See All) |
In AD 922, Arab courtier Ahmad Ibn Fadlan accompanies a party of Vikings to the barbaric North. Ibn Fadlan is appalled by the Vikings customs-- their wanton sexuality, their disregard for cleanliness, their cold-blooded human sacrifices. And then he learns the horrifying truth: he has been enlisted …to combat a terror that slaughters the Vikings and devours their flesh. (Read More)
Subgenre: | epiccult filmsword and sorceryfish out of waterswashbucklerrevisioniststonepunk |
Themes: | murderdeathlovereligiondrinkingfearfuneraldeceptiontravelsupernatural powercannibalismmurder of brothernorse mythology |
Mood: | gorerain |
Locations: | caveforestboatwoodscampfire |
Characters: | warriorfamily relationshipsfather son relationshipmother son relationshiptattooboyreference to godfacial tattoo |
Story: | barbarianbased on novelnumber in titlebloodviolencedogfightthree word titlefirevoice over narrationcorpsehorsedrinkbattlesword …vomitinghand to hand combatdead bodydemoncombatswimminggood versus evilsword fightaxesnakesevered headfictional warunderwater scenekingcreaturelegendpoisonmissiontenthangingdeath of brotherhorse ridingwaterfallsevered armpoetbearsleepingcowdismembermentbattlefieldprincebow and arrowspearhelmetmutilationsevered handskulltorchshieldinvasioncannibalexilearabeye patchkingdomfortune tellerdaggerfast motion scenecameltranslatorprayinggreekcremationalarmvikingdigginglanguage barrierambassadorrespectsword and sandalheirperfumefacial scarmiddle agesprophetdiplomatfleeingshot with a bow and arrowretreatbanishmentnoblemanflaming arrowhoneybonesadaptation directed by original authorreference to allahsword and shieldangel of deathgonghordemarauderancient times10th centurybeowulfends with funeralirish wolfhoundvisceralcannibal cultflying debrisviking shipodinviking funeralblowing one's nosemohammadvalhallapaupercaliphwashing one's handsarabian horseseastorm (See All) |
Loc nar is tricked and set up to take the fall of the queen he set out to love and it would have worked if he would of listened to only his heart he saw the betrayal before it ever came and he made documents and took pictures voice recording videos all without ever being noticed so when the plan was … set all the proof would put them away no matter the evidence planted . But because of his big heart he had to play it to the end and hurt from the woman he loved the most Betrayal. (Read More)
Subgenre: | cult filmblack comedy2d animationslapstickadult animation |
Themes: | murdersurrealismmarriagebetrayaldrug useabductionalien abduction |
Mood: | goresatire |
Locations: | new york citytaxitaxi driverspace station |
Characters: | warriorteenage boyzombiegirlaliensecretaryrobot human relationship |
Period: | future |
Story: | sorceryheavy metalnudityfemale nudityf ratedbloodviolencefemale frontal nuditysex scenechasevoice over narrationswordbased on comicrock music …robotdecapitationgood versus evilbased on comic bookmassacretrialanti heroanthologytransformationpilotactor playing multiple rolesrock 'n' rollobscene finger gestureufochild murdersexual fantasyspacecraftaccidental deathsadomasochisms&mfemale warriorcynicismalternate realityextraterrestrialmysticismepisodic structurehuman sacrificebloody body of childbomberarcheologisttitle same as bookflying saucerpentagoninvulnerabilitydark heroineflying carmidnight movierotoscopinggreen bloodspheresex with robotanimated nudityradical transformationsegmentsmixed marriagecanadian science fictionfemale whippingmale alienmuscle growthdeath rayimpaled childsaving the world missionwoman disintegrated (See All) |
A high energy, high concept, stylish action epic set in the Norse world sees a passionate young man transform into a brutal warrior as he travels the unforgiving British landscape in search of his long lost brother Hakan The Ferrocious who his people are relying on to restore order to their kingdom …following the bloody death of their king. (Read More)
Subgenre: | epic |
Locations: | cave |
Characters: | warrior |
Story: | high conceptbare chested maleswordgay slurhorse ridingthunderstormsuperstitionvikinghanging upside downman punching a womanbattle axetied to a postheir to the thronenorse godsaxon …stop action (See All) |
A demon who seeks to create eternal night by destroying the last of the unicorns and marrying a fairy princess is opposed by the forest boy Jack and his elven allies in this magical fantasy. Two different versions of this picture feature soundtracks by either Tangerine Dream or Jerry Goldsmith.
Subgenre: | cult filmfairy talesword and sorcerydark fantasyswashbucklersword and fantasychrist allegory |
Themes: | mythologymagicbetrayalmonsterheroseductiondevil |
Mood: | night |
Characters: | warriorboyfriend girlfriend relationship |
Story: | adventure herosurprise endingfirerescueswordshowdowndemoncombatdecapitationgood versus evilsword fightdisarming someonefictional warprincessduel …missionbow and arrowgothiclifting someone into the airsexual desireshieldreference to satansword duelblack magicelfbrainwashingtemptationbeastsorcererunderworldsword and sandalgoblinunicornshot with a bow and arrowparadiseevil godlifting a male into the aircomfortd box motion codeseductive dancespiritual redemption (See All) |