Please wait - finding best movies...
After a mammoth cruise ship sails over the site of the Titanic’s disaster, dark and deadly events start to occur on board. As the ship’s captain investigate the tragic occurrences, it becomes clear that the passengers from the original Titanic have returned.
| Subgenre: | supernatural thriller |
| Themes: | escapeghostmurder |
| Locations: | ship |
| Characters: | witch |
| Story: | security agentcruise shipjump cuthigh securityshark attackrich and famousmaiden voyagequeen marytoneevil winssurprise visitrelicsthroat slashedspoofingalive …annihilationdeadlyleavingtentaclessinkingboardin lawtragicinfernoover the toplocksmith666sister in lawfrozenfunghoststitanicjumpcruisebarrelscarecrowhusbandsecuritydeaftripasylumcgipsychoagentcaptainattackdrowningritualnew yorkdecapitationblood splattershowerfemale rear nudityfemale nudity (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | independent filmcult filmpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
| Themes: | escapemurderdeathrevengemonsterpsychopathsupernatural powerevildrug addictionmurder of a police officer |
| Mood: | gorerainhigh schoolslasher |
| Locations: | new york cityboatwoodsseacityamericasewer |
| Characters: | teenage girlteenage boyzombiepolice officerserial killerkillervillainteacher student relationshipterrorslasher killermysterious villainserial murderer |
| Period: | 1980s |
| Story: | cruise shipcruisepsychodrowningnew yorkdecapitationblood splatterfemale nuditycharacter name in titlenumber in titlebloodviolencesequelbare chested maleexplosion …pantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york cityflashlightgangstrangulationaxevideo camerastabbingthroat slittingimpalementstabbed to deathsubwaywhite pantiesexploding carnecklaceon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyebody countcharacters killed one by onesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
A young nurse is kidnapped by a group of violent teens who escape from a mental hospital and take her on the road trip from hell. Pursued by an equally deranged lawman out for revenge, one of the teens is destined for tragedy and horrors that will destroy his mind, moulding him into a monster named …Leatherface. (Read More)
| Subgenre: | suspenseteen horroramerican horrorslasher horror |
| Themes: | escapemurderdeathrevengekidnappingfeartortureangerpsychopathbrutalitydysfunctional familyinsanitymental illnesssadismexploitation …hopecrueltypaniccannibalismrape and murder (See All) |
| Mood: | gorecar chaseslasherdarkness |
| Locations: | hospitalforestwoodsrural settingwheelchairfarmpolice carroad triptexasbackwoodsback country |
| Characters: | family relationshipspolicemother son relationshipboyteenage girlserial killernursekillervillainsheriffpolice chasesuicide by hangingslasher killerthe familyevil mother |
| Period: | 1950syear 1965 |
| Story: | over the toptripasylumritualdecapitationblood splatterfemale rear nudityfemale nuditybloodviolenceone word titlebare breastsbare chested male …gunsex scenebeatingcorpseshot to deathcar accidenturinationshot in the headshotgunpunched in the facemaskheld at gunpointcar crashdead bodyhandcuffsrevolverf wordsurvivalfoot chasebound and gaggedaxestabbingimpalementdinertied to a chairsevered headradiobirthday partypolice officer killedvanon the runflash forwardbeaten to deathcostumescreamingon the roadkicked in the facescreamskeletoncountrysidepigtrapschoolgirlrattied upcowdismembermentkillingmaniacriotpickup truckchainsawbirthday cakesociopathscene during opening creditsragemutilationbarnoverallshammersevered handcovered in bloodorphanagecrushed to deatheaten alivemental institutionredneckpump action shotgunwoman in jeopardydamsel in distressseriesgrandfatherstabbed in the throatcannibalmanhuntgunshot woundmental hospitalplot twistbribethrown through a windowbooby traplipstickdisfigurementinsulttrailerfamily dinnerchainkilling spreeprequelstolen carserial murderpsychopathic killerbeheadingnew jobface masknecrophiliabirthday presentkilldead animalabandonmenttrailer homedouble barreled shotguninsane asylumscalpeldeputycrushed headshot point blankhanged manoverweightpsychiatric hospitalspitstar crossed loversextreme violencedisfigured facegraphic violencefacial scarsixth partwoman shotmasked villainhit with a hammerfamily homeroadpsychotronic filmretributiongrudgeburn victimmurder spreebutcherygrindhouse filmbludgeoningextreme close upexploitation filmcrime spreecaptivityamerican southinitiationknife in the chestfalling through the floorbear trapsexual intercoursedecomposing bodyfranchisedinner tableyoungbritish actor playing american characterenginereference to frankensteinfemale nursepolice vigilantismmobile homehuman skullloss of innocencebaitrangerscreaming in horrorhorror iconanimal trapmentalteenagehuman skeletonpolice officer stabbedtwo directorsyear 1955texas rangerfat boyescapeeparaphiliastitchesstolen police caroverturned carpsychiatric patientcarcasskilled with a hammermama's boyorigin storyblowing out candles on a birthday cakehorror filmpig maskgroup of teenagersshot by the policefalling into a holebeheadedclassichorror movie prequelhead crushinganimal maskelectroconvulsive therapyspitting in someone's facethrown out a windowteenage killerhuman boneinsane manmad familystitching a wounddark forestdisturbed personcar engineextreme crueltywearing human skinanimal carcassdragged along the groundfemale captiveslapped in the facehit on the head with a hammer2017animal skeletoneffectfamily matriarchstrongwork of artpolice officer stabbed in the backcovered with bloodmental disabilitycannibal familyhitting a policemanpolice car rolloverdeath by chainsawevil familygirl in jeopardyhorror movierotten corpse (See All) |
A darkness swirls at the center of a world-renowned dance company, one that will engulf the troupe's artistic director, an ambitious young dancer and a grieving psychotherapist. Some will succumb to the nightmare, others will finally wake up.
| Subgenre: | supernatural thrillerindependent filmsuspenseconspiracysupernaturalparanormal phenomenapsychological dramadark fantasyart horrorbody horrorsupernatural horrorpsychological horrorcult horror |
| Themes: | escapeghostmurderdeathrevengesurrealismsuicidekidnappingreligionmoneypoliticsfeartorturedancemonster …investigationdeceptionmagicmemorybrutalitysupernatural powerterrorismredemptionguiltinsanitydatinghumiliationsadismevilcrueltypanicnear death experienceregretmysterious deathgerman politicsdying motherdance ritualdance student (See All) |
| Mood: | gorerainbehind the scenesnightmarenightarchive footageavant gardedarknesshorror movie remakemurder plotatmosphereblood and goreritual murderslow burn |
| Locations: | restauranttrainschooltaxirural settingkitchenapartmentpolice stationfarmtrain station |
| Characters: | witchhusband wife relationshippolicemother daughter relationshipdoctorsingerteenage girlfemale protagonistteacherpolice officerdetectivedancerhostagemother …police detectiveteacher student relationshippsychiatristmaidterrorrussianfrenchgermanamerican abroadself mutilationdance teacherevil witch (See All) |
| Period: | 1970syear 1943year 1977 |
| Story: | jumpritualdecapitationblood splatterfemale rear nudityfemale nudityf ratednuditybloodmale nudityviolenceone word titlefemale frontal nudityflashback …male frontal nuditymasturbationmale rear nuditygunkissfemale full frontal nuditycigarette smokingdancingphotographmale full frontal nudityexplosionsingingknifelesbian kisssurprise endingpistoltelephone callfiretopless female nuditycryingsongdreamcorpsefoodhorsemirrorurinationremakerescueslow motion scenewatching tvsecretshowdownliesunglassesbombrunningcafebathroomcollegedemonhallucinationtelephonef wordsubjective cameragood versus evilsurvivalnewspaperwineambushold manstabbingmontagethroat slittingbridgeeatingimpalementstabbed to deathtoiletstabbed in the chestfemale pubic hairsubwaymapapologyculttrialradiodisarming someonedrawingdouble crosssearchnews reportold womanpaintrainingflash forwardcursebeaten to deathdangerstabbed in the backprologuescreamingprotestwidowerumbrellaauditionpossessionrace against timesuitcasemissing personcover upcollege studentlightningscreamfarmerdiarylong takemanipulationdisappearancetragic eventexploding bodywitnessdarkhauntingsuspicionballettypewritergraffitisubtitled sceneberlin germanyriotpickup truckeyeglassesocculteavesdroppingtv newsdestinydestructionrevelationnipples visible through clothingelectronic music scoregothicheavy rainlooking at oneself in a mirrorlistening to musictape recorderscene during opening creditscomamutilationdemonstrationexploding buildingwitchcraftpsychologydesperationcovered in bloodmind controlcrying mandead womanbroken leghomicideambitionchokingpassporthaircutrampagebarefootwoman in jeopardydamsel in distresscameohaunted by the pastface paintsufferingcouchhypocrisyblood on faceintrigueconfrontationstabbed in the throatbackstagemercilessnessstabbed in the neckdeath threatplot twisttitle appears in writingdespairdelusionimmortalityescape attemptmentorsculpturearchival footagestabbed in the legscene after end creditsexploding headrivallaughterdisembowelmentshadowsoultitle at the endboarding schoolrainstormslaughterwedding ringdark pastdressing roombarefoot femalebody countpastorbroken armroombruisekilling spreeblack magicpajamastelekinesisbloodbathnewspaper clippingholding handspipe smokingsurprise after end creditsmedia coveragesintelepathydead girlfemale female kissactress playing multiple rolesgothdormitorypost world war twoblood on camera lensintestinesserial murderprayinghysterialiving deadlevitationfinal showdownapparitionbodydark secrettractorohioscene before opening creditsspiral staircasemetaphorsubway stationjournalstairwayevil spirithuman sacrificechoreographyfriendship between womencorporal punishmentdiscoveryabandoned houseborder crossingperformerfarmhousewallstabbed in the armsatanismbroken mirrorredheaded womanwhisperingyoung womanhearing voicesurinepiercingwetting pantscigarettehand over mouthnihilismballerinamercy killingsoupmissingtesttrain ridetutorchandelierepilogueatrocityschoolteacherseizurehijackingvanityextreme violencemacabrenewscastfemale police officerberlin wallreading a newspapermenacemurderessbloodshedtragic pastoverhead camera shotjumpingchapter headingsdistrustradio newsbloody violencevotinggiallofemale victimmind readingpentagrampsychotronic filmchoreographerkiss on the cheeksecret passagehouse on firescythebonebilingualismrebirthred hairhooksecret roomleg woundsinistertrancecryptrevolving doorhorror artballet dancerpower strugglechantingframed photographmentor protege relationshipspiritualismmissing girlfemale sitting on a toiletsubway trainkeyspolitical protestbloody faceportrait paintingdecomposing bodyenglishwoman abroadspectatoramishcult leaderacademyruthlessnesssong and danceel trainbarefoot womansecret passagewaywatching someoneemaciationbeing watchedmodern dancesweatinglooking in a windowpokiesstabbed with a knifesatanic cultbreakdownred lightsatanic ritualconvulsiondining hallevil powersick motherborder guardscreaming in painfemale star appears nudedance studiofrenchwomaninstructorpitysoundtrackpsychotherapistsubliminal messagewalking in the rainagonyactress playing male rolefiendheavy breathingplayingjarcovenentrailsmatriarchymysterious eventswest berlin west germanyblood on the floorpsionic powersurrogate familypaintbrushschool expulsiondollar billnewsstanderased memorysoul transferencestrange personvaliumeast berlin east germanymeat hookmysterious disappearancemysterious eventrotting corpsec wordfemale corpsefile cabinet40 year oldback in timepessimismspooningaryanyear 1948ritual sacrificedance rehearsalhorror filmsecretsspoken inner thoughtsearthwormdance performancereading in bedurinating in fearmysterious personreanimated corpsereference to frederic chopinreflection in a mirrordark killerill mothernude dancingsmall penisballet schoolexperienceurine samplecatacombssessioncivil unrestairplane hijackingdark powerwitchesbroken bonebroken jawclothes ironfalling to the groundmatronreference to johannes brahmsshushingsupernatural murderturmoiltryoutblindspantingsee through gowndifficulty breathingfracturesadistic torturethroat slitbaader meinhofdance practiceideaunrestcrypticgroaningtransference2015crying teenage girldance auditiondevil worshiperboeing 707dance recitalblood traildance companyprima ballerinasevered spinewitches' covenhaunted schooltriple roleurinating on the floorwhite paintbreaking mirrorcompound fracturedance academynude dancerred army factionchest ripped openlistening to music on a radioreflection in a glass window (See All) |
After discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre ocurrences happen and the group becomes trapped inside the ship, which they soon learn is inhabi …ted by a demonic creature. (Read More)
| Subgenre: | cult filmsuspensesurvival horror |
| Themes: | ghostmurderdeathbetrayaldrunkennessdeceptionangersupernatural powerguiltgreed |
| Mood: | gorerain |
| Locations: | shipbarseaoceanghost ship |
| Characters: | little girllustghost in mirror |
| Period: | 1960syear 1962zip line |
| Story: | cruise shipcruisecaptaindrowningdecapitationblood splatterfemale rear nuditybloodviolencefemale frontal nudityflashbackcigarette smokingphotographtitle spoken by character …explosionpistolcorpseshot to deathmachine gunshot in the chestshot in the headshotgunpunched in the facefalling from heightvomitingheld at gunpointislandsubjective cameraflashlightmassacreambulancedeath of friendwomanthroat slittingimpalementmapsevered headradiochild in perilunderwater scenefemme fatalecigar smokingnecklaceshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firepoisonstorytellingknocked outdeath of childskeletondisappearanceexploding bodyhauntingratsevered armdismembermentchild murderitaliangoldburned alivemass murderlooking at oneself in a mirrorshot in the stomachtreasurebuttocksfemale singersevered handwatching televisionstabbed in the throatstabbed in the legsoulsintorso cut in halfapparitionfemale removes her dressshipwreckburnt faceshot in the eyetavernpoisoningdripping bloodrazor bladescuba divingpassengeraltered version of studio logosole black character dies clichemaggotshape shifterimmortalexploding shipcut into piecessole survivorpool of bloodvillain not really dead clichelocketradarballroomstraight razorballroom dancingexploding boatfalling through the floorc4 explosivessliced in twostabbed in the foothundred dollar billfall to deathlocked inblowtorchmorphingfreak accidentocean linerstartledrock paper scissorssinking shiphead cut in halfshaving headspear gungold barindoor swimming poolrat poisonwoman wearing a red dresssalvagehanged childhung from a hookconstruction cranepile of moneytugboathit with a metal pipeavaricefalling to one's deathrustshell casingchild ghostlogbookdigital watchluxury linerpoisoned foodevil markfall through floorbering straitcan of beansfalling into poolhiding in a freezership collisionbenevolent spirittug boat (See All) |
Frank Zito misses his mother, who was killed in a car accident years before. She was abusive to him, and made money selling her body, but Frank still misses her. He tries to keep her from leaving him, and reform her evil ways, by killing young women and putting their scalps on mannequins which he di …splays around his apartment. Photographer Anna D'Antoni takes a picture of him in the park, and he pursues and befriends her. Is she the one he has been looking for or just another mother wannabe? (Read More)
| Subgenre: | independent filmcult filmexperimental filmb moviepsycho thrilleramerican horrorindependent horrorsadistic horror |
| Themes: | escapemurderdeathchristmaslonelinesspsychopathbrutalitydeath of motherparanoiadepressionsadismevilexploitationclaustrophobia |
| Mood: | gorenightmareslasherblood and gore |
| Locations: | hospitalnew york citybeachrestauranthotelcemeterybathtubcitysex in a carsex in cemetery |
| Characters: | boyfriend girlfriend relationshipprostituteserial killernursephotographerkillervillainterrorslasher killerserial murdererself inflicted injury |
| Period: | 1980s1970swinteryear 1979 |
| Story: | leavingpsychonew yorkdecapitationblood splatterfemale rear nudityfemale nuditysexbloodviolenceone word titlebare chested malecigarette smokingphotograph …surprise endingpistolcorpsecar accidentmirrorshot in the headshotgunslow motion scenevomitingheld at gunpointsunglasseslow budget filmbathroomhallucinationmanhattan new york cityfoot chaseorphanbound and gaggedstrangulationmassacrevideo camerastabbingthroat slittingstabbed to deathstabbed in the chestsubwaychild abusemodeldream sequenceassassinationgraveyardpantyhosenecklaceparkstalkercharacter repeating someone else's dialoguestabbed in the backunderground filmpay phoneevil manstalkingdarkpremarital sexmurdererthreatened with a knifecult directorkillingblood spattersplattermaniacflirtingfemale stockinged legselectronic music scorelooking at oneself in a mirrorragemutilationtied to a bedstabbed in the stomachcovered in bloodgrindhousevictimbrooklyn new york cityschizophreniaapartment buildingrampageswitchbladelow budgetitalian americanbutcherexploding headblood on shirttitle at the endslaughterdark pastlens flaredead motherkilling spreenewspaper clippingchildhood memorymannequinpsycho killerserial murderpsychopathic killerbad guybeheadingmadmanvietnam veteranburied alivehead blown offhuman monstersubway stationhomicidal maniacslashingdouble barreled shotgunhearing voicesbubble bathdruggeddripping bloodshot point blankacrobatfashion modelextreme violencedarkroomdisfigured facegraphic violencehit with a shovelfur coatmurder attemptknife murderlesbian subtextbloody violencedeformityfemale victimstrangled to deathsadistic psychopathpsychotronic filmschizophrenicmurder spreevillain not really dead clichebutcherygrindhouse filmhead ripped offcrime spreecreepcandlelightkilled during sexcut armmultiple homicidepsycho terrorbody torn apartcreepydisturbingtwin towersitalian restaurantscalpingworld trade centerdrive in classicperversitygory violenceeast coastsickorotting corpsenewspaper admutilated bodycentral parkchoked to deathbased on ed geinmonster as victimsadistic killertrapped in a carmanhattanstabbed in stomachinstrument caseeyes wide openabusive childhoodhand from gravemannequin comes to lifehairbrushforehead cutbody in bagkicking a doorjumping onto a carsex with a mannequin (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | suspensesupernaturalparanormalpsycho thriller |
| Themes: | escapeghostmurderdeathsuicidekidnappingmarriagerapeprisonfeartorturememorypsychopathsupernatural powerparanoia …drug useinsanitymental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
| Mood: | gorerainneo noirnightmareslasherdarkness |
| Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoofemale protagonistserial killernursepolicemanlawyerreference to godkiller …security guardvillainpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
| Story: | leavingasylumpsychoblood splattershowerfemale nuditysexf ratedbloodviolencefemale frontal nudityinterviewflashbackbare chested malegun …kissfightphotographexplosionknifechasesurprise endingpistoltelephone callfirecryingcell phonedreamcorpsecar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightaxevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Five teenagers head off for a weekend at a secluded cabin in the woods. They arrive to find they are quite isolated with no means of communicating with the outside world. When the cellar door flings itself open, they of course go down to investigate. They find an odd assortment of relics and curios, … but when one of the women, Dana, reads from a book, she awakens a family of deadly zombie killers. However, there's far more going on than meets the eye. (Read More)
| Subgenre: | black comedysupernaturalslasher flickteen horrorsupernatural horrorreality spoof |
| Themes: | ghostmurdersurrealismsuicidedrunkennessmonstergamblingsurveillanceapocalypse |
| Mood: | goresatireslasher |
| Locations: | lakegas stationtunnelcave in |
| Characters: | witchteenagerboyfriend girlfriend relationshipzombiesecurity guardbabe scientistself referential |
| Period: | 2000s20th century1900s21st centuryyear 2009 |
| Story: | relicsdeadlyscarecrowdecapitationblood splatterfemale nuditybloodflashbackbare chested malesurprise endingpistoltelephone callshot to deathmachine gunshot in the chest …shot in the headcar crashcollegerobotf wordmassacreimpalementstabbed to deathstabbed in the chestsevered headman with glassescreaturegravecharacter repeating someone else's dialoguevirginstabbed in the backclownperson on firediarymanipulationexploding bodymercenarydirectorial debutsevered armdismembermentsubtitled scenefreeze frametopless womanwerewolfhand grenadegrenadeathleterevelationgroup of friendsswat teamsevered handcovered in bloodend of the worldeaten alivecelebrationredneckcameostabbed in the throatdark humorfalling to deathstabbed in the headthrown through a windowtitle at the endstabbed in the eyeaxe murdercharacters killed one by oneethnic slurcellarinterrupted sexmarijuana jointvideo surveillancestabbed in the handbonghuman sacrificestonerboy with glassesinterracial kissjapanese schoolgirlelectric shockcabin in the woodstentacleoffice workerbitten in the neckcarnagejocksawgoblinstabbed in the shoulderfilmed killingtwo way mirrormusic boxwoman in a bikinimasked villainrecreational vehiclepsychological tortureku klux klantrapdoorlocked in a roomforce fieldevil clownhatchetunicorngiant spiderinternno survivorsbear trapgas station attendantdyed hairkiller clowngirl stripped down to pantiescyclopstorture chamberdirt bikezombie childtruth or darebody torn apartdead teenagerfilm reelcocktail partyscholarcubepuppeteerkilled in an elevatorgiant snakehorror icongrappling hookblonde stereotypeno cellphone signalblobevil godcontrol roomunderground bunkerpushed into waterritual sacrificestrange behaviorlovecraftianravinechasmanimate treemermantorture victimbulletproof glassspeaker phonedeconstructionswimming in a lakebloody hand printmountain roadyear 1903alpha maleboat dockpheromonesmounted animal headgroup of fiveconchgiant batharbinger of deathgiant handtrowelfalling into a lakebetting poolcaged monster (See All) |
Having awoken from their spring break extravaganza at Lake Victoria, the swarm heads upstream where they look to make a meal out of Big Wet, a local water park where when it comes to fun, nobody does it wetter! Though they came to get wet, get loaded and get some, the staff and patrons get more than … they bargained for when they must face the fiercest, most bloodthirsty piranhas yet. Lead by the strong-willed, studious Maddy and her friends, Barry and Kyle, the trio must dive in and take on these man-eating creatures using every ounce of their being but can they be stopped? (Read More)
| Subgenre: | independent filmblack comedysuspenseabsurdismcreature featureteen moviesurvival horrormonster movie |
| Themes: | escapedeathfriendshipfearvoyeurismseductionparanoiaunrequited loveexploitationpaniccouragemurder of a police officernear death experienceghost townfear of water |
| Mood: | gorenightmarepoetic justice |
| Locations: | hospitalswimming poolbathtubwaterwheelchairpolice carlakemotelsex in a carcar in waterwater pistolwater wellsex in vansex in a van |
| Characters: | teenagerboyfriend girlfriend relationshipteenage girlpolice officerlove triangleinterracial relationshipsheriffex boyfriend ex girlfriend relationshipself mutilationstepfather stepdaughter relationship |
| Period: | 2010ssummer |
| Story: | funcgiattackdrowningdecapitationblood splatterfemale rear nudityfemale nuditynuditynumber in titlebloodmale nudityviolencebare breastssequel …threesomefemale frontal nuditymale rear nuditybare chested malekissfemale full frontal nudityexplosionpartyknifeleg spreadingchasesurprise endingerectionpantiestelephone calltopless female nuditycell phonecorpsedigit in titleurinationblondeshotgunrescueslow motion scenepunched in the facecondomundressingbikinisex in bedbare buttsunglassessecond partanimal in titlehandcuffsvoyeurstripperscientistf wordsubjective cameracleavagesurvivalgay slurflashlightmassacreambulancedeath of friendmontageimpalementfishsevered headno opening creditsscantily clad femalechild in perilhit by a carunderwater scenepolice officer killedvannews reportskinny dippingvirgindangerkeydeath of childcollege studentskeletonscene during end creditsfarmerpremarital sexunderwatersevered armprofanityfireworkscowcorrupt copsingle parentgirl in pantiespickup truckactor playing himselfkilling an animalno pantiesloss of virginityeggwalkie talkieloss of loved oneeccentricyoutubeflatulencecovered in bloodfroggrindhousecoitusanimal attackinterracial friendshipeaten aliverampageredneckdivingreverse footagecameofloodsevered fingerbravery3 dimensionalevacuationescape attemptblack and white scenecigarette lighterswamp3dsexploitationaccidental killingaerial shotarizonatitle at the endcastrationpiersevered legdeath of loved onetan linecopulationblack bra and pantiesfast motion scenemarijuana jointblood on camera lensbriberybloopers during creditsvomitdead animalblue pantiesnudecrutchesstepfatherautographvulgarityamputeewhistlefish tanknude girlhead bashed indeputywoman in bra and pantiesman in swimsuitdeath of boyfriendsole black character dies clicheextreme violencewet t shirtgraphic violencewoman in a bikinilifeguardcamera phonebloody violencetongue in cheeksong during end credits3d in titleanimal killingstupid victimkeyboardgas explosionfemale in swimsuitexcrementsexual innuendodouble entendresurprise during end creditsmascotwoman punches a manfemale explicit nudityfossilface ripped offpiranhanumber 3 in titleloss of boyfriendsevered penismass deathgory violencesequel to remakewater slidefish in titlehandcuffed to a pipebitten in the facetridentpenis bitten offpainful sexcorrupt sheriffwater parkbeheadeddead cowkiller animalmarine biologistmarine biologybitten on the legdecapitated childgiant fishhead bitten offaquaphobiakiller fishman vs naturecrying for helpchild killed by animalleg bitten offbitten in the armcinder blocktv advertbitten in the legfictional placebitten by a fishshark costumetitaniumcelebacyunderground lake (See All) |
A Journeyman ninja by name of Jubei stumbles upon a plague, an evil clan of demons, a national crisis, and a beautiful ninja girl.
| Subgenre: | martial artscult filmsupernaturaltragedyepicadult animationdark fantasy |
| Themes: | murderdeathloverevengesurrealismrapemonsterheromagicseductiontravelangersupernatural powerunrequited lovecruelty …blindnessjusticemythologysamurainear death experiencerape and revengesupernatural powers (See All) |
| Mood: | goreneo noiranimepoetic justice |
| Locations: | shipforestboatwatervillagejapanblood in waterdeath at sea |
| Characters: | tattoojapanese womanaction herojapanesesamurai swordnear deathblood revengedeath of a girl |
| Story: | jumpattackdecapitationblood splatterfemale rear nudityfemale nuditynuditybloodviolencebare breastsflashbackbondagebare chested malegun …sex scenekisschasefirelickingcryingbreast suckinghorserescuepunched in the faceswordkissingfalling from heightshowdownrunningdemonswimminggood versus evilspycandlesword fightambushold manstabbingbridgearmymapsnakeunderwater scenecontroversycreaturetransformationduelone against manytreescreamingelectrocutionpoisonmissionninjaopening action scenescreammartial artistgovernmenthorse ridingunderwatersacrificeespionageblood spatterpowerstylized violencegoldmartial arts masterdestructionhead buttwoundquestsexual abuserageenemybuttockscrying womanbuttfaked deathhonornaked womanchop sockyfemale warriorpromiseseriessevered fingerkatana swordblood on faceteamresurrectionevacuationimmortalitydark heroeye gougingstabbed in the eyeblind manbroken armsword duelarrowdaggerchallengeblindtorso cut in halfheroismbisexualitysaving a lifeswordsmanelectricitykatanaviolence against womenbandagekung fu classicrunning awayschemelong hairsexual violencemegalomaniacponytailclimbingmessageninjitsuforeplaypoisoningfinger cut offtravelingaction violenceextreme violencetreacherygraphic violencetragic loverighteous ragebloodshedjumpinggrassimmortalcut into piecesspitting bloodbloody violencearm cut offcoughing bloodwoman undressingviolent deathtreesdeath of loverscreaming womanloinclothepic battledirtarm ripped offcutscrollantidotedrinking bloodhaydark heroineshurikenangryheadbandfemale ninjawaspcompanionmagical swordninja warriorfireflylife and deathstabbedbamboomass deathninja masterriding a horsedeath of main charactergory violencepoisonedtouching breastsfake deathviolence against a womanblood on mouthfeudal japantribalbloody sprayangry mandoomed loveflamescryelectrocutedbloodlustcut in halfdeath by firehole in wallwoman undressing for a mantoxinbloodystabbreast squeezingbreaking through a wallwoman electrocutedjapanimationviolenttasting bloodclimbing a wallcompanionshipancient timestragic deathbroken dreamlicking someoneblood spurtclimbdeath by swordkiss of deathlife savingcoughing up blooddeath of womanenemieshorse riderbloody liplong fingernailsbloodthirstyfaking a deathrock monstersnake womanblood dripbloody messbreaking through walldecapitatedultraviolencebamboo forestbloody waterchase scenetownspeoplejapanese governmentancient japanburn to deathnear death survivorsnakesanimated violenceclimbing a cliffdestroyed wallinsane violencetraveling companionburning shipcutting off fingerfingers cut offgushing bloodheroic deathmale companionpoisonerspit blood (See All) |
A young woman slowly goes crazy after taking a job as the caretaker for an ancient New York home.
| Subgenre: | independent filmsuspense |
| Themes: | ghostmurderdeathsurrealismsuicidefearinsanitymental illnesssadismevilmadness |
| Mood: | gorenightmare |
| Locations: | new york citybarbathtubkitchen knife |
| Characters: | female protagonistpolice officersuicide by jumping |
| Story: | jump cutpsychoritualblood splattershowerfemale nuditybloodone word titlebare breastsfemale frontal nudityknifetelephone callcorpsewritten by directorlow budget film …bathroomdemonhallucinationtoplessmansionstabbingstabbed in the chesthousesevered headdream sequencenecklacepossessionmistaken identitysuitcasescreamscene during end creditsisolationhaunted housedismembermentfreeze frameoccultdresslooking at oneself in a mirrorstabbed in the stomachhammercrying womanrape victimschizophreniafemale killerfalling to deathscissorsmakeupblack and whitelipstickbalconyh.p. lovecraftpsychoticlingerie slippsycho killerdementiaminimal castrepeated sceneclose upwalletvery little dialogueearringblackblood stainyoung womanhearing voiceslocked doorlying on bedhallwaysawmacabrefrightcaretakerchapter headingswoman smokerpsychotronic filmchance meetingbreaking through a doordragging a bodyman hits a womansecret roomtrancedriver's licensepick upbloody facefemale in a showerfemale vomitingrepeated eventhome alonebarefoot womanplastic bagbodily dismembermentfemale star appears nudeshower scenewhitedragging a dead bodydismembered bodymad womanringing telephonejumping off a roofchaptershorror filmcrucifix pendantdead body in a bathtublovecraftianliving alonelocked roomterracetooth extractionclaw hammerhouse sitterticking clockhousesittingdriving licencemascaracup of teaplastic bag over headcleaning up bloodsuffocated with plastic bagdismembering a dead bodybutterfly collectionblood showerdescent into madnessalone in houseblack and white filmdriven to suicidenew york cityscapestanding on a ledgelatin phrasesuffocated with a plastic bagwashing blood off handsthe other sideflickering lightsinverted cross (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy |
| Themes: | ghostmurderdeathfriendshiprapepregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanitysadism …eviltrauma (See All) |
| Mood: | gorenightmareslasher |
| Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
| Characters: | father son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killernursebaby …artistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | deadlyasylumblood splattershowerfemale rear nudityfemale nuditysexf ratednuditybloodviolencebare breastssequelflashbackbare chested male …gunphotographpartyknifechasesurprise endingpistoltelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypecharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
Someone is strangling coeds in Perugia. The only clue is that the killer owns a red and black scarf, and police are stumped. American exchange student Jane and her friends decide to take a break from classes by going up to Danielle's uncle's villa in the country. Unfortunately the killer decides to …follow, and the women begin suffering a rapid attrition problem. (Read More)
| Subgenre: | independent filmcult filmsuspensepsycho thrilleritalian horror |
| Themes: | escapemurderdeathfriendshipmarriageinfidelitydrugsrapemoneyjealousypoliticsdrinkingfeartorture …investigationvoyeurismincestmemoryseductionangertheftpsychopathbrutalityparanoiablackmaildrug usecancermental illnesssadismevilhome invasionphotographyexploitationdyingtraumadrug addictionwritingphilosophymysterious death (See All) |
| Mood: | gorenightmarecar chaseslasherdarknessbreaking the fourth wall |
| Locations: | trainschoolchurchforestcarmotorcyclevillagewoodsrural settingkitchenapartmentpolice stationitalysex in publicwater well |
| Characters: | family relationshipspolicefather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipdoctorchildrenboyprostituteserial killernursestudentlove trianglebest friend …killerlustvillainteacher student relationshipterroramerican abroadtruck driverlove letterslasher killermysterious villainart studentmysterious killeramerican girlsuicide by jumping off a cliff (See All) |
| Period: | year 1972 |
| Story: | psychodrowningdecapitationblood splatterfemale rear nudityfemale nuditybloodmale nudityviolencethreesomefemale frontal nudityflashbackmale rear nudity …bare chested malesex scenekissfightfemale full frontal nuditynipplesphotographpartyknifelesbian kisschasesurprise endingerectionpantiestelephone callfondlinghigh heelsunderwearcar accidentmirrorblondeface slapcatbikinibrawlthongfalling from heightmaskpaintinglietearssunglassesrunninglingeriedead bodymarijuanacollegepianoprostitutionbritishvoyeurclassroomorgyalcoholfightingtelephonecleavagebisexualnewspaperorphanbedroombrawinecandleconcertstrangulationaxemountainmansionstabbingdrug dealerthroat slittingstabbed to deathsuicide attemptbrunettedrivingnunassassinationhit by a carsearchold womanimmigrationskinny dippingpublic nuditytreelibrarystalkerbinocularsstrippingbeaten to deathdangerscreamingkeymini skirtchampagnemassagemistaken identitystorytellingdollevil mankicked in the facedeath of childcollege studentscreamuniversitydisappearancecountrysidestalkingglassesthreatwitnessisolationbasementtrapsuspicionmurderertied upwaterfallsevered armdismembermentsplattercouplemaniaceyeglassessupermarketdestructiondressmass murderlooking at oneself in a mirrorfaintingrome italygroup of friendsred dressmutilationloss of friendcaught having sexhidingdesperationgrindhousepsychologiststrangervictimfollowing someonemilkpicnicembarrassmentmasked manblack womansexual desirerampagerear entry sexwindseven word titlekickinggash in the facefalling to deathbutcherescape attemptswamphit on the headdead childbathingdisembowelmentfrustrationevidencesurpriseperversionspyingdead maneye gougingslaughtermarital separationintruderdark pastbody countbroken armsevered legcharacters killed one by oneparrotmasked killerchildhood memorysunbathingpsycho killermuddead girlpiano playerimpotenceserial murderbisexualitypsychopathic killersexual awakeningbarbed wirebad guymadmanmysterious manface maskclosetmenstruationhiding in a closetnecrophiliakilltractorbandagegloveslong hairhuman monstereyeclose upbottlelecturestaircaseskirtbreadrepressionsexual perversionhomicidal maniacvillaearringblack marketsilentslashingdegradationjacketexhibitionistlandladypremonitiondruggedamputationdripping bloodlocked doorcrushed headcollege professorsawkicked in the headuniversity studentscholarshipsexual frustrationextreme violencemacabrefilling stationgraphic violencescarfblademultiple murdermasked villainknife murdercircular staircasecut into piecesbloody violencegialloinspectorfemale victimstrangled to deathignorancesadistic psychopathdelivery manegopeep holedelivery boydisturbed individualbutcherygrindhouse filmsexual obsessionnoiseanarchismbody partcrime spreewrapped in a towelmotor scooterwater fountainresearcherasphyxiationenvelopedeeply disturbed persontarot carddriver's licenseclothes rippingkeysbanishmentmystery killerstrobe lighttortured to deathnude sunbathinguniversity professormultiple homicideintegrationcigarette holderpsycho terrorblack glovesdevastationco edoil lamppneumoniaorderlybreast flashingdisturbingblouserun over by a caritalian cinemamotorcycle racingperiltortureruncle niece incestsadisticthesiscuttingsidewalk cafedrive in classiclegfienddeath by strangulationhiding in a caramerican womangory violenceconfettisickogaggingheadlineseclusionboutiquedismembered bodypreychild suicidefoot injurylesbian lovergruesomecarrying a dead bodystaringthrown through a glass doorbody partscovered in mudlocked upburying a dead bodymultiple stabbingunknown killercartwheelmutilated bodysouthern italynude dancingpsycho filmhack sawradiatorclass differencestatuettetin candripping watertroubled childhoodblouse rippingfabricshawlfemale victimssleazy giallouniversity campusblack gloved killerdelivery trucktelephoto lensbarred windowslashed to deathstalking victimlace pantiestransfer studentcardboard cut outdismembering a dead bodycut to pieceshandheld mirroroverhead projectorrear ending a carfalling into mudthrown from a cliffvoice over flashbackdark alleykicking a canlifting skirtanti socialistfood cartmadonna and childslaughteredtailor shopwine barrelkiller wearing a ski maskarm cutetymologysitting on someone's lapstalking by nightwindow screenmarket vendor (See All) |
As a collection of history's worst tyrants and criminal masterminds gather to plot a war to wipe out millions, one man must race against time to stop them.
| Subgenre: | martial artsconspiracyperiod pieceaction moviewar drama |
| Themes: | escapemurderdeathrevengechristmasbetrayalpoliticsprisonfeartorturefuneraldeceptionmilitaryangerpsychopath …brutalityterrorismblackmailsadismevilpaniccouragenear death experience (See All) |
| Mood: | gore |
| Locations: | shiptrainchurchairplanelondon englandelevatorenglandrussiagermanysubmarineairplane accidentu boatstorm at sea |
| Characters: | father son relationshipteenagerteenage boysoldiertough guywarrioraction herovillainsniperrussiangermansniper rifleex soldiergerman soldier …mysterious villain (See All) |
| Period: | 1910s20th century |
| Story: | over the topfuncaptaindrowningdecapitationblood splatterbloodviolencesequelflashbackbare chested malefightphotographexplosionknife …three word titlesurprise endingpistolshootoutbeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headrescueslow motion scenepunched in the facebattleswordgunfightbrawlfalling from heightletterpaintingbased on comicshowdownrifleheld at gunpointhand to hand combatbombapostrophe in titleinterrogationbritishrevolverfightingcombatshot in the backf wordsubjective cameragood versus evilspygay slurassassinsword fightbased on comic bookambushterroriststrangulationmassacremountaindisguisemontagethroat slittingstabbed to deathmixed martial artssuicide attemptprisonerstabbed in the chestmapexploding carsevered headdisarming someoneone man armyassassinationdouble crossunderwater scenefemme fatalegraveyardthird partshot in the legshot in the foreheadtrainingflash forwardattempted murderdangerstabbed in the backprologuewidowerpoisonumbrellamissionactor playing multiple rolesundercoverrace against timetentevil mankicked in the facechristmas treetough girlopening action sceneringscene during end creditsmanipulationexploding bodyautomobileworld war onethreatened with a knifeprofanitygeneralhandgunsecret agentclass differencesespionagenewspaper headlinebattlefieldpowerwashington d.c.stylized violencehenchmanpoemiceeavesdroppingtraitorhand grenadefireplacedestructionrevelationassassination attemptcakecomic booklifting someone into the airbeardsergeantkicked in the stomacheccentricservantirishsouth africaparadeburialaction heroinefemale killergoatbroken leggun battlefemale warriorgas maskseriesshieldbraverystabbed in the throathatredimpostorsonmercilessnessshot in the facedeath threatfalling to deathstabbed in the headballensemble casttime lapse photographybutlerstabbed in the legmarvel comicspunched in the chestdynamiteconcentration campknife fightparachuteundercover agentknife throwingmustachecanehousekeeperbody countlieutenantsword duelterrorist plotblack magicpigeonmoral dilemmagatling gunprequelnannypalaceterrorist grouphistorical fictionanti warfinal showdownsecret servicefemale fighterlong hairwar herosuit and tieworld dominationcomicmajoramputeemegalomaniacfemale spycheering crowdembassyambassadorreluctant herobayonetbritish armyseductresswoman kills a mantop secretbritish soldiershot in the throatcodefeathertelegramrighteous ragespy heroexploding shipwarlordbloody violencemass gravepsychotronic filmsecret missionflare gunanimal killingarmy basebiplanekicking in a doorfake accentcloseted gaytorpedoleg injurysecret roomscottish accentlandminecowardicereputation19 year oldhidden gunsurprise during end creditsscotsmanfranchiseaustrianhidden roomcriminal masterminddukeman fights a womanpacifistleg bracetraining montagefriendly firefanspickaxehenchwomanmortarpacifismbritish intelligenceintelligence agencymicrofilmwar woundtrench warfarejumping from an airplanewartimecyanidehealing powertwo against onenetworkyear 1914basic trainingspy missionbalancecode breakinggeopoliticswestern frontinvincible henchmanno man's landcriminal organizationelevator crashwalther ppkgender in titleboer warknife in shoemanservantreference to king arthurreference to icarusaid workeryear 1902icon comicsreference to germanyopening creditsthe white housewipereference to oral sexstrongcarrier pigeoncyanide pillreference to mexicoreference to russiatailor shopwar medalbuckingham palace londonperfect scorereference to merlinreference to queen guinevere (See All) |
Jen's romantic getaway with her wealthy (married) boyfriend is disrupted when his friends arrive for an impromptu hunting trip. Tension mounts at the house until the situation culminates in an unexpected way.
| Subgenre: | independent filmsuspenseconspiracy |
| Themes: | escapemurderdeathrevengeinfidelitydrugsrapebetrayaljealousyfeardrunkennessdeceptionvoyeurismextramarital affairpsychopath …brutalityexploitationcrueltypanicvengeancehuntingnear death experiencerape and revengerevenge murder (See All) |
| Mood: | gorenightmareavant gardebreaking the fourth wallblood and gore |
| Locations: | swimming poolhelicoptermotorcycledesertwaterlakecavecampfire |
| Characters: | female protagonistsnipersniper rifleself mutilationself surgerynear deathgirl with a gun |
| Period: | 2010s |
| Story: | tripdrowningblood splattershowerfemale rear nudityfemale nudityf ratednuditybloodmale nudityviolenceone word titlebare breastsmale frontal nudity …male rear nuditybare chested malegundancingtitle spoken by charactermale full frontal nudityknifechasepantiesfirecell phoneshootouttitle directed by femalecorpseshot to deathshot in the chesturinationblondeface slapshot in the headshotgunslow motion scenepunched in the facewatching tvwritten by directorgunfightbare buttfalling from heightvomitingshowdownrifleheld at gunpointbeersunglassesrunningcar crashhallucinationvoyeursubjective camerasurvivalfoot chaseflashlightambushmontageimpalementhousedream sequencedisarming someonenecklacepainattempted murderone against manytreedangerstabbed in the backproduct placementcover upshot in the shoulderlong takestalkingvigilantesubtitled scenearsonsplatterstrong female charactergirl in pantiesflirtingelectronic music scorewoundlistening to musicsurvivorragewalkie talkiehunterspiderpoolbarefoot maledesperationcovered in bloodrape victimrapistaction heroinebroken legapplebikergun battletensionblood on facemanhuntmercilessnesscigarette lighterexploding headblood on shirttitle at the endeye gougingboyfriendgasolinestabbed in the eyered pantiesbarefoot femalelens flarefemale directorkilling spreebloodbathmale in showermale objectificationblood on camera lenstaking a showertriple f ratedfinal showdownminimal castrunning awayvery little dialoguerear nudityanal rapebusiness carddripping bloodbullet woundfinal battlerighteous ragebloody violenceone woman armymurder spreeanimal killinggrindhouse filmextreme close upman slaps a womanbloody facedecomposing bodyleft for deadmotorcycle ridingmidnight moviescreaming in painman huntoff screen rapehit with a rifle buttamerican womangory violencecar won't startplastic wrapdead body in waterhunting rifleshot in the earchoke holdshot in the bellyheadshotsleeping outsidebeer canrotting corpsedream within a dreamglass shardblood on wallwoman murders a maneurocopter as350 squirrelhunting knifeisolated househead held underwatertelescopic rifleblood on clothespeyotepushed from heightrevenge killinghallucinogenic drugeating an appleloading a gunturning the tablesall terrain vehiclehunting tripviolent womanblood on floorbloody hand printpushed off a cliffwalking on broken glassrange roverbloody footprintmale star appears nudequad bikerunning barefootstepping on glassbutane lightercauterizing a woundkilled one by oneview through rifle scopeear shot offblood trailfield surgeryslipping on bloodcovered with bloodgearing upstomach woundworld cinema (See All) |
It is the time of the Spanish Inquisition. Maria does not like what is going on during the "Auto De Fe". When she speaks out, she is arrested and accused of being a witch. Torquemada has plans for her! He orders her tortured, and her tongue to be cut out. Her husband attempts to free her...
| Subgenre: | independent filmcult film |
| Themes: | murderrevengerapereligionbetrayalfeartorturesupernatural powersexualitysadismevilexecutiongreedcrueltydevil …madnessreligious fanaticismreligious beliefpriest in love (See All) |
| Mood: | gore |
| Locations: | churchcastletunnelspaincatholic church |
| Characters: | witchhusband wife relationshiphostagethiefreference to godlustvillainmaidcatholicreligious fanaticbakerdeath wishsex with a priestself flagellationreligious fervor |
| Period: | 15th century |
| Story: | barrelhusbandcaptainritualblood splatterfemale nuditynuditybloodviolencefemale frontal nudityfemale full frontal nuditynipplesknife …firecorpseface slapswordarrestmaskhand to hand combatprayerfoot chasewinecandlestrangulationimpalementstabbed to deathprisonerfemale pubic haircoffincontroversyold womanpaingunshotconfessioncurseperson on fireliarpassionscreamskeletonscarcrossratwaterfallwhippingeuropechessloyaltyburned alivedesirewoundmutilationcrucifixwitchcraftspiderskulltorchmonkchokingmoralitycannonguardwhipmercilessnesssuperstitionmedieval timesbased on storydungeonperversionsoularmorsurgeondaggersintelepathyplaying cardsspelltombpervertpopeburied aliveforced to stripstreet marketcorporal punishmentbreadtemptationdegradationfortresshearing voicesdying manbakerytyrantsword fightingvanitybladegropingriteshrinehorse and wagonfloggingpithookblasphemyfanaticovendepravityflintlock riflewebmercyspectatorexaminationcmnfdevotioncardinal the priestinquisitionexhumationcartvendorfanaticismhourglasstorturergunpowderburned at the stakefiendfemale tearsdisembodied voicehereticvicedreadiron maidenpendulumtongue cut out1400sspanish inquisitioncitadelflagellationweeping womanholy manmanaclesbased on the works of edgar allan poereligious mandevicemortal sinconfessorsado masochismtorquemadayear 1492grand inquisitorpapal visitdecreeheresaysexual denial (See All) |
A college fraternity prank goes wrong and a student ends up in the mental asylum. Three years later, it's graduation time, and the members of the fraternity decide to have a costume party aboard a train trip to celebrate their graduation. Unknowingly to them, a killer has slipped aboard, killing the …m off one by one, disguised in the costumes of the victims. (Read More)
| Subgenre: | independent filmcult filmpsycho thrillerslasher flickteen horroramerican horrorindependent horrorcanadian horror |
| Themes: | murderdeathrevengemagictravelpsychopathsadismevil |
| Mood: | gorenightslasher |
| Locations: | trainsnow |
| Characters: | doctorteenage girlteenage boyserial killerstudentkillervillainterrorslasher killermysterious villainserial murderermysterious killer |
| Period: | 1980syear 1980 |
| Story: | tripasylumpsychodecapitationblood splatterfemale nuditynuditybloodviolencetwo word titlepartyknifesurprise endingslow motion scenesword …masklow budget filmcollegestabbingstabbed to deathsevered headpantyhosestalkercostumeevil manprankstalkingmurderersplattericefemale stockinged legsmutilationmagiciansevered handnew year's evemasked manpastbutcherslaughterbody countaxe murdermasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmanmysterious manmagic trickhuman monsterblack pantyhosehomicidal maniacslashingmedical studentorchestral music scoremasked villaincoldlunaticsadistic psychopathdisturbed individualbutcherygrindhouse filmbody partcreepsittingimpossible loveillusionisttrain conductorpsycho terrorweirdocadavermasqueradehidden identitydrive in classiccanuxploitationgory violencehorror movie remadesickoaxe murdererbody partsfancy dresscollege agelavatoryfalling from a traintrain movie (See All) |
Three college students, Phil, Ed, and Henry take a road trip into Mexico for a week of drinking and carefree fun only to have Phil find himself a captive of a group of satanic Mexican drug smugglers who kill tourists and whom are looking for a group of new ones to prepare for a sacrifice.
| Subgenre: | psycho thrilleramerican horrorsadistic horrormexican horror |
| Themes: | murderdeathrevengekidnappingdrinkingtorturedrunkennesspsychopathbrutalityinsanityevilmurder of a police officer |
| Mood: | goreslasher |
| Locations: | hospitalbarbeachcemeterypolice stationstrip clubmexico |
| Characters: | prostitutesingle mothervillainterrorslasher killerreligious icon |
| Story: | funtrippsychodecapitationblood splatterfemale nuditybloodviolenceone word titlemale rear nuditybondagebare chested maledancingchasebased on true story …corpseshot to deathshot in the chesturinationface slappunched in the facethongmarijuanaprayergay slurbound and gaggedgangstrangulationmassacredeath of friendstabbed to deathstabbed in the chestsevered headcultshot in the legstabbed in the backscreamingmissing personevil mankicked in the facebaseball bathorse ridingpremarital sexthreatened with a knifesevered armdismembermentmaniacwhat happened to epiloguehead buttlooking at oneself in a mirrordrugmacheteshot in the stomachmutilationstabbed in the stomachloss of loved onenosebleedsevered handfestivalvirginitymale underwearmexicangunshot woundbutcherstabbed in the headreference to satanamusement parkstabbed in the legeye gougingbarbecuebody countkilling spreedrug lordpsycho killerserial murderpsychopathic killerprayingbad guymadmanbag over headstuffed animalshot in the neckbandagehuman monsterhuman sacrificehomicidal maniacslashingjointarm cut offsadistic psychopathbreaking through a doorshot through a doormurder spreestupid victimbutcheryu.s. mexico bordercrime spreetarot cardhung upside downlamblassocult leaderpsycho terrordisturbingleg bracesatanistknife woundmagic mushroomloosely based on real eventssatanicafter dark horrorfestpole dancethrown through a glass doorachilles tendon cutpsycho filmhack sawtongue rippinggalveston texaschained to a post (See All) |
Two of three powerful artifacts allow Rugal Bernstein, a man of evil intent, to enter and control an alternate dimension where gamers have been entering into martial arts combat for fun. From there, he awaits adversaries, killing them rather than defeating them so that he alone will remain as The Ki …ng of Fighters. As Rugal possesses lesbian lovers Vice and Mature to aid him, undercover CIA agent Mai Shiranui teams up with Iori Yagami and Kyo Kusanagi to stop him before he can unleash a dread spirit named Orochi upon Mankind. (Read More)
| Subgenre: | martial arts |
| Themes: | escapemurderrevengesurrealismbetrayaltheftpsychopathdeath of fathersupernatural powersadismself sacrifice |
| Locations: | hospitalhotelsnowmotorcyclecemeterywheelchairapartmentmuseum |
| Characters: | father son relationshipnursewarriorasian americanself mutilation |
| Story: | funcgiagentblood splattershowerfemale nuditybloodviolenceflashbackfightexplosionchasesurprise endingpistolcell phone …machine gunshot in the chestslow motion scenepunched in the faceswordshowdowndemonspysword fighttied to a chairsnakeexploding cardouble crosscigar smokingtransformationbeaten to deathelectrocutionundercoverkicked in the facebaseball batexploding bodylaptopsecret agentciaicefalling down stairsspiritrevelationflyinglooking at oneself in a mirrorcatfightlifting someone into the airkicked in the stomachnosebleedmind controltournamentfemale warriorshieldbased on video gameboston massachusettsgash in the faceprophecyimmortalitypunched in the chestblood on shirthologramundercover agentdemonic possessionexistentialismmannequinteleportationseattle washingtonhit with a baseball batcia agentelectricityface maskalleyfemale fighterspiral staircasefireballlockerportalworld dominationmegalomaniacfemale spyreluctant heroman punching a womanmacguffincar set on fireoverturning carroller skatesspawoman fights a manparallel universegarbage canalternate dimensionmass murdererforce fieldglowing eyesmacefalling through the floordutch angleturned to stonehockey maskpickaxehockey stickflaming swordear piecekicked in the backself repairred eye (See All) |
The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum …mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)
| Subgenre: | martial artsblack comedysupernaturalfairy talesword and sorcerysteampunkdark fantasy |
| Themes: | escapemurderdeathsurrealismkidnappingbetrayalmagicdeath of fathersupernatural powerdeath of motherabductionfalling in lovemissing child |
| Mood: | gore |
| Locations: | forestsmall towndesertvillagewoodscity |
| Characters: | witchpolicebrother sister relationshiphostagetough guyaction herovillainsnipersheriffmayorsniper rifleself inflicted gunshot woundevil witch |
| Story: | ritualdecapitationblood splatterfemale rear nudityfemale nuditycharacter name in titlenuditybloodviolenceflashbackbare chested malegunfightphotographexplosion …knifechasepistolfirevoice over narrationpunctuation in titlebeatingshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownrifleheld at gunpointhand to hand combatinterrogationcombatshot in the backf wordgood versus evilcleavageorphanassassinsword fightambushaxemassacrestabbingimpalementstabbed to deathcolon in titlestabbed in the chestsevered headanti herochild in perilpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backperson on firemissionrace against timeknocked outtough girlopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachwitchcraftbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All) |
An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.
| Subgenre: | cult filmsuspense |
| Themes: | murderdeathkidnappingrapeadulterytortureseductionpsychopathbrutalityobsessiondrug useinsanitygrief |
| Mood: | rainnightmarenight |
| Locations: | shiphospitaltrainaustraliapolice carseaoceanyachtstorm at seaship on fire |
| Characters: | husband wife relationshippolicedoctorserial killerpolicemandancerphotographerhostageaustralianterroraustralian abroaddeath of killer |
| Story: | tripdrowningshowerfemale rear nudityfemale nuditysexbased on novelbloodmale nudityviolencefemale frontal nudityflashbackmale rear nuditydogtwo word title …bare chested malekissfightcigarette smokingdancingphotographknifechasefirecryingsongbeatingcorpsefoodcar accidentshotgunrescuebare buttheld at gunpointtearssunglassesdead bodysubjective cameraswimmingflashlightsubwayapologyradiounderwater sceneduelbinocularsmicrophonekeyevil mandeath of childdeath of sonisolationsuspicionmurdererdie hard scenariomaniacsociopathsurvivorcaptivewristwatchstrangerhome movierailway stationblack humorpassportwoman in jeopardydivingphoto shoottrappedpillsloss of sonhit in the crotchdeath threattitle appears in writingrowboatmedicationexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedpsychoticpsycho killerminimal castalonesailboatsailingraftdegradationmarried coupleflareunconsciousnessdruggedswimming underwaterlying on bedman in swimsuitstabbed in the shouldershot through the mouthtitle same as bookpsychological torturesole survivorbreaking through a doorflare gunmass murdererdriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceandeeply disturbed personhands tiedwriting in bloodlooking at picturebathing suitmovie projectorsleeping pillsharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlearm injurysalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasday for nightplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All) |
This is the story of an isolated Alaskan town that is plunged into darkness for a month each year when the sun sinks below the horizon. As the last rays of light fade, the town is attacked by a bloodthirsty gang of vampires bent on an uninterrupted orgy of destruction. Only the small town's husband- …and-wife Sheriff team stand between the survivors and certain destruction. (Read More)
| Subgenre: | cult filmsuspense |
| Themes: | murderdeathsuicidemarriagefearbrutalitysupernatural powerdeath of wifewritingself sacrificemurder of a police officerwilderness |
| Mood: | gorenightdarkness |
| Locations: | shipcarsnowsmall townairporttrucktownalaskaout of town |
| Characters: | brother brother relationshipvampiresheriffterrorgrandmother grandson relationshippolice arrestdeath of heroblood lust |
| Period: | 2000swinter |
| Story: | over the topfrozenhusbanddecapitationblood splatternumber in titlebloodviolencedogexplosionknifepistolfirecorpsedigit in title …shot to deathcar accidentshot in the chestshot in the headshotguncomputerfalling from heightbookbased on comicriflecar crashmarijuanajailhandcuffsorgyshot in the backflashlightbased on comic bookgangaxethroat slittingimpalementdinerstabbed in the chestsevered headno opening creditschild in perilhit by a carcreaturegunshotperson on firereadingkicked in the facedeath of childscreaminjectionautomobileisolationneck breakingloss of fatherpolicewomansevered armshot in the armdismembermentundeadarsonpowercouplerecord playerdestructionkilling an animalrevelationhead butthypodermic needlecomic bookmutilationvandalismwalkie talkiebeardhidingwatching a movieexploding buildingloss of wifedesperationsevered handstrangerbroken legseriesteamstabbed in the neckoildeath of protagonistexploding headsundynamiteatticmurder of a childalzheimer's diseasemarital separationaxe murderlightsirenwilhelm screamseparationtorso cut in halfdead dogvodkabeheadingbarking dogsunsetwifeharborset uptractordead animalkilling a doghead blown offstrandedsubtitlesblonde womanmini dressblackoutcomicasthmalanguagebearded manburnt facehunthit by a truckbased on graphic novelmercy killingblizzardbitten in the neckbloody body of childsunrisecrushed headpotburnt bodycomicsfemale police officerdeath of grandmothersuperhuman strengthcut into piecescoldloss of familylunaticsnowmobiletoothlong haired malebear trapthroat rippingphonograph recordremotechevroletset on firewheelbarrowbitten handlocationgeneratorgraphic novelnumberburned bodyburning carbaitestranged couplelittle brotherskull crushingestranged wifemarriage crisisbroken ankledark horse comicslocked upclosing credits sequencevampire versus vampiretundrahead on a stakehusky dogmini serieshand through headsled dogchild vampirevampires29 year olddog killedpopulationremote locationgraphicoil pipelineshort dresstraffic violationthroat slitreference to bela lugosihuman versus vampirehusband and wifeopening creditsanimal killedharbinger of deathhuskyidw publishingwife killedbad teethanimal violenceidw comicsdeath by sunrisedrilling for oilman's best frienddeath of animalgmc truckmusic video directorbarrow (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
| Subgenre: | martial artsblack comedysuspenseconspiracydystopiasurvival horrorpolitical conspiracy |
| Themes: | escapemurderdeathfriendshiprevengekidnappingbetrayalpoliticsfeardeceptioncorruptionpsychopathbrutalityparanoiainsanity …sadismsurveillancehome invasionexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
| Mood: | gorenightslasher |
| Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
| Characters: | african americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifleself mutilation |
| Period: | near future |
| Story: | alivesecurityritualdecapitationblood splatterbloodviolencesequelflashbackbare chested malefightphotographexplosionknifechase …pistolfirecell phoneshootoutbeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorswordgunfightbrawlshowdownrifleheld at gunpointbeerhand to hand combatbombcar crashrevolvercombatshot in the backf wordsurvivalflashlightbound and gaggedgangambushaxemassacreambulancedeath of friendmontagestabbed to deathmixed martial artspoliticianstabbed in the chestimmigranttied to a chairmapsevered headman with glassesno opening creditsanti herodisarming someoneone man armyhit by a carvanthird partnews reportshot in the legshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangerstabbed in the backcostumeprologueperson on fireelectrocutionfugitivemissionproduct placementrace against timeevil manknocked outkicked in the facebaseball batstreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodythreatlaptoptrapelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47chainsawhand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntmercilessnesschaosstabbed in the neckconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
After the suicide of her only friend, Rachel Lang has never felt more on the outside. The one person who reached out to her, Jessie Ryan, also happens to be part of the popular crowd that lives to torment outsiders like her. However, Rachel has something else that separates her from the rest, secret … amazing powers to move things with her mind. Sue Snell, the only survivor of Carrie White's rampage 23 years ago, may hold the key to helping Rachel come to terms with her awesome, but unwanted powers. But as Rachel slowly learns to trust, a terrible trap is being laid for her, and making her angry could prove to be deadly. (Read More)
| Subgenre: | suspenseslasher flickteen horror |
| Themes: | murderrevengesuicideangerpolice investigation |
| Mood: | rainhigh schoolslasher |
| Locations: | swimming poolsmall townsex in carschool bus |
| Characters: | teenage girlteachermotherteacher student relationshipslasher killer |
| Story: | deadlyasylumdrowningdecapitationfemale rear nudityfemale nuditysexf ratedcharacter name in titlenuditynumber in titlebloodmale nuditysequelmale rear nudity …dogbare chested malepartysurprise endingpantiesfirewoman on toptitle directed by femaledreamdigit in titlemirrorface slapundressingfalling from heightvomitingsecond parttelephonebravideo cameraambulanceimpalementhousewhite pantiesfemme fatalelocker roomperson on fireunderwatersplatterteen angstloss of virginitymass murderfriendship between menwoman with glassesred dressamerican footballfemale killermale underwearhaircutshopliftingboxer shortsfootball playermakeuplipstickbody landing on a carbody countpublic humiliationlaughingcharacters killed one by onetank toptelekinesismale in showergirl in bra and pantiesreturning character killed offnotebookruinsforced to stripabuse of powerpaintlockermakeoverweightliftingjock strappromwhite brateen suicideman wearing towelshower roomundershirtblond mangroup showerdark heroinetattooingdead teenagerfragments of glassfoster parentinnocence lostlifting weightsguidance counselorspear gunblue dresssex videopyrokinesishead shavingpost coital scenewrong side of the trackscowboy sex positionmale in towelman forced to stripmen's locker roomabandoned schoolhair clipperslone wolfstrapless braboys' locker room (See All) |
A man is released from prison after serving ten years for murdering an elderly woman. He quickly begins to feel the compulsion to kill again. After failing to murder a cab driver, he flees and discovers a secluded rural home, where a young woman lives with her sick mother and disabled brother. He th …en begins to take out his sadistic pleasures on them, attempting to hold them hostage, while thinking of his troubled childhood with his abusive mother and grandmother... (Read More)
| Subgenre: | cult film |
| Themes: | escapemurderdeathrapeprisondrinkingvoyeurismmemorypsychopathbrutalitymental illnesssadismevilhome invasioncruelty …traumapsychological trauma (See All) |
| Locations: | restaurantcarbathtubtaxikitchenpolice carsex in a car |
| Characters: | policepolice officerserial killerlustout of control |
| Story: | psychodrowningblood splatterfemale rear nudityfemale nuditynuditybloodviolencebare breastsfemale frontal nuditydogfemale full frontal nudity …knifeleg spreadingpantiesbased on true storytopless female nudityvoice over narrationfondlingfoodsex in bedcar crashcafebathroomvoyeurbound and gaggedstabbingeatingstabbed to deathhousefemale pubic hairwhite pantiesscantily clad femalepantyhoseold womanblack pantiesdangerfemale removes her clothessuspicionmurderergaragegirl in pantiesmaniaceyeglassesfemale stockinged legsno pantiesnipples visible through clothingstreetdesperationcoitushomicidepillsmercilessnessbroken glassanxietypanties pulled downred pantiesdark pastliving roomtan linefemale in showerreckless drivingcopulationpsycho killerstolen carpsychopathic killermadmannecrophiliagatecar drivingnudemini dressstaircaseblack pantyhosesexual perversionsexual violencebroken windownude girlbackyardmistakemurder attemptnervousnessmultiple murderknife murderriskanguishroadangstclumsinessloss of controlsidewalkmultiple homicideruthlessnesssnorricamsexual crueltyperilstaringdachshundirrational behaviorjeopardybloodstainimpulsivenesssexual deviantdangerous drivingmultiple stabbingsbig housefemale taxi driversex on a chairsex on a pool tableprison releaseerratic behaviortan panties (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c …olleagues (Read More)
| Subgenre: | cult filmblack comedysuspenseslasher flicksurvival horror |
| Themes: | escapemurderdeathrevengesurrealismrapedrinkingfearvoyeurismangerpsychopathsupernatural powerparanoiainsanitysurveillance …evilpanictechnologymadness (See All) |
| Mood: | slasher |
| Locations: | restaurantswimming poolelevatorlaboratory |
| Characters: | boyfriend girlfriend relationshipfemale protagonistreference to godsecurity guardbabe scientistslasher killer |
| Period: | 1990s2000s |
| Story: | cgidrowningblood splattershowerfemale nuditybloodviolencefemale frontal nuditymale rear nuditydogbare chested malegunkissfightnipples …explosionchasepantiestelephone callfiredreamcorpseunderwearmirrorshot in the chesturinationface slappunched in the facecomputerdrinkthongmaskvomitingshowdownsunglassesbombdead bodycafebathroomvoyeursciencescientistsurvivalfoot chasestrangulationimpalementman with glassesanti herounderwater scenetransformationstalkerdangerstabbed in the backsuburbperson on fireelectrocutioninjectionpursuitstalkingneck breakingratfirst partcult directormonkeywashington d.c.experimenteavesdroppingburned alivekilling an animalwarehousemass murdercagesociopathlifting someone into the airstabbed in the stomachmad scientistpoolcovered in bloodpeeping tomrampagetrappedsurveillance cameraresearchthirty somethingbody countcharacters killed one by onelasersightkilling spreeflamethrowerburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillabroken windowanimal abuseelectric shockgiving a toastseizuretop secretburnt bodysole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonvillain not really dead clichescience runs amokscientific researchloss of controlresearchertragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insecticiclesprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
In Torino, Celine, an American model, is abducted by a taxi driver while en route home to meet her sister Linda, visiting at her apartment. The next morning, Linda reports that Celine is missing - the sergeant in charge directs her to F.B.I. agent Inspector Enzo Avolfi. He's from the Special New Yo …rk City Department investigating a serial-killer that kidnaps foreigners to destroy their beauty. When a Japanese woman is found at nearby a fountain, Enzo and Linda find that the girl is calling the abductor's skin is "Yellow" in color and Linda concludes that the guy might have jaundice. They go to the Policlinic di Torino to find the killer. (Read More)
| Subgenre: | suspensepsycho thrilleritalian horror |
| Themes: | murderdeathrevengefeartorturedeath of motherhumiliationabductioncruelty |
| Mood: | raincar chaseslasher |
| Locations: | hospitalnightclubtaxipolice station |
| Characters: | policejapanese womanserial killerdetectivesister sister relationshippolice detectivetalking to oneself in a mirror |
| Period: | year 2007 |
| Story: | psychoagentblood splattershowerfemale rear nudityfemale nuditybloodviolenceone word titleflashbackcigarette smokingphotographpartypistoltopless female nudity …cell phonecorpseurinationpunched in the facecameraheld at gunpointdead bodycolor in titlefoot chaseoperastabbed to deathstabbed in the chestlibrarybeaten to deathactor playing multiple rolesevil manskeletoninjectioncharacter says i love youthreatened with a knifesubtitled scenemaniacsyringedresstape recorderloss of loved oneparking garagedead womanpillssevered fingerstabbed in the throatgash in the facestabbed in the neckfalling to deathautopsybookstoreperversiondead woman with eyes openpsychoticpsycho killerlaptop computerblood on camera lensserial murdervillain played by lead actormadmanmysterious manporn magazineneedleviolence against womenspiral staircasepiano playingsexual perversionhomicidal maniacforeignerconventhead bashed insawed off shotgundripping bloodfinger cut offfashion showsawfashion modelkiller childknife murdermagnifying glasshit with a hammergialloinspectorfemale victimnew yorkerwater fountainpizza delivery boyabandoned babybody in trunkmissing sisterfemale corpsebleachturinchronic illnesspacifiertrapped in a carhepatitisfalling through a glass rooftorinophotograph on wall33 year oldconfidentialityson seeing mother murderedjaundiceliver diseasethe color yellowsearch for killerhepatitis c (See All) |
A "story inside a story," in which the first part follows a woman named Susan who receives a book manuscript from her ex-husband, a man whom she left 20 years earlier, asking for her opinion. The second element follows the actual manuscript, called "Nocturnal Animals," which revolves around a man wh …ose family vacation turns violent and deadly. It also continues to follow the story of Susan, who finds herself recalling her first marriage and confronting some dark truths about herself. (Read More)
| Subgenre: | independent filmsuspensemelodramapsychological thriller |
| Themes: | escapemurderdeathloverevengekidnappingmarriageinfidelityrapefeardrunkennessdeceptionrobberyextramarital affairanger …divorcepsychopathbrutalityparanoiacancerredemptiongriefhumiliationsadismdeath of wifepanicabortionjusticepolice brutalitydeath of daughtermurder of family (See All) |
| Mood: | neo noircar chase |
| Locations: | new york cityrestauranthotelsnowlos angeles californiabathtubdesertelevatorpolice stationpolice carroad tripmoteltexascar theftcar thief |
| Characters: | family relationshipshusband wife relationshiphomosexualpolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshiptattooteenage girlpolice officerdetectivewriterhostageartist …police detectiveex husband ex wife relationshipolder woman younger man relationshippolice lieutenantself inflicted gunshot wound (See All) |
| Period: | 2010s |
| Story: | deadlyhusbandblood splattershowerfemale rear nudityfemale nuditybased on novelnuditybloodmale nudityviolencefemale frontal nudityflashbackbare chested malegun …female full frontal nuditycigarette smokingphotographtitle spoken by characterpartyknifesurprise endingpistolcell phonecorpseshot to deathcar accidentshot in the chestslow motion scenepunched in the facewritten by directorarrestbrawlpaintingshowdownheld at gunpointinterrogationhandcuffscriminalshot in the backf wordgay slurgangmansionwomanmontagedinertoiletnonlinear timelinechild in perildouble crossauthordangerbusinessmandeath of childmanipulationscarhairy chestlaptopmurderershot in the armchild murderterminal illnessfireplaceheavy rainlooking at oneself in a mirrorsociopathscene during opening creditscowboy hatloss of wiferape victimart gallerycrying manrapisthitchhikerhitchhikingretirementredneckwoman in jeopardystealing a carcynicismunfaithful wifehatredmercilessnesstitle appears in writingnovelistescape attempthit on the headaerial shotlipstickmustachetrailernude woman murderedmoral dilemmaflat tiresouthern accentmale in showertext messagingman cryingmale objectificationfinal showdownspit in the facenoveldefecationloss of daughterfarmhousetrailer homedomineering motherinsomniaman kills a womanreading a bookplumbermanuscriptenglishmandeath of familycamera phoneloss of familygang memberoverbearing mothergang leaderdreadlocksex wifefreewaybritish actor playing american charactertrailer trashpolice vigilantismlung cancerelectriciantire ironpolice lineupex husbandart shownaked manboardroomart installationinsomniacstory within a storystanding in the rainstood uprunning a car off the roadno cell phone signalpaper cutoutdoor toiletsitting on the toiletstood up for dinnerstuck in the middle of nowheregallery owner (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
| Subgenre: | martial artscult filmblack comedychristian horror |
| Themes: | murderdeathrevengekidnappingbetrayalprisonfeartorturedrunkennessdeceptionvoyeurismangersupernatural powerpanicvengeance …murder of a police officerghost town (See All) |
| Mood: | gore |
| Locations: | bartrainchurchhotelsmall towndesertelevatormotelgas stationcampfirenew mexico |
| Characters: | prostitutepolice officerpriesthostagetough guyvampireaction heroevil priest |
| Period: | 1990s |
| Story: | over the topritualdecapitationblood splatterfemale rear nudityfemale nuditybased on novelnuditybloodviolenceone word titlebare breastsfemale frontal nuditycigarette smokingphotograph …title spoken by characterexplosionpartyknifechasepistolfiretopless female nuditybeatingcorpseshot to deathmachine guncar accidentshot in the chesturinationblondeface slapshotgunrescueslow motion scenepunched in the faceshowdownheld at gunpointcar crashinterrogationprostitutionvoyeurprayerrevolvershot in the backsubjective cameragood versus evilcleavagegay slurbound and gaggedaxemassacreambulancethroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headanti heroscantily clad femalesearchnews reportcigar smokingshot in the legtransformationshot in the foreheadpaingunshotlegendbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firemini skirtpay phonecharacter's point of view camera shotmissionknocked outlightningscreamshot in the shoulderpursuitcrossexploding bodyneck breakingtied upmercenaryshot in the armcult directorundeadpickup truckmachismowolfburned aliveno pantiesspearfarcemass murderjeepinjuryscene during opening creditsmutilationtied to a bedsecurity cameracrucifixhammerexploding buildingbuttocksphone boothsevered handskulleaten alivewatching televisionduct tape over mouthvisionthundercrossbowteamshot in the facehungershovelimmortalitycigarette lighterthrown through a windowslaughtergasolinelens flareburned to deathexorcismtelepathytorso cut in halfceremonystolen carsunsetcrucifixiongatebandagespit in the faceold dark housesuper strengthnudedisposing of a dead bodyfemale vampiregunslingernude girlbellsawed off shotgunlatinbitten in the neckman punching a womansunrisewindmillcarjackingriteiconvampire huntermind readingreliccamera focus on female buttvampire slayerfalling through the floorthroat rippingblood drinkingsuper speedsliced in twocardinal the priestnestarmored truckbitten on the armhand through chestmusic score composed by directorcablesteakstabbed in the heartburnt handstabbed in the foreheadvampire bitevampire human lovemurdered priestcorrupt priestwooden stakebitten on the legpetrolvampire human relationshipfrenzysexy female vampirecauterizationmaster vampirenude woman tied uppadrerear end (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
| Themes: | ghostmurderdeathrevengesuicidekidnappingfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of motherinsanity …evilabductiontraumafear of water (See All) |
| Mood: | gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore |
| Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
| Characters: | father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain …serial murderer (See All) |
| Period: | 2000s |
| Story: | psychodrowningdecapitationblood splattershowercharacter name in titlebloodviolencesequelflashbackphotographexplosionpartysurprise endingpistol …firevoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashdemonfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevanskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationsevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo …rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
| Subgenre: | martial artspost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsezombie survival |
| Themes: | escapemurderdeathrevengekidnappingtorturemonstermilitarysupernatural powersurveillancecannibalismself sacrificeartificial intelligence |
| Mood: | goreraincar chase |
| Locations: | shiphelicoptersnowmotorcycleairplanetaxielevatorrooftoplaboratorysubmarinecar explosioncar motorcycle chasemotorcycle accidentairshiphelicopter explosion …airplane explosiontruck explosion (See All) |
| Characters: | female protagonistzombiesoldierhostagetough guywarrioraction herodeafnessex police officer |
| Story: | husbandsecurityblood splatterfemale nuditybloodviolencesequelflashbackfightexplosionknifechasethree word titlesurprise endingpistol …shootoutshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facecomputerbattlegunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombcar crashinterrogationcombatshot in the backsurvivalfoot chaseassassinstrangulationaxearmyimpalementcolon in titlemixed martial artssubwaymappart of serieschild in perilhit by a carunderwater scenecreatureshot in the legshot in the foreheadone against manysuburbumbrellamissionproduct placementrace against timekicked in the facetough girlbaseball batstreet shootoutshot in the shoulderinjectionexploding bodydie hard scenariocharacter says i love youunderwaterthreatened with a knifemercenaryshot in the armbattlefieldwashington d.c.stylized violencechainsawexperimenteyeglassesiceundergroundhand grenadesyringeheroinehypodermic needlecatfightmutantred dressdiseasevirussecurity camerakicked in the stomachwristwatchgiantmind controllaserrocket launcherend of the worldaction heroinemexican standofftowelwhite housegun fucrushed to deatheaten alivefemale warriorgas masktokyo japanfloodexplosiveresistancedual wieldbased on video gamepower outageshot in the facespecial forces3dpunched in the chestairplane crashinfectioncommandohologramone dayalternate realitybulletproof vestcorporationmutationrescue missionchainfifth partclonesign languagebullet timemoscow russiatracking devicehit with a baseball batclose up of eyesfemale assassindesert eaglefemale soldierblood on camera lensreturning character killed offhiding in a closettimebombfemale fighterarmored carsuper strengthgiant monsterplaguecommando unithelicopter crashhit by a truckcommando missiongenetic engineeringfemale herobitten in the necksubmachine guntimes square manhattan new york cityfilmed killingflesh eating zombieopen endedparasitewalking deadwoman fights a mansubterraneanone woman armyfemale gunfightervillain not really dead clichescience runs amokevil corporationx rayed skeletonknife held to throatfemale antagonistnew york city new yorkstarts with narrationtime bombmegacorporationcorporate crimesuper speedbiological weaponcrushed by a carinvulnerabilityrunning for your lifegiant creaturepandemicsuper computerassembly linewashington monumentfalling through icegrappling hookwoman with a gunbad actingexposed brainbuilding explosioncar flipdeaf childresident evilfighting the systemlaser cutterhouse explosionunderwater explosionbio weaponbrainwashdeaf girlcar hit by a truckfalling to one's deathmutant creaturereverse motionflesh eaterunderground laboratoryformer agentvehicular accidentcomputer controlverticle take off and landing aircraftraccoon cityflying creaturekamchatka (See All) |
A janitor at a summer camp is accidently burned severely from a prank. Years later, he is released from an institute, and returns to the camp with a pair of hedge clippers to take revenge on the campers.
| Subgenre: | independent filmcult filmblack comedysuspensedark comedyb movieb horrorslasher flickteen moviedisneyteen horroramerican horrorindependent horrorbritish horrorcanadian horror …slasher horror (See All) |
| Themes: | murderdeathrevengevoyeurismpsychopathinsanitysadismevilbullying |
| Mood: | goreslasher |
| Locations: | hospitalforesthelicopterboatwoodswheelchairsealakebaseballoceancampfirestormbackwoodsrunning through the woodssex outdoors …by the sea (See All) |
| Characters: | teenagerfriendboyfriend girlfriend relationshipdoctorboyteenage girlprostituteteenage boyserial killerbullykillervillainterrorslasher killermysterious villain …out of control (See All) |
| Period: | 1980ssummer |
| Story: | leavingover the toppsychoblood splattershowerfemale rear nudityfemale nuditysexnuditybloodmale nudityviolencebare breastsfemale frontal nudityflashback …male rear nuditygunsex scenekissfightcigarette smokingnipplesknifechasepantiesfirecryingmirrorrescueslow motion scenecondomundressingbikinimaskdead bodylow budget filmvoyeurcriminalf wordsubjective cameraswimminggood versus evilsurvivalfoot chaseflashlightaxemassacrestabbingthroat slittingimpalementstabbed to deathaccidentapologybirdroommateskinny dippingsmokingstalkerstrippingperson on firecharacter's point of view camera shotsuitcasemissing personevil manscreamprankdisappearancestalkingwitnesssuspicioncabinsevered armteenage sexmaniacholidaydisastercard gameburned alivedesirenipples visible through clothingelectronic music scoremass murderfriendship between mensexual attractionmutilationbarnstabbed in the stomachmale bondingmagazinecrying womancampswimsuitgaggedskullblack humorcommunityfollowing someonemasked mansexual desireredneckplayboy magazinesevered fingerstabbed in the throatscissorsoillostsexual harassmentslaughtersexual humordisfigurementattractionbody countaxe murderflamethrowermasked killersunbathingpsycho killerplaying cardspractical jokebeing followednude swimmingserial murderpsychopathic killertaking a showerbad guymysterious manporn magazineoutcastshortsdockrepeated sceneurban legendhuman monstersummer campcanoetelling someone to shut upwoodhomicidal maniacbroken windowraftslashinghospital roommasturbation referencecliniccigarettewormmooningbaseball gamefinger cut offbreaking a windowmotorboatunderage smokinghorninesssexual frustrationcrying femaleextreme violencejumping into watermultiple murdercaretakerseductive behaviorman on firearm cut offwoman slaps a mansadistic psychopathpsychotronic filmburn victimhouse on firemurder spreenude bathingmass murdererimmolationfinding a dead bodygrindhouse filmdovepremature ejaculationpointing a gun at someonescreaming womanstabbed with scissorsburningshower roomhysterical womandiscovering a dead bodybloody facepassive aggressive behavioraxe in the headsecretly observingmultiple homicidehand injurypassive aggressive womanpranksterlost in the woodssocial outcastabandoned mineoil rigruinwoman hits a manmissing womansummer holidaynew york stateplan gone wrongscreaming manroommate roommate relationshipvideo nastywatching someone sleepgarden shearscamp counselordisbeliefcampfire storymurder by stabbingpost coital sceneshower curtainprank gone wrongpushed into watersupervisorvitaminarm injuryseductive mansetting a firemalicestolen clothestalking about masturbationfacial injurymale female fightsleeping shirtlessfacial disfigurementforced kisspretending to sleepspurting bloodviolent manhustler magazinebluegrass musicswimming in a lakeweirdburning fleshserial child murderinsane manobscene hand gesturereference to penis sizenaked bathingcrying for helpmistaken belief that someone is deadscissorpellet gunserial child murdererthroat slitslapped in the faceteenage prankstersleeping in underwearvoice over flashbackburned handfinger injuryreference to playboy magazinetalking to a dead bodyday for nighthedge trimmerhiding behind a treeocean floorplaying baseballsexual urgedrilling for oilmasturbation gesturenon disclosure agreementsleeping fully clothed (See All) |
In 1999, retired Argentinian federal justice agent Benjamin Esposito is writing a novel, using an old closed case as the source material. That case is the brutal rape and murder of Liliana Coloto. In addition to seeing the extreme grief of the victim's husband Ricardo Morales, Benjamin, his assistan …t Pablo Sandoval, and newly hired department chief Irene Menendez-Hastings were personally affected by the case as Benjamin and Pablo tracked the killer, hence the reason why the unsatisfactory ending to the case has always bothered him. Despite the department already having two other suspects, Benjamin and Pablo ultimately were certain that a man named Isidoro Gomez is the real killer. Although he is aware that historical accuracy is not paramount for the novel, the process of revisiting the case is more an issue of closure for him. He tries to speak to the key players in the case, most specifically Irene, who still works in the justice department and who he has always been attracted to but never pursued due to the differences in their ages and social classes. The other issue is that Gomez is still at large, no one aware if he is alive or dead. But as Pablo at the time mentioned that passion is one thing that cannot be changed in behavior, Benjamin learns now that that premise still holds true. (Read More)
| Subgenre: | legal drama |
| Themes: | escapemurderdeathlovefriendshiprevengekidnappingrapedrinkingfeardrunkennessinvestigationmemoryangercorruption …obsessionhumiliationsurveillanceabusecrueltydeath of wifevengeancewritingjusticeself sacrificepolice brutalitypolice investigationmurder of husbandrape and murder (See All) |
| Mood: | darkness |
| Locations: | bartraincemeterytaxielevatorpolice stationcourtroomofficetrain stationschool teacher |
| Characters: | husband wife relationshippolicemother son relationshipfriendteachergirlpolicemanphotographerwriterlawyersecurity guardalcoholicyounger version of characterself justicepolice dog …writing a novelpolice interview (See All) |
| Period: | 1970s2000syear 1974 |
| Story: | surprise visitalivehusbandagentattackfemale nuditybased on novelnuditybloodmale nudityviolencebare breastsfemale frontal nudityinterviewflashback …male frontal nuditydoggunsex scenekissfightcigarette smokingphotographchasesurprise endingtelephone calltopless female nudityvoice over narrationcryingcell phonebeatingcorpsetesticlesmachine gunurinationslow motion scenepunched in the facedrinkarrestbare buttsecretletterbooktearsrunningdead bodyinterrogationcafejailalcoholtelevisionsubjective cameracleavagefoot chasebedroomsoccerdeath of friendmontagefootballprisonernonlinear timelinejudgeman with glassessearchold womancoffeelatex glovesconfessiongraveprologuewidowerundercoverpassionfull frontal female nuditybankflowerscourtlong takepursuitdeath of husbandpigratsleepingtypewriterrecord playertwenty somethingflirtingmachismoeyeglassesocculttv newshuggingtearevelationbreaking and enteringdresscagefriendship between meninjurywoman with glassesrecordingjail cellcrucifixloss of loved onebeardloss of wifeassaultpuzzledead womanbosshomicideretirementwatching televisionwhiskeycrime scenehaunted by the pasttensionargentinaconstruction sitemobile phonepastpartnerco workernovelistfootball playerfrustrationevidenceaerial shotsurprisecaptureprison cellsuspectmustacheintruderstadiumrelease from prisoninjusticebruisepolice inspectordeath of loved onealarm clockmelancholycrowdphoto albumimprisonmentdead girlmysterious maninvestigatornotebookgatedark secretforced sexconstruction workerlocal blockbustermen's bathroomsuit and tiemale friendshiptelevision newswhistleanimal crueltyno title at beginninglatin americabearded mandistrict attorneystakeoutman kills a womanwrathdeath penaltymacguffinwriter's blockshort skirtprosecutorschoolteachersouth americamurder of wifesoccer playersoccer matchold photographcapital punishmentin medias resanguishbuenos aires argentinainspectorfemale bossretributionman hits a womanwrongful arresteyesflash cameraleg injurysleeping on a couchframed photographdignitycourthousescottishdrinking alcoholreading a lettersoccer fanaspiring writerbody part in titlealcohol abusenightstickdeath of partnerman punches a womanpublic restroomlong black hairred rosejudicial systemfandomfootball stadiumhitting a womantoilet stallfalse confessionharvard universityjudicialjudiciarykiss on the foreheadjudgmentbloody handcivil servantlegal systemwalking a dogsoccer gameunsolved crimeclimbing a fencesoccer stadium23 year oldangry manargentineemasculationbank clerkmusic score features pianoclosing eyes of dead personforced confessionjealous manthe pastlife imprisonmentsleeping on couchmaking lovereference to the three stoogeshierarchyvoice over writingunreliable flashbackmale sitting on a toiletangry bossgood cop bad coprotary phonehands upreference to don quixotedeductiondirty warkilling the wrong personreference to prince charmingbloody corpsefalse pretenseoperation condorinternal strugglekicking a dogblack and white televisiondate with coworkerdesk lampflashback montagefood traygoodbye at train stationkicking a doorsecluded housetouching handsco worker co worker relationshipcocking a guncornell universitydog barkingdog walkingmispronounce namepen and paperconfession under tortureneck scarfseeking justicecoerced confessionexposing one's penisillegal entrylong haired womanmurder of partnerprivate conversationwoman with long haircriminal courtfemale emasculating a malejudicial misconductshirt and tiewalking alone at night (See All) |
Alex, a psychopathic mechanic, rapes a woman in the park. Later, a decadent couple pull into his shop needing car repair. They invite Alex and his mentally challenged buddy to join them at a decadent suburban party. Once there, Alex amuses himself by tormenting and raping the guests...
| Subgenre: | independent filmpsycho thrillerindependent horroritalian horror |
| Themes: | murderdeathfriendshiprevengekidnappingrapemoneytortureseductionrobberypsychopathbrutalityhumiliationgamblingsadism …evilabusehome invasioncruelty (See All) |
| Mood: | goreslasherone night |
| Locations: | new york citysex in a car |
| Characters: | serial killerhostagebest friendkillervillainterrorself mutilationserial murderermurder of a friend |
| Story: | psychodrowningblood splattershowerfemale rear nudityfemale nuditysexnuditybloodviolencebare breastsfemale frontal nuditymale rear nuditydog …bare chested malefemale full frontal nuditydancingsingingpartyknifelesbian kisschasesurprise endingpistoltelephone calltopless female nudityshootoutbeatingcorpsefistfightcar accidenturinationface slapslow motion scenepunched in the facegunfightheld at gunpointsunglassescombatfoot chasegangstrangulationwomanfemale pubic hairgarter beltcontroversypantyhosepainparkbeaten to deathscreamingsuburbevil manknocked outshot in the shouldersadnessmurdererfirst partthreatened with a knifefreeze framemaniacfemale stockinged legshead buttpokerwoundsexual abusered dresscaptivecovered in bloodvictimparking garagemechanicrampagesufferinggash in the facepunched in the stomachescape attemptsexploitationpedophileknife fightblind mansexual assaultmisogynybloodbathlocation in titlepsycho killerbullet timegarterbushpervertserial murderpsychopathic killerbad guymadmanfire extinguisherviolence against womenmisogynisthuman monsterpink pantieslockersexual violencehomicidal maniacvillaslashingdegradationbullet ballethead bashed inhand over mouthrazorgun duelheld captivegun violencebumbleeding to deathcrotch grabgropingcadillacbloodshedbutt slapsuntan pantyhosefemale victimstrangled to deathsadistic psychopathmolestationshot in the crotchviolent deathbroken bottlebutcherygrindhouse filmsexual humiliationexploitation filmstraight razorcreepexit woundserial rapistgenital mutilationclothes rippingsexual predatorcut armbitten handpsycho terrorrich kidsexual sadismsexual torturetied to a postsexual crueltyhand on crotchgun saubanned filmheld hostagecollarhouseguestitalian cinematorturerscarred faceurinating on someonementally challengedtouching someone's breastsperversityfalling into a swimming poolnude paintingvideo nastysickotwo in a showerdisco musictransgressionbald womanthrown through a glass doorsuspension bridgetransgressive filmmuffradiatorsex maniacturning the tablesabuse against womentrapped in a housewoman haterpredator turns victimfirst of two partspredator becomes preyserial rape (See All) |
While playing with a puzzle, a teenager is repressed by his mother, and he kills her and severs her body with an ax. Forty years later, in an university campus in Boston, a serial killer kills young women and severs their bodies in parts, stealing body pieces from each student. Lt. Bracken makes a d …eal with the dean of the campus, and infiltrates the agent Mary Riggs as if she were a tennis teacher and together with the student Kendall, they try to find the identity of the killer. (Read More)
| Subgenre: | independent filmcult filmsuspenseb movieb horroramerican horroritalian horrorsadistic horrorspanish horror |
| Themes: | murderdeathfriendshipfearvoyeurismcorruptionpsychopathbrutalitydrug useinsanitymental illnesssadismevilexploitationcruelty …trauma (See All) |
| Mood: | gorenightslasherdarknessblood and gore |
| Locations: | swimming poolwaterelevatoroffice |
| Characters: | friendpolice officerserial killerpolicemanvillainsecretaryterrorslasher killermysterious villainserial murderer |
| Story: | psychoagentdecapitationblood splatterfemale rear nudityfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditybare chested male …male full frontal nuditysurprise endingfondlinghigh heelsbeatingcorpseurinationblondeslow motion scenegunfightbikinidead bodylow budget filmvoyeursubjective camerabraold manaxemassacrestabbingstabbed to deathtoiletchild abusebrunettesevered headcontroversypantyhoseshot in the foreheadattempted murderstalkerdangerscreamingcharacter's point of view camera shotevil manuniversitymanipulationstalkingballetdismembermentkillingmaniacchainsawfemale stockinged legsdesireragemutilationdesperationswimsuitsevered handgrindhousevictimdead womantowelcamera shot of feetrampagewoman in jeopardyboston massachusettsmercilessnessbutcherpsychotronicfrustrationperversiondisfigurementcastrationdark pastbody countaxe murdercharacters killed one by onedead woman with eyes opendead motherkilling spreebloodbathpsychoticpsycho killerbullet timefemale stockinged feetpervertserial murderpsychopathic killerbad guybeheadinggirl in bra and pantiesconfusionmadmanmysterious mankillglovesscene before opening creditshuman monsteralonerepressionsexual violencehomicidal maniacrestroomslashingboy with glassesblood stainwetting pantsdying mandruggedcarnagesawuniversity studenthead cut offkiller childextreme violencegraphic violencesexual repressionmultiple murderknife murderbloody violencegiallofemale victimsadistic psychopathoff screen murdermurder of a nude womanmurder spreedisturbed individualgrindhouse filmcreepcurtainmysterious strangerfedoradead woman on floordeeply disturbed personmystery killeraxe fightdecomposing bodymultiple homicidehand cut offpsycho terrorblack glovesco edtennis playerweirdopranksterjigsaw puzzledisturbingdecapitated bodysevered penistorturerdead woman on groundphantomcuttingdrive in classicnude pantyhoseperversitywaterbedgory violenceeast coastsickoman and woman in bedgruesomeson murders motherfemale corpsebody partschainsaw murderunknown killerfemale stockinged solesmutilated bodyurinating in feardark killerfemale urinatinghead chopped offbrutaltroubled childhoodchild killing an adultfemale victimsblack gloved killerunintentional humorabusive childhoodchainsaw fightson kills mothermentalitybostondisturbedspanish giallochild as murderer (See All) |
When hundreds of videotapes showing torture, murder and dismemberment are found in an abandoned house, they reveal a serial killer's decade-long reign of terror and become the most disturbing collection of evidence homicide detectives have ever seen.
| Subgenre: | mockumentaryfound footageamerican horrorindependent horror |
| Themes: | escapemurderdeathsuicidekidnappingrapefeartortureinvestigationcorruptionpsychopathbrutalityguiltinsanityhumiliation …sadismevilhome invasionexecutionexploitationcrueltypanictraumamadnessmurder investigationmysterious deathpsychological trauma (See All) |
| Mood: | gorenightslasherdarkness |
| Locations: | hospitalcemeterywaterpolice carroad tripgas stationpennsylvania |
| Characters: | policeprostitutegirlpolice officerserial killerlittle girlvillainterrormysterious villainserial murdererout of controlmysterious killer |
| Story: | psychonew yorkblood splattershowerfemale nuditynuditybloodviolencefemale frontal nudityinterviewbondageknifepantiestelephone callcrying …beatingcorpsecameramasktearsrunningbedbathroomtelephonereportersubjective cameranewspaperbedroomjournalistbound and gaggedaxevideo camerastabbingthroat slittingstabbed to deathprisonerhousemapchild abusefalse accusationman with glasseschildgraveyardnews reportlooking at the cameratalking to the camerastalkerbeaten to deathscreamingfbimissing personevil mantragic eventstalkingautomobilethreatbasementtrapmurderernewspaper headlinedismembermentkillingchild murdermaniactv newsbreaking and enteringballoonstreetsexual abuseragemutilationsecurity cameracaptivefbi agentassaultvideotapedesperationgrindhousevictimjournalismdriving a carrapistdead womantowelhomicidemasked mansubmissionslaverampagehookersufferingcouchkickingmercilessnessball gagstabbed in the neckanxietybutcherdespairscene after end creditspedophiledisembowelmentsurprisehandheld cameraperversiondead manmurder of a childhighwaybody countfemale reporternervous breakdownliving roominjusticecellarkilling spreemisogynychloroformpsychoticmasked killerpsycho killersurprise after end creditsdead girlpervertpsychopathic killerbad guymadmanmysterious manbrainwashingnecrophiliaset uppedophiliamisogynisthuman monsterhogtiesex slavesexual perversionsexual violencehomicidal maniactv reportermasochismslashingdegradationframednihilismamputationkidnappermissingdnasnuff filmsawnaked dead womandecadencemenacenervousnessdeath sentencemultiple murderchild molestertormentknife murderfemale prisonerpsychological tortureriskanguishbloody violenceroadfemale victimangstsadistic psychopathtapetalking while drivingmolestationmurder of a nude womanmurder spreecriminal investigationdisturbed individualbutcheryvideo cassettecrime spreecaptivitymissing daughterdepravityloss of controlfemale journalistsidewalkmissing girlstockholm syndromechild killedmystery killerfetishismmass mediamultiple homicideruthlessnessviral videosexual sadismchild killercreepysexual crueltychild murdererbreakdowndisturbingperiltorturerdead prostitutedehumanizationmissing womancollapsemasked womanknife attackserial child killerperversity911 callgrave robbingeast coastpsychological tormentgruesomeparaphiliadeviant sexglass of waterkidnapped womanunknown killerfemale fbi agentjeopardyinhumanitynecrophiliachelplessnessjustice systemmysterious personfbi investigationsexual devianttorture victimoutragephysical torturebound in chainsbrutalwoman in toweldna testhomicide investigationkidnap victimbrainwashassailantdysfunctionalityserial child murdersexual aberrationfemale slavedisturbed personfbi profilerloss of humanitydysfunctional societyneedlesprowlerfemale captivechelsea smiledefenselessnesstormentorphysical tormentpoughkeepsie new yorkdepravationhandsawdisturbed man (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
| Subgenre: | martial artsblack comedysupernaturalparanormal phenomenadark fantasymonster movie |
| Themes: | escapeghostmurderdeathfriendshiprevengesurrealismkidnappingbetrayalfearmonsterdeceptionmagicmilitaryseduction …angersupernatural powerparanoiaredemptionsurveillanceevilpaniccourageself sacrificenear death experiencemurder of familyunlikely heroegyptian mythology (See All) |
| Mood: | darknesshorror movie remake |
| Locations: | trainchurchforesthelicoptercemeteryairplanebusdesertlondon englandwoodspolice carrooftopmuseumlaboratorytunnel |
| Characters: | policedoctortattoozombiesoldierpolice officerpriesthostagethieftough guywarrioraction herosecurity guardprofessoramerican abroad …self mutilationbabe scientistamerican in the uk (See All) |
| Period: | 2010s |
| Story: | attackdrowningritualblood splatterfemale rear nuditybloodviolenceflashbackdogbare chested malefightexplosionknifechasesurprise ending …pistolfireshootoutbeatingdreamcorpseshot to deathfistfightmachine gunhorsecar accidentshot in the chestface slapremakeshotgunrescueslow motion scenepunched in the facebattlegunfightbrawlbare buttshowdownheld at gunpointbeerhand to hand combatsunglassescar crashhallucinationcombatscientistshot in the backsubjective cameragood versus evilfoot chaseflashlightambushstrangulationaxemassacreambulancedeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestsubwayman with glassesno opening creditsanti herodisarming someoneone man armycoffinassassinationdouble crossunderwater scenekingpolice officer killedfemme fatalenews reportshot in the legprincesstransformationflash forwardattempted murderpilotcursebinocularscharacter repeating someone else's dialoguebeaten to deathdangerprologuescreamingelectrocutionfantasy sequencecharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outlightningopening action sceneskeletonmanipulationscarinjectionlaptopratthreatened with a knifemercenarypubsubtitled sceneundeadbattlefieldpowerak 47pickup truckmissiledestinyhand grenadegrenadedestructionassassination attempthypodermic needlegothictape recordersecurity camerawalkie talkiemad scientisttreasuremorguesergeantkicked in the stomachspidervillainesspoolskullknightmind controltorchfateburialcolonelback from the deadiraqgun battleguardrampagecrime scenereverse footagemiddle eastvisiontarget practicebraveryu.s. armyconstruction sitefight to the deathpartnermercilessnesspower outageegyptstabbed in the neckresurrectionevacuationimmortalityescape attemptspecial forcesstabbed in the legpunched in the chestairplane crashaerial shotparachutewisecrack humorcapturebulletproof vestdemonic possessionblack magictelekinesisdaggerstick fightmoral dilemmamedia coveragetelepathycrowclose up of eyestombsidekickliving deadalleyfinal showdownburied alivetasermummyconstruction workerpistol whiphuman monsterarmored carhuman sacrificeworld dominationdronecomic reliefsecret societymegalomaniacold flamesplit personalityfilm starts with textartifactpatricideman kills a womanoffscreen killingbitten in the neckmacguffinwoman kills a manaltered version of studio logoheirchainedarcheologistopen endedalter egowoman fights a manimmortalmatricidesubterraneangodwoman slaps a manjewelcockney accentmind readingimprovised weaponcar rolloverancient egyptarmy basechosen onestupid victimrelicbilingualismdeal with the devilthronemad doctorsecret roomfratricidecryptinfanticideregenerationtragic villainwomen's bathroomarchaeologistdecomposing bodyenglishwoman abroadsecret organizationbig ben londonzero gravityman fights a womanair strikecorporalcollapsing buildingserumpharaohharpoonsandstormrebootfragments of glassmultiple personality disordertreasure hunterexcavationpharoahhit with a car doorburied treasuresecret laboratoryexplosive decompressionarcheological digevil godjekyll and hydelondon undergroundjackhammerrubyinsurgentflipping caryin and yanglondon eyeairplane pilotcargo planecatacombcrusaderlovecraftianreanimated corpsereboot of seriessoldier of fortunebookshelfgemstonesarcophagusmercurycontemporary settingrogue soldierfaustianhieroglyphicsegyptian godsecret lairlondon busheir to thronemilitary operationliterary charactersecret chamber1190sburial sitefemale archeologistdark universemonster hunter (See All) |
It's 1954, and up-and-coming U.S. marshal Teddy Daniels is assigned to investigate the disappearance of a patient from Boston's Shutter Island Ashecliffe Hospital. He's been pushing for an assignment on the island for personal reasons, but before long he wonders whether he hasn't been brought there …as part of a twisted plot by hospital doctors whose radical treatments range from unethical to illegal to downright sinister. Teddy's shrewd investigating skills soon provide a promising lead, but the hospital refuses him access to records he suspects would break the case wide open. As a hurricane cuts off communication with the mainland, more dangerous criminals "escape" in the confusion, and the puzzling, improbable clues multiply, Teddy begins to doubt everything - his memory, his partner, even his own sanity. (Read More)
| Subgenre: | cult filmsuspensepsycho thrillerconspiracy theory |
| Themes: | escapemurderdeathrevengesurrealismprisontortureinvestigationdeceptionmemorypsychopathparanoiaguiltinsanityexecution …holocausttraumapsychological trauma (See All) |
| Mood: | rainneo noirnightmareambiguous ending |
| Locations: | shiphospitalsnowcemeteryboatwoodsseacavestormcar explosionwater gun |
| Characters: | husband wife relationshipdoctortattoogirlsoldierserial killernursedetectivereference to godlittle girlalcoholicpsychiatristamerican abroadgerman soldier …talking to oneself in a mirrorcolleague colleague relationshipself delusionamerican in europeamerican in germanygerman doctor (See All) |
| Period: | world war two1940s1950syear 1945 |
| Story: | asylumcaptainattackblood splattershowerbased on novelbloodmale nudityviolenceinterviewflashbackmale frontal nuditymale rear nuditytwo word titlebare chested male …gunkissfightcigarette smokingphotographtitle spoken by charactermale full frontal nudityexplosionsurprise endingpistolfirecryingdreamcorpseshot to deathshot in the chestslow motion scenepunched in the facesecretvomitinglierifleheld at gunpointplace name in titledead bodyinterrogationhallucinationhandcuffsislandmale pubic hairrevolvershot in the backf wordfoot chasestrangulationmassacrewidowexploding carman with glassesno opening creditsdream sequenceradiodrawinggraveyardcigar smokingracial slurgunshotfbifantasy sequencemissing personcover uplightningscardisappearanceinjectionhairy chestwitnessratsuspicionmurderercharacter says i love yougardenhandguntherapychild murdercold warexperimentsyringemedicinerevelationreference to adolf hitlermass murderjeepgothiccagelistening to musictape recorderwoman with glassesjail cellfbi agentcrying womanpsychologybarefoot malecovered in blooddead womanschizophreniafemale killerchokingmental institutionrole playingguardprison guardimaginationwindblood on faceboston massachusettsmanhuntpower outageshot in the facemental hospitalplot twistpost traumatic stress disorderdelusionconcentration campdead manracistrainstormcliffdisfigurementfemale doctornotebarefoot femalechaincellarferrypipe smokingarrogancemale in showerdead girllighthousetombtaking a showerbarbed wiremental patienthysteriaillusioninvestigatorharborbrainwashingnotebookdockspiral staircasebottlealarmdead childrenfenceblackouthomicidal maniaccamera shot of bare feetfemale psychopathstabbed in the armblood stainhospital roomfortresshurricaneinsane asylumgramophonebunk bedpipeashespondcar set on firebadgelighting a cigarettemurderesspsychotherapycelldeath of familyfemale prisonerdead wifejailbreakdeath by drowningtoy guntraumatic experienceportwet clothesdeath by gunshottiehouse on firehusband murders wifepunch in faceknocked out with a gun buttmale vomitingfortphonographworld war two veteranscreaming womanwrapped in a towelcryptinfanticidered herringescaped mental patientfedorabloody body of a childpolice partnerwardentalking to oneselfhysterical womandustmedical experimentmental asylumnecktielearning the truthbrain surgerypretending to be someone elsemausoleumtorture chamberhuman experimentationfemale serial killerrepressed memoryu.s. marshalhysterical outburstorderlychild murdererfilicideblood on handsscarred facesedativelobotomytalking to the deaddark and stormy nightpsychotherapistconfinementfantasy scenefemale psychiatristelectric fenceseasicknesslake housewar traumafemale murdererfalling treehallucinogenreference to j. edgar hooverdeath camppyromaniacsecret experimenttaking a pilltideyear 1952murder by drowningreality vs fantasymigrainehole in chestyear 1954heavy smokerphilosophical conversationsetting a firehallucinogenic drugfbi investigationanagramreference to franz kafkaspeaking germantalking with the deadcontainmentcriminally insanehysterical manlighting someone's cigaretteregressionhidden agendareference to johannes brahmschild drowningmass executionpipe smokerpsychematchstickpsychiatric nursereference to gustav mahlertriple child murdercagedlighting a matchtalk to the deadarrogant manmemory gamesparanoid schizophrenictaking notesface injuryphone line cutphotosensitivitypsychotic killerelongated cry of nonew colleaguetalking to a dead bodytraumatic shockaltered perceptiondachau concentration campdenouementdrowned bodyleaky rooflunacymother murders own childblind eyecarrying a childdetective as protagonistisland fortressseaside clifftaking a medicationtalking to one's dead wifeturned into dustboston accentexperimental therapytalking to one's dead husbandchild killed by motherdeputy marshalmigraine headachemurderer as protagonistpicture of hitler (See All) |
Mike Locken is one of the principal members of a group of freelance spies. A significant portion of their work is for the C.I.A. and while on a case for them, one of his friends turns on him and shoots him in the elbow and knee. His assignment, to protect someone, goes down in flames. He is nearly c …rippled, but with braces is able to again become mobile. For revenge as much as anything else, Mike goes after his ex-friend. (Read More)
| Subgenre: | martial artsblack comedysuspenseconspiracy |
| Themes: | escapemurderdeathrevengemoneybetrayaldeceptioncorruptionpsychopathbrutalityredemptionsurveillancevengeance |
| Mood: | car chase |
| Locations: | shiphospitalmotorcycleairplaneboattaxiairportwheelchairrooftopstrip clubsan francisco californiasinging in a carcar bombchinese restaurant |
| Characters: | husband wife relationshipfather daughter relationshipdoctornursehostagetough guyaction herohitmanjapanesesniperasian americanchinesesniper riflepolice chasechinese american |
| Period: | 1970s |
| Story: | securityblood splattershowerfemale rear nudityfemale nuditybased on novelnuditybloodviolenceflashbackbare chested malegunfightcigarette smoking …explosionpartyknifechasesurprise endingpistolshootoutcorpseshot to deathfistfightmachine guncar accidentshot in the chestface slapshot in the headshotgunslow motion scenepunched in the faceswordgunfightbrawlbare buttfalling from heightshowdownrifleheld at gunpointhand to hand combatbombcar crashrevolverstripperkung fushot in the backspysurvivalgay slurflashlightassassinsword fightmassacreambulancedeath of friendstabbed to deathmixed martial artspoliticianstabbed in the chestanti heroassassinationdouble crossshot in the legracial slurstalkercharacter repeating someone else's dialoguevirginstabbed in the backkaratestripteasepay phoneninjakicked in the faceopening action scenescene during end creditsstreet shootoutshot in the shouldermanipulationbodyguardpremarital sexcabinmercenaryshot in the armsilencerespionageciafreeze framehenchmansurgerymachismouzifalling down stairsassassination attemptwoundmachetesociopathjoggingsecurity camerawalkie talkiekicked in the stomachphone boothirishmexican standoffgun fustreet lifegun battlemoralitypassportmechanicreverse footagetarget practicekatana sworditalian americanhit in the crotchpartnerpunched in the chestdynamiteassault riflewisecrack humorgasolinepiersword duelstick fightpipe smokingshot multiple timessouthern accentbullet timemale in showerimpersonating a police officercia agentharborset upexotic dancerspiral staircasearmored carsarcasmsailboatbullet balletpush upsstethoscopefilm starts with textgun duelrecoverysword fightingbloodshedcorrupt officialgarbage trucklimpmotorcycle coptai chimartial arts traininggolden gate bridgechinatowntommy gunwitness protectionprotectioncat and mousedojoone last jobtime bombsecret organizationcoming out of retirementshurikenmale camaraderiedefectorleft for deadfemale ninjasexually transmitted diseasephysical therapyshot in the kneeabandoned shiparm castauto repairginscotch whiskeystitchesleg castroninhired gunskeet shootingbuilding explosionplastic explosivefleetscoped rifleloading a gunbody searchbedpanslipping and fallingwoman wearing a g stringboeing 737crippled manemergency surgerywalking with a caneex partnertriple crosseating with chopstickselectric shaverninja assassinabandoned boatcia operativedisabled malepolitical extremism (See All) |
A community of mutant outcasts of varying types and abilities attempts to escape the attention of a psychotic serial killer and redneck vigilantes with the help of a brooding young man who discovers them. Based on the novel "Cabal" by Clive Barker.
| Subgenre: | independent filmmartial artscult filmblack comedysuspensesupernaturalstop motion animationcreature featuredark fantasychrist allegory |
| Themes: | escapeghostmurderdeathloverevengesurrealismsuicidekidnappingbetrayalfeartorturedrunkennessmonsterinvestigation …deceptionangerpsychopathbrutalitysupernatural powerparanoiaredemptioninsanityfaithhome invasionexploitationhopeprejudiceself sacrificepolice brutalitymurder of a police officernear death experiencemurder of familyunlikely hero (See All) |
| Mood: | gorenightmarenightdarkness |
| Locations: | hospitalbarcemeterypolice stationpolice carcanadamotelcavegas station |
| Characters: | policemother daughter relationshipboyfriend girlfriend relationshipdoctortattoosingerpolice officerserial killernursedetectivepriesthostagetough guypolice detectivevillain …psychiatristbiblepolice shootoutself mutilationcoronershooting a police officerpolice sergeantself cutting (See All) |
| Period: | 1980s1990s |
| Story: | attackdecapitationblood splattershowerfemale nuditybased on novelnuditybloodviolenceone word titlebare breastsflashbackdogbare chested malefight …cigarette smokingnipplesphotographtitle spoken by characterexplosionknifechasesurprise endingpistolfiretopless female nudityshootoutbeatingdreamcorpseshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewatching tvcatwritten by directorbattleswordarrestgunfightbrawlfalling from heightvomitingshowdownrifleheld at gunpointhand to hand combatsunglassesbombcar crashinterrogationdemonjailhallucinationrevolvertelephoneshot in the backf wordsubjective cameragood versus evilsurvivalfoot chaseambushstrangulationtoplessmassacrestabbingdeath of friendmontagethroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chesttied to a chairsnakeexploding carfalse accusationsevered headdream sequenceanti herocoffindrawingchild in perilhit by a carfictional wardouble crosscreaturepolice officer killedgraveyardcigar smokingshot in the legtransformationshot in the foreheadbartenderone against manybeaten to deathstabbed in the backscreamingperson on firefactorycharacter's point of view camera shotproduct placementrace against timestatueevil manknocked outkicked in the faceskeletonshot in the shoulderscarexploding bodyneck breakingmurdererdie hard scenariothreatened with a knifesevered armshot in the armvigilantecult directornewspaper headlineundeadbattlefieldchild murdermaniacak 47pickup truckanswering machinedestinyfalling down stairshand grenadedestructionburned alivegothicmachetetape recordersociopathlifting someone into the airmutantragebarnjail cellmorgueexploding buildingkicked in the stomachspiderswat teamfemale singerpress conferencegrindhouseskullrocket launcheranimal attacksocial commentaryback from the deadmasked manpresumed deadmental institutioncamera shot of feetrampageredneckcrime scenereverse footageswitchbladestealing a carvisionexplosiveticklingfight to the deathhatredmercilessnesschaosgash in the faceresurrectionkicked in the crotchnippleprophecyimmortalityframe upbible quotepunched in the chestdynamitediscriminationbooby trapknife fightwisecrack humorblood on shirteye gougingslaughterdisfigurementtribebody landing on a carknife throwingsiegebody countmutationlasersightpolice inspectorkilling spreeflamethrowerburned to deathmasked killermoral dilemmaframed for murdershot multiple timesmale in showertombpsychopathic killerbad guymental patientyellingsunsetoutcaststuffed animalbaptismhuman monsterspiral staircaseabuse of powerpolice officer shot in the chestarmored carsuper strengthhomicidal maniacmilitiahangoversecret societyhideoutburnt faceman in underwearlsdkittenpolice captainhit by a truckexploding truckfactory workermercy killingone linershamandruggedtentacleoffscreen killingbitten in the neckdisembodied headstabbed in the shoulderbullet woundfight the systemwoman in lingeriecar set on firecrotch grabgraphic violenceopen endedstabbed in the facewalking deadsubterraneanjailbreakku klux klandeformityvending machineimprovised weaponschizophrenictommy gunburn victimanimal killingmass murdererstupid victimwrongful arrestclimbing out a windowglowing eyesknocked out with a gun buttarmoryinnocent person killedmad doctorcryptknife held to throatthroat cutlandmineangry mobfalling through the floorcityscapemodern westernbanishmentcut armtortured to deathgarrotebuilding collapsedrinking bloodinvulnerabilityrunning for your lifeface ripped offmausoleumtaxidermyhand through chestpolice vigilantismsunlightpoison gascaged humanscalpingdeityoutrunning explosionspikerope bridgeadaptation directed by original authorkilled in police caralberta canadahuman skeletonpolice officer bombedinitiation ritestabbed through the chestdumb policeexposed brainvoice recordingdouble impalementrecurring dreamhockey gamehunting knifehole in chestknife in chestpoison darttrip wirefalling into a holeporcupinehandprintbetrayedface burnhouse of cardsspontaneous human combustionleather maskidentifying dead bodyford pickupcop killed by a copkiss of deathlighting a cigarscenic beautyface slashedhole in a walliron gatemurdered friendthrowing knifefriend murdered (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
| Subgenre: | martial artsblack comedysuspensepunk |
| Themes: | escapemurderdeathrevengekidnappingbetrayallesbianismfeartorturedrunkennessinvestigationdeceptionseductionbrutalityparanoia …sadismhome invasionpanic (See All) |
| Mood: | goreneo noircar chase |
| Locations: | barrestauranttrainhotelsnowmotorcycleairplaneparis francebathtubnightclublondon englandwatertaxiairportelevator …apartmentpolice carrooftoptunneltrain stationcar firecar in watercar into waterescape from a car in water (See All) |
| Characters: | husband wife relationshippolicefather daughter relationshipmother daughter relationshiptattoofemale protagonistsoldierpolice officerhostagehitmansniperrussiangermanamerican abroadpolice shootout …sniper riflepolice chasecoroneramerican in the uk (See All) |
| Period: | 1980syear 1989 |
| Story: | aliveattackdrowningblood splatterfemale rear nudityfemale nudityf ratedbased on novelbloodmale nudityviolencebare breastsflashback …two word titlebare chested malegunsex scenefightcigarette smokingphotographexplosionpartyknifelesbian kisschasesurprise endingpistolfiretopless female nudityvoice over narrationshootouthigh heelsbeatingcorpseshot to deathfistfightmachine guncar accidentshot in the chestblondeshot in the headrescueslow motion scenepunched in the facecameragunfightbrawlfalling from heightbased on comicshowdownheld at gunpointbeerhand to hand combatsunglassesbedcar crashdead bodyinterrogationbritishcolor in titlerevolverfightingtelephonekung fushot in the backf wordspybisexualsurvivalfoot chasebraassassinbased on comic bookambushstrangulationmassacredisguisewomanmontagethroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestnonlinear timelineexploding carman with glassesradiodisarming someonehit by a cardouble crossbathunderwater scenepolice officer killedvanfemme fatalenews reportshot in the legshot in the foreheadbartenderlatex gloveson the rungunshotflash forwardattempted murderone against manystalkerhotel roombinocularscharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuekarateprotestpay phoneumbrellamissionundercoverproduct placementrace against timecover upknocked outkicked in the facetough girlopening action scenelong takemanipulationscarwigstalkingneck breakingpremarital sexsuspicionthreatened with a knifeprofanityhandgunsecret agentsilencerlove interestespionageciasubtitled scenekillingarsonstylized violencehenchmanberlin germanyriotcold waritalianiceropetraitorfalling down stairsbulletrevelationhead buttassassination attemptelectronic music scorewoundheavy rainscene during opening creditstold in flashbackbeardmorguekicked in the stomachcaucasianmovie theatereccentricwristwatchphone boothjumping from heightcovered in bloodbuttskateboardstrong female leadfollowing someoneaction heroinefemale killerfemale warriorpassportthugstealing a carblood on facefight to the deathintrigueresistancestabbed in the throathit in the crotchmercilessnessshot in the faceevacuationescape attemptstabbed in the headblack bracigarette lightertime lapse photographystabbed in the legpunched in the chestassault rifleaerial shotblack eyeknife fightblood on shirtundercover agentbody landing on a carknife throwinggasolinepolice raiddressing roombruisewilhelm screamswearingstick fightroundhouse kickfast motion scenevodkafemale assassinenglishman abroadbisexual womanblood on camera lenscia agentporn magazinehistorical fictionalleyfinal showdownset uppistol whipscene before opening creditssuit and tieblonde womanarms dealerwatchstabbed in the armfemale spybearded manshot in the eyefilm starts with textcigarettebased on graphic novelstrong languageman kills a womangun violencekgbmacguffinraveski maskwoman kills a manaudio cassettejudocar set on fireshot in the throatmetal detectortwo way mirrorgraphic violencelighting a cigaretteoverturning carberlin wallrogue agentstabbed in the facespy herowoman fights a manmagnifying glassbloody violencedeath by drowningfrenchmanpool of bloodstrangled to deathsecret policeone woman armyimprovised weaponcar rolloverfreedom fighterresistance fighterabandoned warehouserookieanti heroineassassination plotbreaking a bottle over someone's headdouble agentknocked out with a gun buttwalkmanwiretappingbilingualismhidden gunslow motion action scenecassette tapeenglishwoman abroadwoman punches a mangarrotecrushed by a carman fights a womanbrass knucklesblond hairdefectorman punches a womanbatonblood on handsborder guardfrenchwomanbritish secret serviceaudio recordingstabbed in the foreheadbritish intelligencewearing a sound wireneonlistcode nameneon lightmicrofilmfake passportstasiforgerc wordstolen police carsmoking a cigarettesex on bedknife in chestrussian spymi6stabman with a ponytailghetto blastercar falls into waterdrownedtough womancivil unrestdrownlighting a cigarette for a womaneast berlinkgb agentice bathphotographic memorytrapped underwaterphoto labwearing a wirewatchmakerhand in pantieswest berlincounter espionageeurospylesbian sex scenetelevision news reportcar falling into waterreference to david hasselhoffgarrotteoni presssubmerged in car (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their … dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
| Subgenre: | independent filmcult filmsupernaturaldark fantasyurban fantasy |
| Themes: | escapemurderdeathrevengesurrealismkidnappingbetrayalpregnancyfeardeceptionextramarital affairangerbrutalitysupernatural powerdeath of mother …paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All) |
| Mood: | gorenightdarkness |
| Locations: | trainswimming poolairplanebathtubelevatorurban settingapartmenttruckrooftoprussiatunnelyachtfire escape |
| Characters: | witchfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherlittle boyrussian …pregnant womanself mutilation (See All) |
| Period: | 1990s2000s20th century21st centuryyear 1992 |
| Story: | decapitationblood splatterfemale rear nudityfemale nuditybased on novelbloodviolenceflashbackdogtwo word titlebare chested malefightphotographtitle spoken by characterexplosion …knifechasesurprise endingvoice over narrationcell phonebeatingcorpsehorserescueslow motion scenepunched in the facebattleswordarrestbrawlbare buttshowdownsunglassesneighborsubjective cameragood versus evilfoot chaseflashlightsword fightambushconcertaxebridgearmyimpalementstabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuescreamingcharacter's point of view camera shotmissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetlifting someone into the airexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingpsychotronic filmimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
| Subgenre: | independent filmcult filmamerican horrorsadistic horror |
| Themes: | escapemurderdeathrevengesuicidekidnappingrapetortureinvestigationvoyeurismseductionpsychopathbrutalityinsanityhumiliation …sadismevilabductioncrueltyvengeancemadnessrape and revengerape and murder (See All) |
| Mood: | gorehigh schoolnightmareslasher |
| Locations: | swimming poolforestcemeterylakerunning through the woods |
| Characters: | family relationshipsfather son relationshippoliceteenage girlserial killerreference to godkillervillainsheriffterrorslasher killerserial murdererself justice |
| Period: | 1970s |
| Story: | husbandblood splattershowerfemale rear nudityfemale nuditybloodviolencefemale frontal nuditydoggunfightfemale full frontal nudity …knifepantiesshot to deathurinationremakeshootingbeerbirthdaymarijuanavoyeurfoot chasebound and gaggedgangconcertstabbingthroat slittingstabbed to deathtoiletfemale pubic hairwhite pantiesscantily clad femalebathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionevil manringconvertiblefemale removes her clothesmurdererchickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralessmaniacchainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creammutilationgrindhousevictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertserial murderpsychopathic killerprayingbad guymadmancannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual perversionsexual violencehomicidal maniacelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbloody violencesadistic psychopathbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All) |
The Girl on the Train is the story of Rachel Watson's life post-divorce. Every day, she takes the train in to work in New York, and every day the train passes by her old house. The house she lived in with her husband, who still lives there, with his new wife and child. As she attempts to not focus o …n her pain, she starts watching a couple who live a few houses down -- Megan and Scott Hipwell. She creates a wonderful dream life for them in her head, about how they are a perfect happy family. And then one day, as the train passes, she sees something shocking, filling her with rage. The next day, she wakes up with a horrible hangover, various wounds and bruises, and no memory of the night before. She has only a feeling: something bad happened. Then come the TV reports: Megan Hipwell is missing. Rachel becomes invested in the case and trying to find out what happened to Megan, where she is, and what exactly she herself was up to that same night Megan went missing. (Read More)
| Subgenre: | suspensemelodramapsychological thriller |
| Themes: | escapemurderdeathfriendshiprevengemarriageinfidelitybetrayaljealousypregnancyfeardrunkennessinvestigationdeceptionvoyeurism …memoryextramarital affairangerpsychopathparanoiadepressionredemptiongriefhome invasionpanicunemploymentamnesiaaffairpolice investigation (See All) |
| Mood: | neo noirnightmare |
| Locations: | new york citybarrestauranttrainforestcarmotorcyclebathtubwoodsapartmentpolice stationpolice cartunneltrain stationsex in shower …sex in the woodssex in woods (See All) |
| Characters: | husband wife relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipfemale protagonistdetectivebabyartistalcoholicpolice detectivepsychiatristex husband ex wife relationshipcrying babypolice sergeant |
| Story: | husbandnew yorkblood splattershowerfemale rear nudityfemale nudityf ratedbased on novelnuditybloodviolencebare breastsfemale frontal nudityinterviewflashback …masturbationmale rear nuditybare chested malesex scenekissnipplesphotographknifesurprise endingpantiestopless female nudityvoice over narrationcryingcell phonewoman on topbeatingcorpseblondeslow motion scenecomputerarrestsex in bedbare buttsecretpaintingrunninghallucinationvoyeuralcoholcriminalf wordsubjective camerastrangulationtoplesswomanstabbed to deathnonlinear timelinebrunettefalse accusationno opening creditsdrawingdouble crossnews reportattempted murderpublic nuditystalkerbeaten to deathdangerfired from the jobfantasy sequencecharacter's point of view camera shotmissing personcover upknocked outfemale full rear nuditymanipulationdisappearancestalkingdeath of husbandlaptoppolicewomanpremarital sexsuspiciongardenprofanitytherapycheating wifehatemaniactopless womaneavesdroppingrevelationaddictionsociopathjoggingbeardbuttockscrying womantherapistdriving a carart galleryfollowing someonenaked womanblood on facestabbed in the throathatredpool tablestabbed in the necknippleblood on shirtcellphonebalconyred pantiesdark pastdivorceephonefemale in showerabusive husbandneighborhoodswearingmiscarriagelyingnannywoman in bathtubmemory lossimpotencetaking a showerdark secretviolence against womenreference to facebookplaying pooltwist endingnudesuit and tiegolf clubblackoutrear nudityshoutingwhodunitfacebooknihilismstrong languageman kills a womanscene of the crimewoman kills a mancowgirl sex positiondomestic abusenymphomaniacfemale coptragic pastimprovised weaponflashback within a flashbackalcoholics anonymousnakedwrongful arrestbreaking a bottle over someone's headbreaking a mirrorsex from behindjealous husbanddrunken womanloss of memorysex addictiondecomposing bodyenglishwoman abroadborderline personality disorderfemale in a showerlearning the truthbutt nakedsex addictbritish actor playing american characterdead husbandsnorricamwoman's bare buttbeer bottlehit with a rockmissing womanipadsex with neighborwoman in a bathtubdrunk womanbludgeoned to deathmurder of a pregnant womantherapy sessionfemale full back nudityunreliable narratorquitting jobex husbandwoman showeringbare assnaked outdoorspool ballcorkscrewsplashed with watergrabbed by the throatwoman beaterman and woman naked in bednihilistbath tubnude showerself defenceshoweringnarcissistic personality disorderpositive pregnancy testwriting on a mirrorcowgirl sexmentally disturbed personlipstick on mirrornaked woman in beddiscovering one is pregnantwife kills husbandgaslightinggetting drunknude outsidefemale back nuditykilled with a knifesplashing wateralcoholics anonymous meetingnude woman in showervoice messagedeath of ex husbandangry husbandburner phone (See All) |
While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro …ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)
| Subgenre: | american horror |
| Themes: | escapemurderdeathfriendshiprevengekidnappingrapetorturepsychopathbrutalityguiltsadismcrueltyvengeancemurder of a police officer |
| Mood: | goreslasherhorror movie remake |
| Locations: | forestboatwoodskitchenlakemotelstorm |
| Characters: | husband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipteenage girlserial killerhostagekillerterrorserial murderer |
| Story: | husbandblood splattershowerfemale rear nudityfemale nuditybloodviolencefemale frontal nuditybare chested malechasepantiespistolcell phonebeating …corpsecar accidentshot in the chestremakeshot in the headpunched in the facemaskheld at gunpointcar crashshot in the backswimmingcleavagefoot chasebound and gaggedwinestrangulationdeath of friendstabbed to deathstabbed in the chestwhite pantiesscantily clad femalenecklaceon the runstabbed in the backliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonmurdererthreatened with a knifegirl in pantiesmaniacfalling down stairspot smokingfireplaceno pantiessociopathragestabbed in the stomachcoitusrape victimrapistfemale killerwoman in jeopardystealing a carfight to the deathpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downperversionconvictrainstormabusive fathersexual assaultcopulationpsycho killermarijuana jointpsychopathic killergirl in bra and pantiesmadmanparalysisviolence against womenshot in the neckhead woundmisogynisthuman monsterremorsefemale friendshipsexual violencehomicidal maniac17 year oldescaped convictshot in the eyenihilismheld captivesummer vacationunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerfemale serial killerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All) |
The highly skilled Federale Machete is hired by some unsavory types to assassinate a senator. But just as he's about to take the shot, he notices someone aiming at him and realizes he's been set up. He barely survives the sniper's bullet, and is soon out for revenge on his former employers, with the … reluctant assistance of his brother Cheech Marin, who has become a priest and taken a vow of nonviolence. If you hire him to take out the bad guys, make sure the bad guys aren't you! (Read More)
| Subgenre: | martial artscult filmblack comedy |
| Themes: | escapemurderrevengekidnappingbetrayaltorturedrunkennessinvestigationdeceptionracismcorruptionpsychopathdeath of fathersurveillancehome invasion …death of wifepolice brutalitymurder of a police officerpolice corruption (See All) |
| Mood: | gorespoofpoetic justice |
| Locations: | hospitalchurchswimming poolmotorcycledeserttaxikitchenrooftopmexicotexastwo on a motorcyclefood truckshootout in a church |
| Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipdoctortattoobrother brother relationshippolice officernursepriesthostagetough guyaction herohitmanlustsecurity guard …maidsniperolder man younger woman relationshipsniper rifleshooting a police officerfather and daughter (See All) |
| Period: | 2000s |
| Story: | over the topdecapitationblood splattershowerfemale rear nudityfemale nuditycharacter name in titlenuditybloodviolenceone word titlebare breaststhreesomefemale frontal nudityflashback …bare chested malefightfemale full frontal nuditycigarette smokinginterracial sexnipplesphotographtitle spoken by characterexplosionknifechasepistoltopless female nuditycell phoneshootouthigh heelscorpseshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facecomputercamerabattleswordarrestgunfightbikinibare buttfalling from heightvomitingshowdownrifleheld at gunpointhand to hand combatbombcar crashinterrogationhandcuffsrevolvershot in the backassassinbound and gaggedsword fightstrangulationtoplessaxedisguiseambulancemansionthroat slittingimpalementstabbed to deathstabbed in the chestimmigrantexploding carmodelsevered headman with glassesanti heroone man armyassassinationdrawinghit by a cardouble crossfemme fatalenews reportcigar smokingshot in the legshot in the foreheadracial sluron the runimmigrationflash forwardconfessionskinny dippinglimousinedrug addictcharacter repeating someone else's dialoguestabbed in the backelectrocutionfugitiveundercoverevil mankicked in the facetough girlshot in the shoulderdeath of brotherbodyguardcrosssplit screenlaptoptrappolicewomanpremarital sexfirst partthreatened with a knifeshot in the armsilencervigilantecult directorsubtitled scenecorrupt copbattlefieldfreeze framehenchmanmachismouzibulletassassination attempteggmachetepropagandaspin offcowboy hatsecurity camerawalkie talkiecrucifixkicked in the stomachbuttocksasian womanpress conferencesevered handcovered in bloodgrindhousebuttparking garageblack humornaked womanrocket launchercrushed to deathsocial commentarymasked manmexicandrug overdoseduct tape over mouthreverse footagestealing a carexplosivesurveillance cameraconstruction sitekatana swordresistancepartnergash in the facegunshot woundshot in the facetitle appears in writingstabbed in the headframe upsenatorstabbed in the legpunched in the chestjumping through a windowdisembowelmentracisttitle at the endundercover agentbulletproof vestbody landing on a carknife throwingstabbed in the eyeeye patchbody countbroken armethnic slurnude woman murderedflamethrowerwilhelm screamgovernment agentillegal immigrantnewspaper clippingdrug lordpolitical corruptionframed for murdergatling gunmedia coveragefast motion scenerocketfemale assassintext messagingimpersonating a police officernews reportershot through a windownude swimmingintestinescrucifixionstabbed in the handset uphomagefemale fighterscene before opening creditspolice officer shot in the chestcockroachdiscoverywebcamgardenerstabbed in the armlaundromatbus stophired killerinterracial kissshot in the eyescalpelsawed off shotgunforeplaymeat cleaverhearsestabbed in the shoulderolder man younger woman sexcontract killerfilmed killingmurder of wifecamcordercarjackingbettingrepeated linestabbed in the facecorrupt officialexploding houseaikidopasswordtext messageimprovised weaponresistance fighternakedneo westernincestuous desiresocialitehummeru.s. mexico borderexploitation filmscreaming womanthrown from a carknife in the chesttime bombstabbed in the mouthhands tiedflame throwernail guntortured to deathcrushed by a cararsenalpregnant woman murderedhot pantsincest overtonescorrupt businessmanwoman's bare buttsuitcase of moneycompact discsequel mentioned during end creditsextreme closeupdeath of partnerhand through chestpolice vigilantismbare knuckle fightingcarrying someonevideotaped sexobject in vaginapickaxeshot in the kneemexican immigrantsexy nursestabbed in the crotchstabbed in the foreheadchop shophead cut in halfelectric fencelowridermurder of a pregnant womanfake kidnappinggreen cardmother and daughter have sex with the same mannun's habitbare butt womanfemale murdererhara kiriminigunincest subtextmurdered priestporn videoknife in the headbad taste humourcorkscrewincestuous overtonesimmigration officersardonictacobarbed wire fencechauffeured limousinepromiscuous daughterdeath of pregnant womanhouse explosionsex with an older manimmigration agentpersonal vendettaborder fencemexican foodfirearm pointed at the camerastopped by policegardnerday laborerweed whacker35 mm cameramasked intruderstabbing a police officerbound hand and footfederalehair covering breastshedge clipperslunch wagonshot at the camerashooting a pregnant womanamerican citizenshipkilled in cardaddy's girllatino stereotypewomans bare buttbreasts covered by hairdesecrating a church (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
| Subgenre: | independent filmmartial artsblack comedyexperimental filmsuspenseconspiracyabsurdismpunkrevenge plottech noir |
| Themes: | escapemurderdeathrevengesurrealismkidnappingrapebetrayaltorturedrunkennessgangsterdeceptionmemorypsychopathbrutality …supernatural powerterrorismsadismsurveillancehome invasionexploitationpanicamnesiacourageself sacrificepolice brutalitypolice corruptionnear death experienceartificial intelligencerobotics (See All) |
| Mood: | gorecar chaseavant garde |
| Locations: | barbeachforesthelicoptermotorcycleairplanebuselevatorwoodswheelchairapartmentpolice cartruckrooftoprussia …strip clubbrothellaboratorycar motorcycle chaseairship (See All) |
| Characters: | husband wife relationshippolicedoctortattooprostitutesoldierhostagetough guywarrioraction herobullysecurity guardsniperrussianpolice shootout …sniper riflepolice chaseself mutilationhomeless manbabe scientist (See All) |
| Period: | near future |
| Story: | over the topattackdecapitationblood splatterfemale rear nudityfemale nuditycharacter name in titlebloodviolencebare breastsflashbackdogbare chested malegunfight …cigarette smokingexplosionknifechasesurprise endingpistolfiretopless female nuditycell phoneshootoutbeatingcorpseshot to deathfistfightmachine gunhorsecar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facecatwritten by directorbattleswordgunfightbrawlbare buttfalling from heightshowdownheld at gunpointhand to hand combatsunglassesbombcar crashinterrogationrobotorgyrevolvercombatstripperscientistshot in the backf wordsubjective cameragood versus evilsurvivalfoot chasegay slurassassinambushterroriststrangulationaxemassacredisguisemontagethroat slittingarmyimpalementcocainestabbed to deathmixed martial artsstabbed in the chesttied to a chairsubwayexploding carsevered headanti herodisarming someoneone man armyhit by a cardouble crossunderwater scenepolice officer killedvanfemme fataleshot in the legshot in the foreheadon the runpoint of viewparkattempted murderone against manydrug addictbeaten to deathdangerstabbed in the backperson on fireelectrocutionfantasy sequencefugitivecharacter's point of view camera shotevil manknocked outkicked in the facebaseball battankstreet shootoutshot in the shoulderlong takemanipulationbodyguardexploding bodyneck breakingpremarital sexcharacter says i love youmercenarydirectorial debutsevered armshot in the armsilencerobscene finger gesturedismembermentsubtitled scenecorrupt copstylized violencehenchmanak 47crime bossmachismouzihand grenadedestructionburned alivehead buttassassination attemptelectronic music scoremachetesociopathwalkie talkiemad scientistkicked in the stomachvillainesseccentricjumping from heightgrindhouserape victimfaked deathmind controllaserparking garagerock starrocket launcherrapistgun fucrushed to deathback from the deadmasked manbikergun battlecyborgthugrampagedamsel in distressshieldstealing a carbraveryfight to the deathhippiedual wieldstabbed in the throatinventormercilessnesschaosresurrectionmuteshot in the faceescape attemptstabbed in the headcigarette lighterstabbed in the legexploding headpunched in the chestjumping through a windowgang rapeparachutemusical numbercommandoone dayeye gougingwedding ringbulletproof vestdisfigurementbody landing on a carknife throwingraised middle fingerstabbed in the eyefemale doctorcastrationbody countterrorist plotkilling spreeflamethrowerburned to deathwilhelm screamclonetelekinesisgatling gunshot multiple timesgrenade launcherbullet timemoscow russiatracking devicehit with a baseball batvodkamemory lossenglishman abroadtext messagingshot through a windowmarijuana jointabandoned buildingbazookablood on camera lensreference to elvis presleyterrorist groupfinal showdownstabbed in the handburied alivemolotov cocktailtaserspit in the facepistol whipstrongmanhead blown offscene before opening creditsarmored carsuper strengthparkourescalatorworld dominationmegalomaniacskyscraperstabbed in the armclimbing through a windowanarchycrash landingsawed off shotgunman kills a womanoffscreen killingcrashing through a windowwoman kills a mansex clubstabbed in the shoulderbullet woundfinal battledrive by shootingbritish soldierexperiment gone wronghigh techsome scenes in black and whitestabbed in the facegarbage truckcloningcut into piecesspitting bloodcockney accentcocaine snortingimprovised weapontommy gunshot through a doormurder spreefade to blacklifting person in airbreaking a bottle over someone's headheart in handknocked out with a gun buttarmoryhummerbilingualisminnocent person killedfreewaythrown from a carmotorcycle with a sidecarthroat cutwoman wearing black lingeriecryogenicsloss of memorythroat rippingdetonatorhit with a chairflame throwerreference to charlie chaplininvulnerabilityrescue attemptsong and dancebatteryshot through a wallbalisonghidden doorprosthetic limbbroken fingerleft for deadshaky camhand through chestsuper computervideo recordingsuper soldierlugerthrown through a windshieldalbinoescape podhit with a rockfirst personshipping containerbroken backimplantprosthetic legsecret laboratorycamouflage uniformfighting in the airwater tankriding a busreference to darth vadertoy robotkilled by a propellerabandoned hotelcyberneticstaseredwalking in the woodsknife in handprosthetic armamnesiacshot through the floorstopped by policeclimbing up a buildingfighting with selfstabbed through the mouthfragmentation grenademil mi 8 hip helicopter50. caliber machine gundriver shotfiring guns from both handsghillie suitroof collapseevasionhanging from a ropechest ripped openclothes shoprobot hand (See All) |
Marv is unconscious on a highway surrounded by corpses. When he awakes, he has amnesia and tries to recall his last steps from the Kadie's saloon on the Saturday night. He recalls that he found four playboys burning a homeless man alive and defended the poor man. Marv hunts them down and kills the g …roup. The cocky gambler Johnny hits jackpot in slot machines in the Kadie's saloon and invites the waitress Marcie to go with him to play poker game against the powerful Senator Roark. He wins the game and suffers the consequence of his arrogance. The private detective Dwight McCarthy is contacted by his former lover Ava Lord that asks to meet him at the Kadie's saloon. Ava asks him for forgiveness for leaving him to marry the wealthy Damian Lord. However her strong chauffeur Manute takes her home. Dwight snoops around Ava's house but is found and beaten by Manute and the bodyguards. When he returns home, Ava is waiting for him naked in the bed and seduces him again. Then she tells that Damian and Manute torture her and soon she will be killed. Once again Manute takes Ava with him and hits Dwight that invites Marv to help him to rescue Ava. Damian denies the accusation but Dwight beats him to death while Marv tear Manute's eye out. But soon Dwight finds that he was lured by Ava that shoots him. Marv rescues Dwight and takes him to the Old Town where Dwight finds his former lover Gail that helps him to recover while Dwight plots revenge against Ava. (Read More)
| Subgenre: | independent filmmartial artsblack comedyb moviedystopia |
| Themes: | ghostmurderdeathrevengesuicideinfidelitymoneybetrayaladulterytorturedrunkennessdeceptionvoyeurismseductionextramarital affair …corruptionbrutalityobsessionredemptiongriefhome invasionphotographyvengeanceamnesiamurder of a police officer (See All) |
| Mood: | goreneo noirnightmarecar chaseone night |
| Locations: | hospitalbarrestaurantswimming poolhotelcarhelicoptermotorcyclecemeteryapartmentfarmpolice carrooftopstrip clubbrothel …car explosioncar motorcycle chase (See All) |
| Characters: | father son relationshipdoctortattooprostitutedetectivephotographersister sister relationshiptough guywarrioraction herowaitresspolice detectivepolice chaseself mutilationhomeless man …police lieutenantself cutting (See All) |
| Story: | aliveleavingdecapitationblood splattershowerfemale rear nuditybased on novelbloodviolencesequelfemale frontal nudityflashbackmale rear nuditydogbare chested male …gunsex scenefightcigarette smokingphotographtitle spoken by characterexplosionknifechasepistolfirevoice over narrationshootoutwoman on topbeatingcorpseshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facecamerawritten by directorswordgunfightbrawlbare buttfalling from heightlettershowdownheld at gunpointhand to hand combatbombsecond partplace name in titlecar crashhallucinationhandcuffsvoyeurrevolverstrippertelephoneshot in the backsubjective camerafoot chasebased on comic bookstrangulationaxedisguisemansionthroat slittingimpalementstabbed to deathcolon in titlemixed martial artsdinerstabbed in the chestweapontied to a chairnonlinear timelineexploding cardrivingsevered headanti heroanimalone man armydouble crosspolice officer killedfemme fataleanthologycigar smokingshot in the legshot in the foreheadbartenderskinny dippingattempted murderlimousineone against manygravebinocularscharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on firecharacter's point of view camera shotninjaknocked outkicked in the facetough girllightningshot in the shouldermanipulationscarconvertiblebodyguardcrossautomobiledeath of husbandneck breakingpremarital sexthreatened with a knifehandgunsilencertwincowdismembermentheroincorrupt copstylized violenceprivate detectivecrime bossuzibow and arrowburned alivehead buttnipples visible through clothingpokerheavy rainlooking at oneself in a mirrorloss of loved onekicked in the stomachtwinsdesperationjumping from heightsevered handdriving a carrailway stationbald manbikerthugcrime scenehaunted by the pastswitchbladestealing a carcrossbowseven word titlekatana sworddual wieldstabbed in the throat3 dimensionalgash in the facepunched in the stomachshot in the facekicked in the crotchlove at first sightstabbed in the headensemble castcigarette lightersenatorstabbed in the legexploding headpunched in the chestsafejumping through a windowthrown through a windowrainstormeye gougingdisfigurementbody landing on a cargasolinedressing roomsequel to cult favoriteflamethrowercoinshot multiple timessinchauffeurmob bossfemale assassinmemory lossactress playing multiple rolesnude swimmingabandoned buildingnarrated by characterdirector cameogamblerreturning character killed offdinner partyplastic surgerypistol whipstrongmansecond in seriesexotic dancershot with an arrowold flamestabbed in the armbillionaireshot in the eyebody in a trunkbased on graphic novelman kills a womancrashing through a windowslot machineeyeballwoman kills a mancowgirl sex positionkicked in the headcar set on fireextreme violenceford mustangmotorcycle gangsuperhuman strengthfacial scarrighteous ragestabbed in the facecorrupt officialcut into piecesmotorcycle coptwin sistershooting rangepsychotronic filmbiker gangimmolationbreaking a mirrorgrindhouse filmsocial decaytear on cheekman slaps a womanstraight razorpoker gamethrown from a carfictional cityreturning character with different actorgold diggerthroat cutautomatic weaponstrong mancutting hairdrinking from a bottlecard tricksexual intercourselassored light districtdrinking from the bottlepassenger trainharley davidsoncorrupt businessmanjumping from a carbroken fingerfemale ninjaneon signfilicidemidnight moviefemale star appears nudefalling through a windowmasked womanhanged by the neckcoin tossskull crushingduffel bagspeeding vehiclepliersvirtual setchevrolet corvettehandcuffed to a beddollar billshot in the buttwoman wearing a thonggirl gangglass shardtwerkingdark horse comicswoman murders a manchauffeured limousineeye ripped outman murders a womanplaying pokertoothpickloading a gunphysical torturereverse cowgirl sex positionbandaged facemachine pistolprequel and sequelwoman in a bathfalling through a rooftop windowclimbing in a windowself injectionhard boiledjackpotgun with silencersleight of handdoused with gasolinecoin trickflipwoman on top sexactor reprises previous roleangry womancadillac convertiblestealing a police carcredit card declinedmotor carbreaking someone's fingersbeaten to a pulpone dollar billback hand slapgun rangeinjured manambidexterityfield surgeryford mustang convertibleman carrying a mantalking on a phone while having sexblack jackclimbing a fire escapecrashing through a skylightdodge the carlong haired womanpunched in the throatred convertiblebandage over eyediving into swimming pool (See All) |
In a series of escalating encounters, former security guard David Dunn uses his supernatural abilities to track Kevin Wendell Crumb, a disturbed man who has twenty-four personalities. Meanwhile, the shadowy presence of Elijah Price emerges as an orchestrator who holds secrets critical to both men.
| Subgenre: | supernatural thrillerblack comedysuspensesuperheropsychological thriller |
| Themes: | escapedeathsurrealismkidnappingchristmasbetrayalfeardeceptionpsychopathbrutalitysupernatural powerinsanitymental illnessfaithsurveillance …bullyinghome invasionpanichomelessnessjusticepolice brutalitynear death experience (See All) |
| Mood: | high school |
| Locations: | hospitalrestauranttrainswimming poolhelicopterbuswaterelevatorwheelchairpolice cartunneltrain stationabandoned factory |
| Characters: | father son relationshippolicemother son relationshipafrican americantattooteenage girlteenage boyserial killernursestudenthostagelittle boysecurity guardvillainpsychiatrist …snipersniper riflesingle fatherhomeless manwriter directorself referential (See All) |
| Story: | barrelpsychoattackdrowningblood splattercharacter name in titlebloodviolencesequelinterviewflashbackfightdancingphotographtitle spoken by character …surprise endingvoice over narrationcell phonebeatingcorpseshot to deathfistfightshot in the chestrescueslow motion scenepunched in the facewritten by directorundressingbrawlbookshowdownhandcuffscriminalsubjective camerabedroomflashlightambushold manmassacredisguisebasketballthroat slittingbridgeinternetsubwaymapchild abusedouble crossunderwater scenepolice officer killedvanthird partnews reporttransformationtalking to the camerapainattempted murderone against manymicrophonebeaten to deathdangerwidowerrace against timecover upchristmas treeopening action scenescreamgymamerican flagtragic eventbasementvigilantenewspaper headlinesubtitled scenemaniaceavesdroppingsabotagerevelationheavy rainsociopathscene during opening creditscomic booksurvivorsecurity camerawalkie talkieswat teamvictimlaserfollowing someonecompassioncrushed to deathbald manblack womanindianeaten alivemental institutiondamsel in distressseriesreverse footageshieldhaunted by the pasttensionvisionsurveillance camerabackpackfight to the deathsonmercilessnessconvenience storedeath threatsuper villainmental hospitalplot twistheadphonesdelusionescape attemptmedicationblood on shirttitle at the endphiladelphia pennsylvaniaintruderdark pastlasersightkilling spreelightnewspaper clippingsouthern accentheroismvillain played by lead actorsuffocationvideo surveillancemental patientdirector cameofinal showdownreturning character killed offconstruction workervigilantismhuman monstersubway stationdoubttwist endingcomputer crackercomicsecret societyskyscraperweightliftingx raysplit personalitybearded manvigilante justiceshopglassoffscreen killingcrashing through a windowshort skirtmale protagonistroller skatingsuper powercrossoverpsychiatric hospitalmicroscopeparaplegicvideo footageoverturning carsuperhuman strengthroller skatescrime fighterhomeless persontragic pastcustomercrowbarcamera phonehoodiepsychotronic filmreference to supermanschizophrenicmurder spreesurveillance footageintercomscreaming womandying wordscheerleader uniformman in a wheelchairabusive motherhumandeeply disturbed persontragic villaincityscapegpsmultiple personalitydutch anglehooded figurefairgroundinvulnerabilitybritish actor playing american charactercriminal mastermindblack glovesthird in trilogygeneratormultiple personality disorderchristmas decorationkiss on the foreheadfalling through a windowconfinementtrain crashplayingbroken backsanitariumcloakfemale psychiatristbare chested male fightingcaseinstitutionpersonalitytechnicianhandcuffed to a pipecomic book shopdissociative identity disorderstoriesglass shardwater tankpsychiatric patientdancing in the streetmurder by drowningclimbing up a wallname taggrowlingreflection in eyeintroductionwater pipebookshelfirish accentbound in chainslast wordskitchen sinkexplanationhospitalizationsuperheroescrazy manscufflesuperletter openeraudio begins before videorationalizationinsane mancrashing through glassexecutive producerclosed circuit tv2010cheerleader costumethroat slitideaisolatedmale antagonistfamiliarkitchen sink realismsanitoriumcomic booksboarded up windowsaying last words before dyingsecurity expertfood traymultiple personalitiesriot squadvillain as protagonistcrazy personreference to nicki minajspeaking with an accentsuperhero originbritish actress playing american characterstorage roomsupervillian origincomic book moviescomic book storecorner storegasping for breathlifting a carfeminine beautyshared universe (See All) |
When his fiancee is kidnapped by human traffickers, Roman and his ex-military brothers set out to track her down and save her before it is too late. Along the way, Roman teams up with Avery, a cop investigating human trafficking and fighting the corrupt bureaucracy that has harmful intentions.
| Subgenre: | independent filmsuspense |
| Themes: | escapemurderdeathrevengekidnappingdrugsfeargangsterinvestigationdeceptionangerbrutalityabductionhome invasionpanic …couragemurder investigationpolice investigationnear death experience (See All) |
| Mood: | night |
| Locations: | restaurantnightcluburban settingpolice stationroad triptruckrooftopstrip clubsuv |
| Characters: | family relationshipshusband wife relationshippolicedoctortattoobrother brother relationshipbrother sister relationshippolice officerserial killerdetectivepolicemanhostagetough guywarriorhitman …killerpolice detectivevillainsniperpolice shootoutsniper riflepolice chaseex soldierfiance fiancee relationshipcoroner (See All) |
| Story: | over the toptripblood splattershowerfemale rear nudityfemale nuditybloodviolencebare breastsbare chested malegunfightphotographexplosionknife …chasethree word titlesurprise endingpistoltopless female nuditycell phoneshootoutbeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facearrestgunfightbrawlbare buttfalling from heightbookshowdownheld at gunpointbombinterrogationstrippershot in the backf wordfoot chasebound and gaggedambushmassacreambulancemontageweaponmapanti herohit by a carvanshot in the foreheadtrainingattempted murderorganized crimedangerrace against timeopening action scenestreet shootoutshot in the shoulderbodyguarddie hard scenarioprofanityhandgunsilencerobscene finger gesturevigilanteheroinhenchmanak 47pickup truckcrime bossgrenadewarehousecomic bookbeardbald mangun battledrug overdoseduct tape over mouththugwoman in jeopardydamsel in distressshieldtarget practicebraveryhatredmercilessnessgunshot woundpost traumatic stress disorderescape attemptassault rifleautopsybulletproof vestraised middle fingerpolice raidlaptop computertracking deviceheroismshot through a windowhuman traffickingfinal showdownohiovigilantismfirearmspiral staircasecomicbearded manparamedicpolice captainvigilante justicedrug traffickinghand over mouthdruggedvehiclebullet wounddrive by shootingfilmed killingbadgefemale police officerrighteous ragetied up while barefoottextingtequilaheroic bloodshedshooting rangecleveland ohiohummerfinanceframed photographcrime lordtime bombhands tiedgas station attendantc4 explosivesstabbed in the sidegraphic noveltraining montageshipping containerstrapped to a bombimplanttranquilizertape over mouthbachelorette partytelescopic rifleserialrailyardviolentopening creditsview through rifle scopehen partylong haired womanman killedgps trackerhorror movielaw enforcement officer (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com