Please wait - finding best movies...
Deadwood, Dakota Territory, is largely the abode of men, where Indian scout Calamity Jane is as hard-riding, boastful, and handy with a gun as any; quite an overpowering personality. But the army lieutenant she favors doesn't really appreciate her finer qualities. One of Jane's boasts brings her to β¦Chicago to recruit an actress for the Golden Garter stage. Arrived, the lady in question appears (at first) to be a more feminine rival for the favors of Jane's male friends...including her friendly enemy Wild Bill Hickock. (Read More)
Themes: | theatregamblingangerwedding |
Locations: | campfirechicago illinoistrainbar |
Characters: | native americanlove triangledancerfemale protagonistsinger |
Story: | frontier townstage showtheatre audiencewedding gownreference to george armstrong custersix gunreference to sitting bullcalamity janeindian attacksioux tribechorus linechorinepantaloontall talegirls with guns β¦female impersonatorbuggyfrontierlassoman in dragstagecoachfemale gunfighterwild westsaloontomboyplaying cardsmusic bandposterhorse and carriagedressing roomballwhipbrideimpersonationbow and arrowfireplaceapplausecross dressingcabinstagemistaken identitycowboybartenderpainterprisoneraxegay slurtearspaintingrescueface slapsingingdancingcharacter name in titlegun (See All) |
Down-on-his-luck theatrical producer Max Bialystock is forced to romance rich old ladies to finance his efforts. When timid accountant Leo Bloom reviews Max's accounting books, the two hit upon a way to make a fortune by producing a sure-fire flop. The play which is to be their gold mine? "Springtim β¦e for Hitler." (Read More)
Subgenre: | independent filmcult filmscrewball comedy |
Themes: | theatrerevengeprisongreed |
Mood: | breaking the fourth wall |
Locations: | barnew york cityrestaurantmotorcycleelevatorcourtroomrooftop |
Characters: | dancersingerhomosexualactordirectorsecretary |
Period: | 1960s |
Story: | theatre audiencechorinechorus linemusic bandposterhorse and carriageapplausecross dressingstagebartenderprisonergay slursingingdancinggun β¦two word titlefightphotographexplosionsurprise endingpistolbikinimanhattan new york citysuicide attemptjudgetrialcigar smokingold womantalking to the cameragunshotattempted murdercostumeauditionex convicttypewriternewspaper headlinerecord playersexual fantasyflirtingeavesdroppingdestinyfarcefriendship between menhelmetfraudrehearsalscamrole playingprison guardhippierowboatdynamitepigeonviolinistchauffeurcontractbriberyaccountanthysteriagay manswastikatestimonyfountaincentral park manhattan new york citysenior citizenhitlerjukeboxplaywrightjurymedalsecuritystage playlandladytoasttransvestismbroadway manhattan new york citycarouselblankethide and seekchrysler building manhattan new york cityticketstreet vendorswedishcity parkphonograph recordreference to winston churchillhot dog standempire state building manhattan new york citybroadwaypenitentiarymusic conductorboatingcasting callchequehot dog vendorstorm troopercanoeingembezzlerauditmusical stage productiongerman stereotypefloor safehard of hearinghitler spoofplay directorreference to eva braunfunny nazitheatrical producerswedish sex bomb (See All) |
Maverick is recreated from the character James Garner created in the 1950s TV program. Maverick is a gambler who would rather con someone than fight them. He needs an additional three thousand dollars in order to enter a Winner Take All poker game that begins in a few days. He tries to win some, tri β¦es to collect a few debts, and recover a little loot for the reward, all with a light hearted air. He joins forces with a woman gambler with a marvelous, though fake, southern accent as the two both try and enter the game. (Read More)
Subgenre: | cult film |
Themes: | gamblingangerdeathdrunkennessheroseductioncheating |
Mood: | satirespoof |
Locations: | campfireboatbathtubdesertvillage |
Characters: | native americanfather son relationshipthiefkillerbiblerussianchinesesniper rifle |
Period: | 19th century1800s |
Story: | frontier townsix gunbuggystagecoachsaloonplaying cardswhipbow and arrowcabincowboyface slapsingingcharacter name in titlemale nudityone word title β¦flashbackbare chested maleexplosionsurprise endingpistolshootoutshot to deathfistfightremakeshotgungunfightbrawlsex in bedshowdownriflerevolverriverambushsnakebirddouble crossvoice overcigar smokinggunshotattempted murdergravebased on tv seriesbuxomumbrelladebthanginghairy chestbank robberystrong female charactercoachropecard gamepokerfarcecowboy hatstrong female leadtournamenttorchburialindianwhiskeycameolandscapeexplosivecard playingcon artistdynamiteoutlawcliffpassionate kissferrysouthern accentcon manbanditvictorian eradonkeygamblerlaundrypickpocketrobberwalletbarberquick drawgunslingercowboy bootsbellsawed off shotgunstreet fightnoosetelegramhold upmusketbased on tv showoutlaw gangin medias resrattlesnakehorse and wagoncardbarbershopgunfighterbathhousehawkstreamwinchester riflesurname as titlerepeating rifleflintlock rifleconponycowboy shirtspaniardclothes lineoil lampcowboys and outlawswestern herocliffhangermuleencampmentriverboatjackasssacktelegraphcash prizesteamboatgriftercovered wagonderringercowboys and indiansattempted seductionsaved from hangingthrown from a boatconcealed weaponpoker playergorgepaddle boathands upfake fightcommodoretelegraph officecrooked gamblingburrocard cheatace of spadesthieves falling outhit with a log (See All) |
The Ultimate Western Spoof. A town where everyone seems to be named Johnson is in the way of the railroad. In order to grab their land, Hedley Lemar ('Harvey Korman' (qv)), a politically connected nasty person, sends in his henchmen to make the town unlivable. After the sheriff is killed, the town d β¦emands a new sheriff from the Governor ('Mel Brooks' (qv)). Hedley convinces him to send the town the first Black sheriff ('Cleavon Little' (qv)) in the west. Bart is a sophisticated urbanite who will have some difficulty winning over the townspeople. (Read More)
Subgenre: | cult filmslapstick comedymadcap comedy |
Themes: | drugsdrunkennessfilmmakingheroracismunlikely hero |
Mood: | satirespoofbreaking the fourth wallwestern spoof |
Locations: | campfirechurchsmall townlos angeles californiabathtubdesertwheelchair |
Characters: | native americandancersingerafrican americanprostitutemusicianactorwarriorinterracial relationshipsherifffilm directorself referential |
Period: | 19th century1870s |
Story: | frontier towntheatre audiencelassosaloonplaying cardsstagecowboybartenderprisonergay slurface slapsingingdancingflashbackkiss β¦explosionchasesurprise endingsongshootoutfistfightmirrorblondegunfightbrawlshowdownlingeriemarijuanapianojailrevolvergood versus evilcleavagedisguisescantily clad femalepantyhosecigar smokinglooking at the cameraracial slurlimousinewritten and directed by cast memberactor playing multiple rolesevil manhangingfilm within a filmblack americanchessred dresscowboy hatblockbusterflatulenceorchestrastupiditymovie theatreabsurd humorbackstageshoveldynamiteoutlawmusical numbersexy womanpastorethnic slurcrude humorgartercamelceremonysidekickcannabiscafeteriastereotypemini dressquick drawgovernorpopcorncattlegunslingerdrunkardanimal abusecowboy bootsrailroadreluctant heromarching bandmovie studion wordfriends who live togetherpunspittelegramoutlaw gangsix shooterku klux klanred brahorse and wagonanachronismshot in the crotchwanted postergunfighterfinger gunsmoking potsnoringphysical comedyshowgirlcolt .45railroad trackcowboy shirtoathwestern towncomic herocomic violencecowboys and outlawsgallowswhite horsereference to friedrich nietzscheexecutionerwestern heroquicksandmeta filmmultiple cameosnylonsbell towertalking to the audiencelispburpingmarqueeballadeerbimbosound stagebig bandderringerhangmanmovie reality crossoverfunny accentgrauman's chinese theaterjewish humorinterrupted hangingsinger offscreenwagon trainsaloon girlchess setgun shot out of handreference to cecil b. demillepie fightreference to louis pasteurreference to douglas fairbanksbaked beansblack cowboychanteusereference to jesse owensfamous entrancereference to w.c. fieldssioux indianreference to hedy lamarrstudio tourwestern unionyear 1874cootpaddleball (See All) |
Ellen, an unknown female gunslinger rides into a small, dingy and depressing prairie town with a secret as to her reason for showing up. Shortly after her arrival, a local preacher, Cort, is thrown through the saloon doors while townfolk are signing up for a gun competition. The pot is a huge sum of β¦ money and the only rule: that you follow the rules of the man that set up the contest, Herod. Herod is also the owner, leader, and "ruler" of the town. Seems he's arranged this little gun-show-off so that the preacher (who use to be an outlaw and rode with Herod) will have to fight again. Cort refuses to ever use a gun to kill again and Herod, acknowledging Cort as one of the best, is determined to alter this line of thinking ... even if it gets someone killed ... (Read More)
Subgenre: | cult filmblack comedysuspenserevisionist western |
Themes: | murderdeathrevengeprisontorturephotographytrauma |
Mood: | rainstylization |
Locations: | campfirebarcemeterysmall towndesertrural settingmexicobar brawlbar shootout |
Characters: | native americanfemale protagonistfather son relationshipfather daughter relationshipafrican americandoctorteenage boyphotographertough guyaction herolittle girlmayorevil sheriff |
Period: | 19th century |
Story: | frontier townsix gunpantaloonfemale gunfightersaloonplaying cardsfireplaceapplausecowboybartenderprisonergunbloodviolenceflashback β¦kissfightphotographexplosionknifesurprise endingpantiespistolshootoutbeatingblood splatterfistfightblondeshot in the headpunched in the facecameragunfightbrawlshowdownrifleprayerrevolverfightingshot in the backambushdream sequenceanti herodisarming someonefemme fatalegunshotduelevil mantough girlopening action scenehangingstreet shootoutcontestdeath of sonfeminismcult directorstylized violencestrong female characterheroinecowboy hatexploding buildingaccidental deathstrong female leadtorchaction heroinepreacherbar fightgun battlemexicancelebrationdual wielddynamiteoutlawarizonadead boydictatorpipe smokingquick drawcowboy bootsaccidental shootingshot in the eyegirl powerstreet fightgun duelhandcuffedstablenoosechainedbadgebroken nosebettingexploding housesix shootershot in the crotchcowgirlgunfighterwinchester riflerepeating riflecolt .45cowboy shirtlong blonde hairwestern towndark heroinecowboys and outlawsteenager fighting adultfilicideprairieclock towersombrerospurschild uses a guntucson arizonaapachevictorian agefiestapistol duelarizona territoryderringercarbinesaved from hangingshoeshineapache indiandaughter murders fatherreference to jesse jamesgun shot out of handtrick shotlong johnssonora mexicocomanche indiansmith and wesson revolvercash boxyuma prisonvaquero (See All) |
'Louisa May Alcott' (qv)'s autobiographical account of her life with her three sisters in Concord, Massachusetts in the 1860s. With their father fighting in the American Civil War, sisters Jo, Meg, Amy and Beth are at home with their mother, a very outspoken women for her time. The story tells of ho β¦w the sisters grow up, find love and find their place in the world. (Read More)
Subgenre: | coming of age |
Themes: | theatredeathmarriagechristmaspregnancydysfunctional familyillnesshopewritingfirst love |
Mood: | affection |
Locations: | new york citysnowparis francerural settingusa |
Characters: | female protagonistsingerfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipdoctorteenage girlgirlsoldierbabywritersister sister relationshipartistlittle girl β¦maidprofessorpregnant wife (See All) |
Period: | winter19th century1860s |
Story: | pantaloonbuggytomboyhorse and carriagefireplacestagepaintertearspaintingsingingdancingf ratedbased on novelpartytitle directed by female β¦catletterneighborpianooperacandleold manchild abusevoice overmarriage proposalbinocularscostumechristmas treepianistchildbirthreunionactingtwinreference to william shakespearecivil wardressbirthrealitypet dogfeministchristmas evemay december romanceice skatingyoung loveboarding schoolgrowing upplayviolinistvictorian eragiving birthtriple f ratedepidemicpublisherreading aloudtween girlsicknessenvykittenmailboxtutoramerican civil warbroken heartloss of sistermassachusettsmanuscripttelegramhorse and wagonpet catexpectant motherchristmas carolhomeworkboarding housechristmas decorationsnightgownsheet musicreference to charles dickensgovernessoil lampstorytellerchalkboardfalling through iceboarderu.s. civil warpost civil warfood shortagecurlingcanvasreference to walt whitmanreference to goetheemotional healingpregnant sisteremotional depressionreference to friedrich schillerscarlet feversnow sleddingbirth of twinsdance ball (See All) |
1878 in New Mexico: John Tunstall picks up young gun men from the road to have them work on his ranch, but also to teach them reading and to civilize them. However he's a thorn in the side of the rich rancher Murphy, as he's a competitor in selling cattle. One day he's shot by Murphy's men. Judge Wi β¦lson can't do anything, since Sheriff Brady is one of Murphy's men. But attorney Alex persuades him to constitute Tunstall's young friends to Deputies and give them warrants of arrest for the murderers. Instead of arresting them, William Bonney just shoots them down. Soon the 5 guys become famous and William gets the name "Billie the Kid" - but they're also chased by dozens of Murphy's men and the army. The people however honor him as fighter for justice. (Read More)
Subgenre: | cult filmdark comedy |
Themes: | weddingmurderdeathfriendshiprevengeescapepsychopathpoetryvengeance |
Mood: | gore |
Locations: | campfirebarsmall townbathtubdesertrural settingfarmcavemexiconew mexicobar shootout |
Characters: | native americanhusband wife relationshipteenagerprostituteteenage boysoldierphotographerlawyertough guyinterracial relationshipsheriffchinesepolice shootout |
Period: | 19th century1870s |
Story: | frontier townwedding gownsix gunbuggylassoplaying cardsmusic bandbridecowboyface slapdancinggunfemale nuditybloodmale nudity β¦violencesex scenekissphotographknifechasepistolbased on true storyfireshootoutblood splatterfistfightmachine gunhorseurinationshot in the headshotguncamerabattleundressinggunfightbrawlbare buttvomitingshowdownrevolvercriminalcombatfoot chaseambusharmyweaponanti heroon the rungunshotfugitiveopening action scenestreet shootoutpiglove interestvigilantearsontraitorteen angstlawcowboy hatbuttocksflatulencenew year's evetorchburialmexican standoffbar fightgun battleinterracial romancetarget practiceattorneydual wieldbathingoutlawarizonawisecrack humorbounty huntersiegeranchbonfirepsychoticgatling gunvillain played by lead actorbad guyvigilantismquick drawstandoffhideoutcattledouble barreled shotgungunslingercowboy bootsnewspaper articlevigilante justicedeputygun violenceoutlaw gangsix shooterhorse and wagonmain character shotcavalrygunfighterwinchester riflerepeating riflerocking chairhorse chasebanjocolt .45cowboy shirtnebraskawestern townranchercowboys and outlawsgunmanbare knuckle fightingouthousechinese womanhalf breednavajobrat packwestarizona territorypeyotebowie knifecarbinecrooked sheriffindian villagearrest warrantslow motion violencecult herobilly the kidcattlemanjustice of the peacebuckboardnew mexico territorypistolerolincoln county warpugilist (See All) |
The Marx Brothers take on high society. Two lovers who are both in opera are prevented from being together by the man's lack of acceptance as an operatic tenor. Pulling several typical Marx Brothers' stunts, they arrange for the normal tenor to be absent so that the young lover can get his chance.
Subgenre: | slapstick comedy |
Themes: | theatrekidnappingescapeunrequited love |
Locations: | restauranthotelelevatoritalybaseballfire escape |
Characters: | singerpolicepolice officermusicianlittle girlpolice detectivemaidmayor |
Period: | 1930s |
Story: | theatre audienceplaying cardshorse and carriagedressing roomwhipcross dressingstagemistaken identitysingingdancingpantiesarrestfalling from heightpianoopera β¦disguiseman with glassescigar smokingparkmicrophonecostumeclownfugitivespeechpianistnewspaper headlineropewaiterfalling down stairssabotagefarcebeardrehearsalorchestracelebrationbackstageimpostorpierirreverencecontractdragblackoutknocked unconsciousvaletopera singercruise shippark benchdivasuitornew york city new yorksheet musicstowawayharpopera houseocean linertenormusic conductorserenaderadio broadcastingreference to tarzananvilaviatormanicurebuffethecklerfolk dancecontemporary settingplaying with foodwisecrack comedyrich widowsandbagmarx brotherssteamer trunkdowagerport holereference to enrico carusotransatlantic voyage (See All) |
Held yearly for centuries, the Ocean of Fire--a 3,000 mile survival race across the Arabian desert--was a challenge restricted to the finest Arabian horses ever bred, the purest and noblest lines, owned by the greatest royal families. In 1890, a wealthy sheik invited an American, Frank T. Hopkins, a β¦nd his horse to enter the race for the first time. During the course of his career, Hopkins was a cowboy and dispatch rider for the U.S. cavalry--and had once been billed as the greatest rider the West had ever known. The Sheik puts his claim to the test, pitting the American cowboy and his mustang, Hidalgo, against the world's greatest Arabian horses and Bedouin riders--some of whom are determined to prevent a foreigner from finishing the race. For Frank, the Ocean of Fire becomes not only a matter of pride and honor, but a race for his very survival as he and his horse attempt the impossible. (Read More)
Subgenre: | martial artsfish out of water |
Themes: | gamblingmurderdeathkidnappingmoneydrinkingtorturedrunkennessescapeseductionracism |
Locations: | campfiretrainbarnew york citysnowdesertwatership |
Characters: | native americanfather son relationshipmother son relationshipfather daughter relationshipboysoldiertough guywarriorreference to godmuslimuncle nephew relationshipdeafness |
Period: | 19th century1890s |
Story: | reference to george armstrong custersioux tribelassostagecoachsaloonplaying cardsmusic bandbow and arrowcowboyrescuedancingcharacter name in titlegunbloodfight β¦title spoken by characterknifepistolbased on true storyfireshot to deathfistfighthorsemirrorslow motion scenepunched in the facedrinkbattleswordbrawlriflehand to hand combatsunglasseshallucinationprayerrevolverbandsword fightambushmassacrestabbingarmydisarming someonejourneycoffeepaingunshotbinocularsumbrellatentknocked outrabbitpursuittrapgeneralprinceiceteaspiritracespearcowboy hatislamaudiencehonorgoatiraqslavewhiskeymiddle eastvisiontelescopesandbackstageboston massachusettspartnerlosttime lapse photographyarabpridebooby trapslaughterknife throwingraidcastrationlanterndrumshorseback ridingcamelceremonytranslatorbad guybeheadinghandshakegamblerruinsschemetowersubtitleshorse racingmajoranimal crueltywellharmonicacowboy bootsgramophonemegaphonescorpionstatue of liberty new york citypalm treeshot in the handbritish soldierchainedenglishmancaravanritepitchforksix shooterharemhorse racesyriafloggingtrespassingveilblasphemythirstcustomnomadarabiccolt .45ponyspectatorshacklesenglishwomanleopardsharpshooterbased on supposedly true storysandstormsaudi arabiabolt action riflesheikfalconsand dunesaddleinter culturalquicksandkoranlocomotivereference to allahcoin tossspursswarmencampmentteepeebedouindisgraceginblessingsports manmustangharehookahmiragegrasshopperhorseshoeoasiswater pipethrown from a horsesteamshiplocustpersian gulfgoatherdsacrilegeu.s. cavalrycitadelstalliondragged by a horsesaloon girldamascus syriaindian villageinfidelyear 1890thoroughbredendurance racinginsect swarmyear 1891marereference to wyatt earpcross country racefoalstoned to deathwounded knee massacrepony expresssacrednessannie oakleybuffalo billreference to wild bill hickoktransatlantic triparabian horsebrigandcolt revolverfalling horselong distance racesioux chiefwax cylinder (See All) |
"All eyes will be on you," says the Austrian Empress, Maria Theresa to her youngest daughter Marie Antoinette. The film, marketed for a teen audience, is an impressionistic retelling of Marie Antoinette's life as a young queen in the opulent and eccentric court at Versailles. The film focuses on Mar β¦ie Antoinette, as she matures from a teenage bride to a young woman and eventual queen of France. (Read More)
Subgenre: | alternate historyrevisionist history |
Themes: | theatregamblingweddingdeathmarriageinfidelityadulterydrinkingdrunkennessseductionextramarital affairdeath of fatherdeath of motherdrug useunfaithfulness β¦humiliationillnessrevolutionhuntingfrench revolutiondeath of babyamerican revolution (See All) |
Mood: | up all night |
Locations: | paris francebathtubfrancebrothel |
Characters: | dancerfemale protagonistsingerfamily relationshipshusband wife relationshipfather son relationshipmother daughter relationshipdoctorbrother sister relationshipprostitutemusicianbabypriestsister sister relationshipmaid β¦catholicgrandfather grandson relationshipfiance fiancee relationshipfrench soldier (See All) |
Period: | 18th century |
Story: | theatre audiencestagecoachhorse and carriagebrideapplausetearspaintingsingingdancingcharacter name in titlesexfemale nudityf ratedbased on novelnudity β¦dogkissfemale rear nuditypartyvoice over narrationcryingsongtitle directed by femalefoodhorsemirrorslow motion scenedrinkswordundressingbare buttletterbirthdaybedspyoperacandlewomanmontageeatingdinnerchildcoffinbirthday partybathritualkingfemme fataleprincesspublic nudityvirginfactorychampagnestorytellingtentreadingdeath of childflowerswigchildbirthgardenfireworksqueeneuropescandalbirthday caketraditionloss of virginitycakelifting someone into the airroyaltyelephantbuttocksgossipbirthorchestrashoesfanmourningintrigueunfaithful wifepet dogshoppingrowboatcard playingbilliardsalternate realityvoice over letterparrotpipe smokingpalacemale virginwoman in bathtubhorseback ridingmotherhoodgiving birthjewelrycandysailboatnaivetyaustriavienna austriaambassadorchandeliersunrisebishopopera singerfeatherclothingdecadencedivagame playingrevoltritediceanachronismbride and groomlocketcustomdiamondswoman initiating sexhappy birthdaysexual innuendoportrait paintingroyal familysnuffaustriancrossing selfdukecountessjugglerharpcoronationcounttobaccomasqueradeempressversaillestaxesbelchsister in law sister in law relationshipreference to thomas jeffersonduchesssexless marriagebeagleharpsichordreference to mozarthair dresserdressmakerreference to alexander the greatsalonsmallpox1780spugdance party1770slady in waitingmasked balldeath of kingmasquerade partyannulmentwearing clothes in a bathtubpug dogself indulgencereference to jean jacques rousseauextravagance1760sman refusing sexmasquerade ballbastillehorse drawn hearsedauphineye maskunconsummated marriageransacked roompolitical adviserlawn croquetpowdered wigrococotricorne (See All) |
Robbie Hart is singing the hits of the 1980s at weddings and other celebrations. He also can keep the party going in good spirit, he knows what to say and when to say it. Julia is a waitress at the events where Robbie performs. When both of them find someone to marry and prepare for their weddings, β¦it becomes clear that they've chosen wrong partners. (Read More)
Themes: | angerweddingfriendshipinfidelityjealousydrunkennesshumiliationfalling in lovewealth |
Locations: | barairplane |
Characters: | singerhusband wife relationshipfriendbest friendwaitresscousin cousin relationshipbar mitzvah |
Period: | 1980s |
Story: | wedding gownbridecross dressingface slapsingingdancingkisscigarette smokingtitle spoken by characterpartythree word titlecryingpunched in the facesecretvomiting β¦orphanold womanmarriage proposallimousinedateactor playing himselfice creampop cultureclubcameobloody noseunderage drinkingmisunderstandingnostalgiaengagementraised middle fingerwedding receptionguitar playingbroken mirrorgroomtrumpetbroken heartgropingdumpsternevadalifting person in airwedding anniversarycanceled weddingwedding cakeinfantnephewrubik's cubecompact discbitten on the armrappingsongwritinglimousine driverbest manaudio flashbackmile high clubdouble datedelorean dmc 12nubile womansinger actingreference to van halendoor shut in facejilted at the altarjilted groom (See All) |
Begins when an opera ghost terrorizes the cast and crew of the French Opera House while tutoring a chorus girl. He finally drives the lead soprano crazy so she and her friend leave. The girl is able to sing lead one night but the soprano doesn't want her show stolen so she comes back. The ghost dema β¦nds they keep giving his protege lead roles. Meanwhile, His pupil falls in love with the Vicomte de Chagny, but the Phantom is in love with Christine, his student. The Phantom is outraged by their love and kidnaps Christine to be his eternal bride. Will Raoul, the Vicomte, be able to stop this dastardly plan? (Read More)
Subgenre: | gothic horror |
Themes: | theatremurderdeathkidnappingheroobsessionunrequited love |
Locations: | snowcemeteryparis francewheelchairrooftop |
Characters: | dancersingermusician |
Period: | 19th century1910s1870s |
Story: | theatre audiencehorse and carriagedressing roombridestageface slapsingingdancingbased on novelflashbacktitle spoken by characterexplosionfirevoice over narrationhorse β¦mirrorremakeslow motion sceneswordmaskoperacandlesword fightno opening creditsforeign language adaptationgraveyardcostumekeyproduct placementringunderwaterropeheroinegothicfaintinglifting someone into the airtold in flashbacktorchbackstageroseblack and whitedisfigurementauctionchandelieropera singerdisfigured facemasked villainflashback within a flashbackbreaking a mirrorballroomtragic villainblack and white segues into colorchorusred rosecarrying someonebased on stage musicalyear 1919falling chandeliertheatre boxstagehandsecret laircolor segues into black and whitethrough the mirrorbased on stage musical based on novel (See All) |
Smart-but-ineffectual journalist Dan "We use euphemisms!" cannot decide between his girlfriend, loving-but-clingy waitress Alice, or his lover cold-but-intellectual photographer Anna; herself indecisive between Dan and honest-but-thuggish "You're bloody gorgeous!" doctor Larry. The film puts the fou β¦r leading characters in a box and strips them apart. (Read More)
Subgenre: | independent filmmelodrama |
Themes: | theatreangerrevengemarriageinfidelitymoneybetrayaljealousyadulteryextramarital affairdivorcedeath of fatherobsessiondeath of mother β¦depressionguiltunfaithfulnessdatingrivalryphotographybreak upwealthforgiveness (See All) |
Mood: | rainambiguous ending |
Locations: | barhospitalnew york cityrestauranthotelbuslondon englandtaxiairportelevatorstrip clubtaxi driver |
Characters: | love triangledancerhusband wife relationshipboyfriend girlfriend relationshipdoctorchildrenprostitutepolicemanphotographerwriterwaitresslustamericancheating on girlfriend |
Story: | theatre audienceimpersonationmistaken identitybartendertearsface slapdancingfemale nuditybloodone word titlefemale frontal nudityflashbacksex scenekisscigarette smoking β¦photographpantiesbased on playcryingcar accidentmirrorslow motion scenecomputercamerathongbookliebirthdaycafebathroommanhattan new york citystrippercleavageoperajournalistbrainternetnonlinear timelineapologyscantily clad femalehit by a carflash forwardparkportraitvacationwigstalkingcheating wifegirl in pantieseyeglassesshavingteadesirenipples visible through clothingballoonslow motionsexual attractionhappinesssecurity cameradysfunctional marriageart galleryfollowing someonepassportphoto shootsufferingsurveillance camerabreakupunfaithful wifesex talklove at first sightaquariumrosedivorceesurgeonpatriotismpractical jokeadulterous wifespit in the facepostcardexotic dancermen's bathroompublisherphysicianeditorselfishnessfilm cameraemergency roomtimes square manhattan new york citymanuscriptdialogue drivenmemorialchance meetingschizophrenicleg injuryexpatriatecustomsscreenplay adapted by authordouble decker busobituarycompanionfemale photographerpersonal adcybersexchat roomnipple slipexhibitpole dancefilm with ambiguous titleinstant messagingsextingriver thamesdialogue driven storylinedressing gowncompromiseintimatelinguistmedium format cameralove quadranglephoto exhibitinternet sexlondon bustheatre lobbymale slaps femaleinternet chatroompedestrian crossingdermatologistdeviousnessleica cameramuseum of modern art manhattan new york citybpd (See All) |
The Old West.. where a lone cowboy leads an uprising against a terror from beyond our world. 1873. New Mexico Territory. A stranger with no memory of his past stumbles into the hard desert town of Absolution. The only hint to his history is a mysterious shackle that encircles one wrist. What he disc β¦overs is that the people of Absolution don't welcome strangers, and nobody makes a move on its streets unless ordered to do so by the iron-fisted Colonel Dolarhyde (Ford). It's a town that lives in fear. But Absolution is about to experience fear it can scarcely comprehend as the desolate city is attacked by marauders from the sky. Screaming down with breathtaking velocity and blinding lights to abduct the helpless one by one, these monsters challenge everything the residents have ever known. Now, the stranger they rejected is their only hope for salvation. As this gunslinger slowly starts to remember who he is and where he's been, he realizes he holds a secret that could give the town a fighting chance against the alien force. With the help of the elusive traveler Ella (Olivia Wilde), he pulls together a posse comprised of former opponents-townsfolk, Dolarhyde and his boys, outlaws and Apache warriors-all in danger of annihilation. United against a common enemy, they will prepare for an epic showdown for survival. (Read More)
Subgenre: | martial artscult film |
Themes: | murderdeathsuicidekidnappingtorturedrunkennessescapememoryrobberysupernatural powerabductionpanicamnesiacourageself sacrifice β¦murder of a police officeralien abduction (See All) |
Mood: | rain |
Locations: | campfirebarchurchsmall towndesertwoodspolice stationlakecavebar brawlcanyon |
Characters: | native americanhusband wife relationshipfather son relationshipdoctoralienhostagethieftough guywarrioraction herolittle boysheriffgrandfather grandson relationshipdeath of girlfriendshooting a police officer |
Period: | 19th century1870s |
Story: | frontier townsix gunlassostagecoachsaloonbow and arrowcabincowboybartenderprisonertearsrescuebloodviolenceflashback β¦dogbare chested malefightcigarette smokingphotographexplosionknifechasepistolshootoutbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headshotgunpunched in the facebattlearrestgunfightbrawlbased on comicshowdownrifleheld at gunpointpianojailrevolverriverfightingcombatshot in the backsubjective cameradecapitationcandlebased on comic bookgangambushmountaindeath of friendimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headanti herodisarming someoneone man armychild in perilspaceshipunderwater scenecreaturesearchon the rungunshotgravebeaten to deathstabbed in the backkarateattackfugitivecharacter's point of view camera shotknocked outlightningshot in the shoulderpianistpursuitcountrysideexploding bodyunderwatersevered armshot in the armufobattlefieldropegoldburned alivekilling an animalrevelationspearwoundshot in the stomachscene during opening creditscowboy hatjail cellcaptivespacecraftexploding buildinglaserviolintorchburialmexican standoffcolonelpreacherback from the deadbar fightindianeaten alivefemale warriorwhiskeyalien invasiontarget practiceexplosivethundersandchaosgash in the facestabbed in the neckresurrectionkicked in the crotchstabbed in the legpunched in the chestdark herodynamiteoutlawarizonablood on shirthologramdisfigurementtribelonerlanternlens flaregadgetdeath of loved onewilhelm screamlaser guntracking deviceceremonyimaxtranslatorwifedrifterspit in the faceworld dominationquick drawcattlegunslingerinterracial marriagecowboy bootshusbandcrash landingbased on graphic novelunsubtitled foreign languagebitten in the neckcactusstabbed in the shoulderbullet woundchainedbadgealien contactoutlaw gangexploding shipsix shootersubterraneanhorse and wagonwanted postercavernknocked out with a gun buttwinchester riflevivisectionimplied nudityhorse chasetrail of bloodthroat rippingcolt .45human alienhuman versus alienwestern townhuman experimentationrancherrepressed memorypossetrackerhand through cheststray dogscarred facewestern herolobotomystabbed in the hearttomahawkelectromagnetic pulseabandoned shipgreen bloodhumanoid alienspursfiddlerencampmenthorsebackspyglassreal life father and son playing father and sonhole in chestlaser cannonlooking glasslawmanbowie knifecivil war veteranclosing eyes of dead personhummingbirdalien disguised as humanbadlandscorralprobedragged by a horsefemale humanoid alienreal life brothers playing brothersindian tribesurgical stitchesreference to jesse jamesspoiled sonscalpbroken toothwoman disintegratedscalper (See All) |
Cambridge University student Brian Roberts arrives in Berlin in 1931 to complete his German studies. Without much money, he plans on making a living teaching English while living in an inexpensive rooming house, where he befriends another of the tenants, American Sally Bowles. She is outwardly a fla β¦mboyant, perpetually happy person who works as a singer at the decadent Kit Kat Klub, a cabaret styled venue. Sally's outward facade is matched by that of the Klub, overseen by the omnipresent Master of Ceremonies. Sally draws Brian into her world, and initially wants him to be one of her many lovers, until she learns that he is a homosexual, albeit a celibate one. Among their other friends are his students, the poor Fritz Wendel, who wants to be a gigolo to live a comfortable life, and the straight-laced and beautiful Natalia Landauer, a Jewish heiress. Fritz initially sees Natalia as his money ticket, but eventually falls for her. However Natalia is suspect of his motives and cannot overcome their religious differences. Also into Sally and Brian's life comes the wealthy Baron Maximilian von Heune, who has the same outlook on life as Sally, but who has the money to support it. Max is willing to lavish his new friends with gifts and his favors. Around them all is the Nazi uprising, to which they seem to pay little attention or care. But they ultimately learn that life in all its good and particularly bad continues to happen to them and around them. (Read More)
Subgenre: | independent filmgay interest |
Themes: | weddingdeathlovepoliticspregnancydanceextramarital affairabortionwealthgerman politics |
Locations: | trainrestaurantnightclubgermany |
Characters: | love triangledancersingerhomosexualmusicianjewishmaidjewself destructiveness |
Period: | world war two1930s |
Story: | chorinechorus linemusic banddressing roombridefireplacecross dressingstagesingingdancingblooddogbased on playbased on booksong β¦beatingurinationcamerabisexualcandlemarriage proposallibraryscreampianistgiftpremarital sexclasssacrificeberlin germanycloseted homosexualdrag queenreference to adolf hitlerassaultblockbusteraudienceculture clashrailway stationpicnicanti semitismpet dogrowboatfascismsirendinner partykilling a dogdragestatebicyclingperformergramophonegreat depressioncabarettutortransvestismburlesquefamous scorenazismmistakedecadenceentertaineropposites attractnationalismspotlightboarding housesynagoguesheet musicphonograph recordborderline personality disordertranslationbisexual manbaronhouseguestbased on stage musicalnylonspolitical unrestboarderpre warapathycross cultural relationsgorilla suitglbt issueshorse and cartlistening to the radiohitler youthenglish lessonlederhosenyear 1931tony award sourcebisexual interestvampbritish expatriatekilling a petlanguage teachingmaster of ceremoniesamerican expatriatepolitical songreference to clara bowreference to max reinhardtbeer gardenreference to erich von stroheimbased on stage musical based on stage playbrown shirtweimar germany (See All) |
Detroit, the early 1960s. Curtis Taylor, Jr., a car salesman, breaks into the music business with big dreams. He signs a trio of young women, the Dreamettes, gets them a job backing an R&B performer, James "Thunder" Early, establishes his own record label and starts wheeling and dealing. When Early β¦flames out, Curtis makes the Dreamettes into headliners as the Dreams, but not before demoting their hefty big-voiced lead singer, Effie White, and putting the softer-voiced looker, Deena Jones, in front. Soon after, he fires Effie, sends her into a life of proud poverty, and takes Deena and the Dreams to the top. How long can Curtis stay there, and will Effie ever get her due? (Read More)
Themes: | theatregamblingdeathlovefriendshipsuicidemarriageinfidelitydrugschristmasmoneyjealousyadulterypregnancydrinking β¦filmmakingextramarital affairdivorcedrug usecelebrityunfaithfulnessunemploymentprejudice (See All) |
Locations: | barnew york cityswimming poolsnowcemeterylos angeles californiabusnightclubelevatortruckused car |
Characters: | love triangledancerfemale protagonistsingerfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfrienddoctorbrother sister relationshipteenage girlgirlmusician β¦sister sister relationshipactresssingle mothercomedianaunt nephew relationshipcheating on one's girlfriend (See All) |
Period: | 1970s1960s |
Story: | theatre audiencedressing roomapplausetearssingingdancinggunsexone word titlekisscigarette smokingtitle spoken by characterpartytelephone callfire β¦cryingsongmirrorwatching tvcameradrinkpianoguitarreporterbandconcertwomanmontagecocaineboxingno opening creditsradiocoffingraveyardlimousinemicrophoneprologuefired from the jobauditionchristmas treepianistwigfilm within a filmlas vegas nevadaheroingarageblack americantv newsdiscorace relationsfamerecordingguitaristfraudrehearsalvietnam warcomposerpress conferencenew year's evetv showburialdrug overdosebackstagerejectioncard playingabsent fatherbetsongwriterrecording studiotourbriberysandwichdetroit michiganstairwayfriendship between womenjazz musicnaivetyno title at beginningflasktape recordingquitting a jobshow businesssaxophonerags to richestv studiocadillacreference to john f. kennedycomebackprice of fameblues musicegoflash cameratriounwed pregnancycar salesmangirl groupreference to martin luther king jr.music producerannouncerjazz clubgospel musicsoul musicsaxophonistbased on stage musicaltalent contestmedical clinicplaying against typealleywayrhythm and bluesscreening roomphoto sessionreference to lyndon johnsontambourinechaperonerace riotreference to cleopatramusical trioracist jokemusical quartettape playermotownmiami beach floridatheatrical managerbackup singerroman a clefpayolareference to ed sullivan45 recordingprimadonnareference to dick clark (See All) |
Bandit and Cledus are two truck-driving southerners who accept a dare from big-shots Big and Little Enos to pick up a truckload of beer from Texas and return it to them within a specified amount of time. Picking it up is simple enough, but as they are leaving Texas, Bandit unwittingly picks up Carri β¦e, a hitchhiking bride-to-be who just left her groom, Junior, at the altar. Junior, however, is the son of Sheriff Buford T. Justice. And when Buford and Junior discover what has happened, they go on a "high-speed pursuit" across the Southeast to catch the bandit. (Read More)
Themes: | angerfriendshipfuneral |
Mood: | car chasebreaking the fourth wall |
Locations: | barhelicoptermotorcyclecemeterywoodspolice carroad triplaketruckgas stationtexasroad moviemotorcycle accidentcar in water |
Characters: | dancerfather son relationshippoliceprostitutepolice officermusicianlittle girlwaitresssheriffpolice chasetruck driverpolice arrest |
Story: | wedding gownmusic bandbridestagemistaken identitygay slursingingcharacter name in titleblooddogfightbeatingfistfightcar accidentarrest β¦beercar crashhandcuffscompetitionbridgefour word titledinerfishingjourneyold womanbinocularsmicrophoneon the roadconvertiblecheerleaderracenipples visible through clothingwarehousehatcowboy hatvandalismblockbustervisitdriving a carhitchhikingredneckpet dogevidencehighwaywedding dressbetstadiumsirennotebookspeedmasturbation referenceroadblockwagermailboxalabamageorgiapondmoustachedocumenthammocktow truckbadgecashmotorcycle coptoilet papermississippitruckercamperforkliftmuralarkansasfootball gamejumping off a bridgeconvoyprocessionbannerstate troopercoors beerspeeding vehiclereference to fred astairetravellingfast carobscene gesturebootleggerinspectionservice stationhighway patrolreference to elton johnlawmanrunaway bridecb radiohambasset houndcarsploitationbootleggingreference to ginger rogerswreckagetractor trailerfreighttrans amtire swingeighteen wheelercounterbus depotrigjurisdictioncitizens band radiostate line (See All) |
In the 1860s, five men have been tracking a sixth across Nevada for more than two weeks. They shoot and wound him, but he gets away. They pursue, led by the dour Carver, who will pay them each $1 a day once he's captured. The hunted is Gideon, resourceful, skilled with a knife. Gideon's flight and C β¦arver's hunt require horses, water, and bullets. The course takes them past lone settlers, a wagon train, a rail crew, settlements, and an Indian philosopher. What is the reason for the hunt; what connects Gideon and Carver? What happened at Seraphim Falls? (Read More)
Subgenre: | cult film |
Themes: | murderdeathrevengesurrealismreligionmoneydrinkingescapenaturerobberytheftobsessiongriefdeath of wifevengeance β¦justicedevilwilderness (See All) |
Mood: | rain |
Locations: | campfiretrainforestsnowdesertwaterwoodsfarmstormlog cabin |
Characters: | native americanfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipboybrother sister relationshipteenage girlprostitutegirlsoldiermusicianbabyhostagethief β¦christianreference to godlittle boychineseex soldier (See All) |
Period: | winter19th century1860s |
Story: | six gunfrontierwild westmusic bandfireplacecabincowboytearsface slapdancingbloodviolenceflashbackfightknife β¦chasesurprise endingpistolfirecryingshootoutcorpseshot to deathfistfightfoodhorseshot in the chestshotgunslow motion scenedrinkundressingbrawlshootingrifleheld at gunpointrunningdead bodyprayerrevolverrivercombatsubjective camerasurvivalfoot chaseambushmountaineatingarmyone man armyunderwater scenesearchcigar smokingpainon the rungunshotduelone against manyprologuetentknocked outopening action sceneattempted rapefarmerpursuithorse ridingtied upwaterfallshot in the armarsoncivil wargoldcaptainbulletkilling an animalwhat happened to epiloguewoundinjuryshot in the stomachtold in flashbackcowboy hatbarnlosscamprebeltorchmexican standoffcolonelindianfull moonlandscapesufferingu.s. armykicked in the crotchbible quotedisembowelmentoutlawbooby trapbounty hunterknife throwingsnowingburned to deathpipe smokingmormonintestinesstrugglerobberbandagespit in the facemetaphorquick drawbank robbercowboy bootscornfieldrailroadmercy killingindustryamerican civil warold westtreacheryoutlaw gangloss of familyhorse and wagonhouse firewanted posterpioneerthirstrepeating riflewagonbear trapcanteengold coinpick axetradefreezingpossecadavertrackervendorprairiesaddlegunpowderfalling from a treeagonyrocky mountainsriver rapidstrackingfalling off horseencampmentstomach ripped opencarcasspistol duelzealotbowie knifecovered wagonarm woundstarting a firefalling into a riverbadlandsforemanbonnetgang of outlawspeddlerrailroad tracksrapidsconfederate soldierwagon trainconfederate armyfrontier justiceyankeejugknife in throatcauterizing a woundexpansionrailroad constructionunion soldierknife through headburning a houseface offpistol whippingremedyyear 1818year 1868 (See All) |
When a man selects a mail order bride, he is surprised to see the beauty who appears before him. She alleges that she sent false photos to him to assure that he would love her for what she is and not for her beauty. However, what she is is a con artist, prostitute, and actress, who teams with a fell β¦ow actor to steal money from men. What she does not expect is that she falls in love with her new husband and ultimately must decide between him and her sadistic former lover. Contains explicit sex including sadistic acts as Thomas Jane cuts Jolie's back with a knife as part of their lovemaking. (Read More)
Subgenre: | suspenseerotic thriller |
Themes: | theatregamblingweddingmurderdeathmarriagerapemoneybetrayalprisondrinkingdrunkennessdanceinvestigation β¦deceptionseductionrobberytheftobsessionmental illnessexecutionwealthcheating (See All) |
Mood: | rainnightmare |
Locations: | trainbarrestaurantboatbathtubshipbrothel |
Characters: | dancerhusband wife relationshipprostituteactorpriestsister sister relationshipthiefactressbest friendgay kisslustbibleex boyfriend ex girlfriend relationshipself mutilationself cutting |
Period: | 1900s |
Story: | theatre audiencehorse and carriagebrideprisonertearsdancinggunfemale nuditybased on novelbloodmale nudityviolencefemale frontal nudityflashback β¦male rear nuditybare chested malesex scenekissfightphotographpartysurprise endingvoice over narrationcryingunderwearhorsemirrorremakeslow motion scenedrinkbare buttmasklettershootingliecafepianoprayermale pubic haircriminalorphanbedroomoperacandleboxingbirdfemme fatalecigar smokingtalking to the cameracoffeeflash forwardconfessioncostumechampagnefugitivepoisonpossessionpassionsuitcasebankscarpursuithorse ridingratsuspicionkissing while having sextrustteadesirefaintingservantfaked deathorphanageparadefestivalcarnivalfalse identityorchestrabreakfastcannonbackstageimpostorbroken glasscard playingbathingcubadeceitwedding ringprison cellpierpassionate kissprivate investigatorinvestigatorschemegun held to headtheatre productionforeplaymoroccoecstasysunrisepalm treerespectgroomdisillusionmentdead birdcubanportunwanted kissplantationpoker gamesailing shipbird cageimpersonatorborderline personality disorderhavana cubaremake of french filmbank managerblowing a kisscuttingbank accountcloakspongekissing breastssaladorchestra conductorcaged birdescape planmail order bridehandwritingtheatrical playblank bulletsteamshipmissionary sex positiontwo in a bathdelawaresuicidal thoughtcoffee plantationcanopy bededwardian ageedwardian fashionoxymorondeath of bird (See All) |
Shane rides into a conflict between cattleman Ryker and a bunch of settlers, like Joe Starrett and his family, whose land Ryker wants. When Shane beats up Ryker's man Chris, Ryker tries to buy him. Then Shane and Joe take on the whole Ryker crew. Ryker sends to Cheyenne for truly evil gunslinger Wil β¦son. Shane must clear out all the guns from the valley. (Read More)
Subgenre: | melodrama |
Themes: | murderdeathfriendshiprevengejealousydrinkingfearfuneralherodeath of fathergriefmurder of fathermurder of husband |
Mood: | rain |
Locations: | cemeteryfarmbar shootout |
Characters: | love triangledancersingerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendbrother brother relationshiptough guylittle girlbully |
Period: | 19th century1870s |
Story: | frontier townsalooncabincowboybartenderaxetearssingingdancingcharacter name in titlegunbased on novelbloodviolenceone word title β¦dogbare chested malekissfighttitle spoken by characterpartypistolfirecryingsongshootoutbeatingfistfightfoodhorseshot in the chestshotgundrinkgunfightbrawlshootingbookshowdownriflerunningdead bodyneighborprayerriverold manmountainmontagewidowimmigrantapologycoffincigar smokingone against manyevil manreadingfarmerstreet shootoutamerican flagdeath of husbandpiggardenfireworkscowtrustarsonhatehenchmanmachismowoundfaintinghatblockbusterstrangercommunityhonorbar fightgun battlecelebrationwhiskeytarget practicethunderbraveryshoppingshovelcard playinghit on the headoutlawrainstormdeerwedding dressinsultlanternloss of husbandmeetingpipe smokingmudhorseback ridingintimidationanniversarybarking doghandshakeforename as titlegardeningdrifterpistol whiphead woundfencequick drawcattleharmonicagunslingerknocked unconscioustoastalabamaold westclothingsix shooterhorse racefourth of julyblacksmithhymnhorse and wagonmain character shotgunfighterbreaking a bottle over someone's headwedding anniversaryprecocious childmysterious strangersquatterrocking chairtauntingretreatchopping woodcowardicebedtime storyfoot pursuitbloody facehit with a chairponywyomingman boy relationshiprancherstarting overwatching someonecreeklord's prayerbeing watchedgeneral storeshellmerchantdrink thrown into someone's facesaddlesettlerunityoutnumberedstampedeindividualitypleadingultimatumbarroom brawlecholooking through a windowfalling off a balconyindependence daycold blooded killersmall western townhired gunmaverickcivil war veterancovered wagonfarm handnightshirtsetting a firehomesteadcalfstanding in the rainstoicismcandy canelawlessnesscoltsoda pophit with a sticktree stumpanti violencebragginghired handbraggartjugpig farmercataloguedeer antlersgun holsterhit on the head with a guntalking through a windowburning a housecattlemanhomesteaderthrowing a drink on someonebronc busterland baronpunch upturpentinecheyenne wyomingrope knotwedding marchcheyenne indiansleeping in a barn (See All) |
After a chance encounter at a theater, two men, Benigno and Marco, meet at a private clinic where Benigno works. Lydia, Marco's girlfriend and a bullfighter by profession, has been gored and is in a coma. It so happens that Benigno is looking after another woman in a coma, Alicia, a young ballet stu β¦dent. The lives of the four characters will flow in all directions, past, present and future, dragging all of them towards an unsuspected destiny. (Read More)
Subgenre: | melodramasilent movie |
Themes: | theatreweddingfriendshipsuiciderapeprisonpregnancyfearmemorylonelinesstheftobsessionpanicunlikely friendship |
Mood: | rain |
Locations: | barhospitalchurchswimming poolhotelcemeterytaxirural settingapartmentspaincatholic church |
Characters: | dancersingerfather daughter relationshipdoctorteachernursestudentmusicianphotographerwriterpriestlawyeractresslittle girllust β¦psychiatristpregnant from rape (See All) |
Period: | 2000s |
Story: | wedding gownbridestagebartendergay slurtearssingingsexfemale nuditynuditybloodmale nudityfemale frontal nudityflashback β¦nipplesphotographtitle spoken by characterpantiesshowercryingcell phoneslow motion scenewatching tvcomputercameraswordarrestundressingbare buttlettercar crashjailvoyeurreporterswimmingjournalistbraconcertambulancewomanfemale pubic hairsnakewhite pantiesdream sequencescantily clad femalehit by a carritualmicrophonecostumeuniformmassagebaseball batscreamtragic eventfilm within a filmcinemaballettraditionentertainmentnipples visible through clothingsexual abusecomaexerciseguitaristbuttocksmovie theatervisittimeaudiencetv showhaircutwatching televisionspanishrainstormsymbolismman cryingmale objectificationmenstruationnotebookimperative in titlemetaphorsubtitlesautographstage playnewspaper articleinfatuationballerinaactual animal killedbullgroomprison visitcapemadrid spaininmatetragic loveentertainerriteshrineiconsuicide notephobiacurtaincustombullfightingbedriddenspectatorcrutchshrinkingloss of girlfriendcompact discmale nurseembroiderybullfighterphysical therapyconciergejordanwalking canematadorbullfightballet classcharacter appears in newspaperappointmentballet schoolballet teacherbullringdance showlobbycoming out of a comatorerocoma rapegoringnewspaper obituary (See All) |
Outside a movie premiere, enthusiastic fan Peppy Miller literally bumps into the swashbuckling hero of the silent film, George Valentin. The star reacts graciously and Peppy plants a kiss on his cheek as they are surrounded by photographers. The headlines demand: "Who's That Girl?" and Peppy is insp β¦ired to audition for a dancing bit-part at the studio. However as Peppy slowly rises through the industry, the introduction of talking-pictures turns Valentin's world upside-down. (Read More)
Subgenre: | silent filmslapstick comedyswashbucklersilent moviesilent filmmaking |
Themes: | angerfriendshipjealousydrinkingdrunkennessfilmmakingphotographyhollywoodfalling in lovewritingnear death experienceold hollywood |
Mood: | rainbehind the scenesfilm history |
Locations: | barhospitalrestaurantairplanelos angeles californiabusapartment |
Characters: | dancerhusband wife relationshipfrienddoctornursepolicemanactorphotographerartistactressfilm directorhuman animal relationship |
Period: | 1930s1920s20th century |
Story: | theatre audienceposterdressing roomapplausebartendertearspaintingdancingguninterviewdogtwo word titlekisscigarette smokingphotograph β¦pistolfirecryingfoodcar accidentmirrorslow motion scenecameradrinkriflerunningcafetelephonereporternewspapersword fightmontageeatingsuicide attemptapologydream sequencesearchcigar smokinglimousinemicrophonefired from the jobfantasy sequencestatueflowerssplit screenfilm within a filmsadnessobscene finger gesturetypewriternewspaper headlinearsonrecord playerlooking at oneself in a mirrorfamerecordingwatching a moviehollywood californiamovie starmovie theaterladdercrying manorchestramovie theatreshoesbackstagemovie setdespairbutlerlaughterblack and whiteprideshadowfilm producerscreenwriterraised middle fingermustachetuxedopajamassmokefilm industryauctionchauffeursaving a lifeearphonesbarking doggun in mouthmovie producerstairwayjazz musicfilm projectorfilm cameramegaphoneunhappinesswhistlinghollywood signmovie studiofilm studiocoincidencesecond chancefeathersilencekiss on the cheekrise and fallsuicidal thoughtsflash cameratop hatspotlighttap dancingnightgownanimal in cast creditstelephone numberdutch anglewife leaves husbandportrait paintingfictional biographymakeup artisthand kissingwaltzfilm reelfilm premierereference to napoleonblowing a kissquicksandwashed up starbuilding on fireunhappy wifecannes film festivalmatchesmovie businessriches to ragsorchestra conductorhand bandagemarqueepawn shopscreening roomactor's lifeflappermovie extrayear 1930year 1932auctioneerfan the personchance encountertap dancerstock market crashterrieralmost hit by a caryear 1928year 1929theatre marqueecar crashing into a treewriting on a mirroryear 1931bumping into someonecharleston the danceclapperboardiris shotsilent film starjack russell terrierbig breakyear 1927abandoned by wifemen's clothing storemurphy bedvariety the newspaperburned handclapperrefusing to talksilent screamstaircase conversationtalkiedelirium tremenswinking at the cameradog trickcar crashes into a treereflection in a store windowsilent movie starbeauty spothollywoodland (See All) |
Scarlett is a woman who can deal with a nation at war, Atlanta burning, the Union Army carrying off everything from her beloved Tara, the carpetbaggers who arrive after the war. Scarlett is beautiful. She has vitality. But Ashley, the man she has wanted for so long, is going to marry his placid cous β¦in, Melanie. Mammy warns Scarlett to behave herself at the party at Twelve Oaks. There is a new man there that day, the day the Civil War begins. Rhett Butler. Scarlett does not know he is in the room when she pleads with Ashley to choose her instead of Melanie. (Read More)
Subgenre: | melodramaepic |
Themes: | angerweddingmurderdeathfriendshipmarriageinfidelitychristmasmoneyjealousypoliticspregnancyfeardrunkennessdivorce β¦theftdeath of fatherdeath of motherpovertygriefmental illnessunrequited lovealcoholismdeath of wifewealthcourageself sacrificedeath of unborn child (See All) |
Mood: | nightmare |
Locations: | trainhospitalparis francelondon englandbrothelcity on fire |
Characters: | love triangledancerfemale protagonistsingerfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americandoctorbrother brother relationshipbrother sister relationshipteenage girlprostitutesoldier β¦nursebabysister sister relationshipthiefchristianreference to godalcoholicmaidolder man younger woman relationshipcousin cousin relationshipaunt niece relationshipbaby cryingold maid (See All) |
Period: | 19th century1800s1860s1870s |
Story: | pantaloonsaloonhorse and carriagewhipprisoneraxetearsrescueface slapsingingdancinggunf ratedbased on novelblood β¦dogsex scenekissfightphotographexplosionpartypistolfirecryingsongfoodhorsemirrorshot in the headswordarrestundressingsecretletterbooklieriflebirthdaydead bodyprostitutionjailprayerwomanwidowfour word titleapologyfemme fatalemarriage proposalpaingravelibraryattackliarchampagnepassionreadingdeath of childchristmas treelightningscreamattempted rapeshot in the shoulderbusinesschildbirthdeath of sonwitnesstraploss of fatherreunionloss of mothertwinblack americanstrong female charactertwenty somethingflirtingcivil warscandalbirthday cakeeavesdroppingfalling down stairscaptainpokerwoundfaintingred dressslaverybarnaccidental deathblockbustergossipservantrebelrailway stationstrong female leadbirthhonorslavecannonwindexplosivecorsetbraverymourningloss of sonnew orleans louisianabusinesswomanhungerevacuationcard playingdark herorivalfogconvictcapturewedding ringbalconyraidsiegebarbecueextortionloss of husbandtripchloroformmiscarriageshamehorseback ridinggiving birthhysteriajewelrystoresouthernerirish americanbandagepost warwoman cryinghomecomingmental breakdownreading aloudcrutchesphysicianstairwayestatefencemajorsouthern u.s.disposing of a dead bodyhoneymoonearringbroken mirrorself defenseunconsciousnessnarcissismpocket watchstretcherwhistlingamputationmilitary uniformamerican civil warkindnessafrican american womangeorgiaatlanta georgianewborn babybleeding to deathcowardmarriage engagementstar crossed loversfamous scorerainbowhonestyorchestral music scoretitle same as bookbattle of the sexesopposites attractknittinghypocritewriting a letterku klux klansurrenderbegginghorse and wagondeathbedsilhouettefamous linedeterminationplantationfleeingattempted robberyexpectant motherinner title cardpackingvulturehigh societycurtainworking outballroom dancingbrothel madamdefeatgold coinkneelingportrait paintingponythreat to killexpectant fatherfaminehandkerchiefoverheard conversationbrandydevastationmidwifesister in lawwaltzmaster servant relationshippneumoniababy carriagegoodbyepulitzer prize sourcemerchantdeath of a childembroideryblockadeheadstonewoman in laborstained glass windowreconstructionwounded soldierlandownermerry christmasnurserycolognespoiled childflirtfiddletalking to the deadconfederate flagpeacockindifferencescavengerstubbornnessnursingrich snobwashing clothesbreakfast in bedaudio flashbacksurprise birthday partytaxesblue eyesdragging a dead bodysister in law sister in law relationshipbondfiddlerfund raisingriverboatrocking horseu.s. civil warpramsouthern belleshantytowncottonpost civil warbaby bornarms smugglinglicemorning afterfalling off a horsesavannah georgialeg amputationdance partythrown from a horsebonnetdeclaration of lovethumb suckingsoilkissing someone's handretailconfederate soldierhiccupslave girlspurned womanintermissionnarcissistic personality disorderspoiled girltape measureconfederate armycombat casualtyhome birthlying in waitatlantafemale slavepetticoatyankeeinvading armymaster slave relationshipcharleston south carolinacotton fieldsherrythrown from a bridgedrunken singinggeorgia usalumberyardbrushing one's hairfemale cryingmeaslesbaby talkbattle of gettysburgcausalityflute playerfuneral wreathmarriage proposal on one's kneesdeath of a horsefake drunkennesshorse riding accidentlost causespurned malekicking a dooroverturetyphoidcharity balldestroyed buildingpolitical meetingshoulder woundsmelling saltsspurned manconfederate states of americadixiejoining the armylumber milllying in stateman carrying a woman in his armsoverseerpicking cottonradishstolen horseball gownfurloughgallantrydespondencyfanning oneselfside saddlethrowing a vase (See All) |
Ben Sobol, Psychiatrist, has a few problems: His son spies on his patients when they open up their heart, his parents don't want to attend his upcoming wedding and his patients' problems don't challenge him at all. Paul Vitti, Godfather, has a few problems as well: Sudden anxiety attacks in public, β¦a certain disability to kill people and his best part ceasing service when needed. One day, Ben unfortunately crashes into one of Vitti's cars. The exchange of Ben's business card is followed by a business visit of Don Paul Vitti himself, who wants to be free of inner conflict within two weeks, before all the Mafia Dons meet. Now, Ben Sobol feels somewhat challenged, as his wedding is soon, his only patient keeps him busy by regarding Ben's duty as a 24 hour standby and the feds keep forcing him to spy on Paul Vitti. And how do you treat a patient who usually solves problems with a gun? (Read More)
Themes: | angerweddingmurderdeathinfidelitybetrayalprisongangsterdeceptionmafiaguiltmental illnesssurveillancerivalryabduction β¦second marriage (See All) |
Mood: | satirespoof |
Locations: | barhospitalnew york citybeachrestaurantchurchswimming poolhotelhelicopterfarmpolice car |
Characters: | singerfather son relationshippolicemother son relationshipdoctorpolice officerpriestjewishhitmanpsychiatristdoctor patient relationship |
Period: | 1990s |
Story: | wedding gownbrideapplauseprisonergay slurtearssingingdancingguninterviewphotographpartycryingshot to deathmachine gun β¦car accidentshotgunpunched in the facewatching tvcomputerarrestgunfightheld at gunpointlingerierevolverreportercleavagenew yorkvideo camerabridgedinerapologydream sequencescantily clad femaleassassinationritualvoice overgunshotattempted murderauthorbinocularsfbifantasy sequencefactoryundercovertankpianisttied upsilencercowtherapymachismorecordingpatientfbi agentmobstertherapistfloridamobsharkaudiencestupidityitalian americanmiami floridaaquariumraidmeetingsirenhogtiedmob bosscontractceremonyshowimpotencetractorfountainwhalecornfieldtoastmafia bossstressritepillowmob hitcanceled weddingpanic attackreference to sigmund freudfather in lawsexual intercoursegetawayharpreference to marlon brandofalling out a windowcounsellornew york stateoedipus complexpsychotherapistanxiety attackvowcar trunkreference to mark twainyear 1957analystshorelineclosuredisturbed childhoodjazz combofender benderfreudmiami beachpolice busthands upstate policegraphbrooklyn dodgersruined lifefake evidencemob summitshark tankreference to tony bennettfruit seller (See All) |
In Paris, before WWI, two friends, Jules (Austrian) and Jim (French) fall in love with the same woman, Catherine. But Catherine loves and marries Jules. After the war, when they meet again in Germany, Catherine starts to love Jim... This is the story of three people in love, a love which does not af β¦fect their friendship, and about how their relationship evolves with the years. (Read More)
Themes: | theatrelovefriendshipsuicidemarriageinfidelityjealousyadulterypregnancyunrequited loveend of love |
Mood: | archive footagemurder suicide |
Locations: | trainbeachforestcarcemeteryparis francerural settingfrancelakeoceangermany |
Characters: | love trianglesingerhusband wife relationshipfather daughter relationshipmother daughter relationshipprostitutesoldiermusicianwriterartistlittle girlgerman |
Period: | 1930s1920s1910s |
Story: | theatre audiencehorse and carriagecross dressingpaintingface slapsingingcharacter name in titlebased on novelbare chested malekisscigarette smokingtitle spoken by characterexplosionthree word titlevoice over narration β¦songbattleletterrunningcar crashcaferevolverrivermenage a troisswimmingwomanbridgearmyboxingcoffincigar smokingmarriage proposaltrainingvacationstatuepianistcountrysidetragic eventautomobileworld war onecinemahandgunreference to william shakespearegraffitifreeze framewaiterfriendship between menguitaristwatching a movierowboatfogvoice over letterpromiscuityadulterous wifeunhappy marriagecremationstock footageeiffel tower parisfemale psychopathbachelorstage playfencinggramophonefootsie under the tableashesanarchistcountry househammocktitle same as bookfatal attractionjumping into waterurnbromancetitle spoken by narratorletter writingrocking chairaustrianbombardmentreference to pablo picassomausoleumpolyamorycrematoriummanipulative womanopening narrationslide projectorwoman dressed as manhourglassreference to napoleonmillbook burningseine riverpost world war onedominoesla marseillaisereference to oscar wildereference to wolfgang amadeus mozartbikingreference to the nazispre world war twofrench new wavewhite winereference to johann wolfgang von goethesloganbachelorettebisexual interestnouvelle vaguereference to don quixotejumping into a riverbohemian lifeclothes on firereference to charles baudelairesulphuric acidfrench literatureliterary narrationliterary quotedriving off a bridge (See All) |
"Farewell, My Concubine" is a movie with two parallel, intertwined stories. It is the story of two performers in the Beijing Opera, stage brothers, and the woman who comes between them. At the same time, it attempts to do no less than squeeze the entire political history of China in the twentieth ce β¦ntury into a three-hour time-frame. (Read More)
Subgenre: | epicperiod drama |
Themes: | theatreangerdeathlovefriendshipsuicidemarriagedrugsrapebetrayalpoliticsdrinkingfeartorturedrunkenness β¦militaryobsessionblackmaildrug useexecutioncommunismdrug addictiondeath of baby (See All) |
Mood: | rain |
Locations: | schoolsnowjapancourtroomchinabrothel |
Characters: | love trianglesingerhusband wife relationshiphomosexualmother son relationshipfriendboyprostituteteenage boyteachersoldierstudentactorphotographerbaby β¦best friendjapanesemotherhomosexualityteacher student relationshipsuicide by hangingart teacherex prostituteprostitute motherdeath of teacher (See All) |
Period: | world war two1970s1960s1940s1930s1920s |
Story: | theatre audiencefemale impersonatorstageprisonertearsrescuesingingsexfemale nudityf ratedbased on novelnuditybloodmale nudityflashback β¦male frontal nuditymale rear nuditydogkissphotographknifechasefirecryingsongbeatingdrinkswordarrestundressingletterrunninginterrogationprostitutionoperaarmysnakefishchild abuseapologytrialbirdspankingflash forwardconfessiontheaterdrug addictumbrelladragonhangingcourtrunawayriottraitorteadrugfamecommunistfateappledamsel in distressexplosivesevered fingerbreakupinvasionfanevacuationaquariummakeupdead childengagementbathingfallsocietycastrationmiscarriagepipe smokingarrogancerevolutionaryrunning awaycorporal punishmentdisciplinekitefinger cut offtaiwantransvestismacrobatmarriage engagementnationalismopiumfiring squadwarlordsurrendersnailaccusationretributionfirecrackerbeijing chinaimperialismfingercourtesansneezingjapanese armycultural revolutionfalse confessionjapanese occupationtheater troupechild suicidechinese operachinese historyexoticahanged childburning a lettertheatrical troupecounter revolutionhand slapyear 1924counter revolutionarypeking chinaburning letterhitting oneselftheater audiencepeking operapeople's liberation armyknife sharpenerjapanese surrendermother abandons sonskipping class (See All) |
1882, New Mexico Territory. Virgil Cole and Everett Hitch are itinerant lawmen, hired by desperate towns as marshal and deputy. The city fathers of Appaloosa hire them after Randall Bragg, a newly-arrived rancher with money and a gang of thugs, disrupts commerce and kills three local lawmen. Cole an β¦d Hitch contrive to arrest Bragg and bring him to trial, but hanging him proves difficult. Meanwhile, a widow has arrived in town, Allison French, pretty, refined, and good-natured. Virgil falls hard, and it seems mutual, but there may be more to Allie than meets the eye. Can friendship and skill with a gun overcome a pernicious villain and green-eyed jealousy? (Read More)
Subgenre: | suspense |
Themes: | murderdeathfriendshiprevengekidnappinginfidelityrapebetrayaljealousydrinkingfeardrunkennessunfaithfulnessrivalryjustice |
Mood: | ambivalence |
Locations: | campfiretrainbarrestauranthotelsmall towncourtroomnew mexicobar shootoutnew girl in town |
Characters: | native americanlove trianglefriendboyfriend girlfriend relationshipbrother brother relationshipboyprostitutehostagelawyerbest friendwaitressbiblesheriffcousin cousin relationshipmayor β¦ex soldierwriter directoractor director writer (See All) |
Period: | 19th century1880s |
Story: | stagecoachsalooncowboybartenderprisonerface slapgunfemale nuditybased on novelbloodmale nudityviolenceone word titlemale rear nuditybare chested male β¦kissfemale rear nuditycigarette smokingtitle spoken by characterpistolvoice over narrationshootoutbeatingshot to deathunderwearfoodhorsemirrorshot in the chestshotgunpunched in the facedrinkarrestgunfightshootingbookshowdownrifleheld at gunpointcafepianojailrevolverriversurvivalnewspapereatingwidowjudgetrialpolice officer killedsearchcigar smokingshot in the legduelcharacter repeating someone else's dialogueprologuewritten and directed by cast memberreadingopening action sceneringhangingstreet shootoutcourtdirected by starpianistpursuitdeath of husbandhorse ridingwitnessshot in the armtrustredheadhenchmanloyaltykilling an animalspearlawjail cellcampproduced by directormexican standofftelescopepartnergunshot woundkicked in the crotchdark herorivalbathingcaneminedark pastlooking at self in mirrorranchtragic herocontractsidekicktestimonypistol whiptwo man armyquick drawdouble barreled shotgungunslingerhired killerdeputybullet woundmurder witnessold westwindmillbadgetelegramrepeated linelimpiowahorse and wagonmain character shotvillain arrestedwinchester riflesecret pastcurtainammunitioneye witnessbrief female nuditylaw enforcementtrain conductorwalking stickrancheru.s. marshalwater towerdilemmaleg braceambiguityouthousecougarmarshaltown name in titleproduced by actorsentenced to deathapachepardonescape from custodyteeth knocked outkilling a horsecivil war veterannative american attackmountain lionshooting a horsechinese immigrantlong underwearlaw and orderconflicted herohouse constructionriver battlefrontier justicesquawrope around neckapache tribepeacekeeperbathing in a riverrailroad trestlereference to ralph waldo emersonpost american civil war (See All) |
In 1848, a New York bank wants to put a railroad across Mexico, so it buys up small banks around Santa Rita, Durango, and evicts farmers on the proposed rail line who owe money. The bank's henchman is the murderous Jackson. He runs afoul of two women, Maria, the tough but uneducated daughter of a fa β¦rmer, and Sara, the European-educated daughter of the owner of one of these banks. To feed the now landless people and to seek revenge, Maria and Sara become bank robbers, veritable Robin Hoods. But Jackson and his hired guns are after them. What are the women's options? (Read More)
Subgenre: | independent filmblack comedyheistfish out of watercaperbuddy comedyheist gone wrong |
Themes: | angermurderdeathrevengemoneybetrayalfearescapedeceptionseductionrobberycorruptiondeath of fatherbrutalityparanoia β¦blackmailhopehomelessnesscouragenear death experience (See All) |
Locations: | campfiretrainbarnew york citychurchsmall towndesertpolice stationfarmrooftopcavemexicotexas |
Characters: | female protagonistfather daughter relationshipprostitutedetectivephotographerpriestthiefhitmanpolice detectiveamerican abroadfiance fiancee relationshipfarm girl |
Period: | 19th century1840s |
Story: | female gunfightersaloonbow and arrowcowboyaxerescueface slapgunviolenceone word titledogkissfightcigarette smokingtitle spoken by character β¦explosionknifechasesurprise endingpistolfireshootoutcorpseshot to deathhorseshot in the chestshot in the headshotgunslow motion scenepunched in the facecameraswordarrestgunfightfalling from heightshowdownrifleheld at gunpointinterrogationhandcuffsrevolverriverscientistshot in the backswimminggood versus evilcleavagefoot chasecandlegangambushdisguisemansionwomanmontagemapman with glassesscantily clad femaledouble crossfemme fataletrainingattempted murderone against manycharacter repeating someone else's dialogueattackpoisonumbrellarace against timestatueevil manknocked outtough girlbankfarmerstreet shootoutmanipulationscarloss of fatherthreatened with a knifebank robberydirectorial debutshot in the armvigilanteclass differencesnewspaper headlinesubtitled scenearsonstylized violencehenchmaneavesdroppingropegoldlooking at oneself in a mirrorcatfightcowboy hattied to a bedexploding buildingservantculture clashtorchaction heroinemexican standoffgun fusocial commentaryfemale warriorthugtarget practicecorsetbraverycrossbowhatredpartnermercilessnessescape attemptsafedynamitebooby trapwedding dressknife throwingpassionate kisspolice inspectormoral dilemmapipe smokingsouthern accentbullet timedrugged drinkbag of moneylatinafinal showdownrobberfountainalarmarcherybank robbergovernorrailwayfalling into waterbankercowboy bootsrailroadoffscreen killingwoman kills a manfight the systemduorighteous ragehomeless personbowmagnifying glassinspectorfingerprintwanted postercowgirlanti heroineattempted robberyslow motion action scenehorse drawn carriagemoney falling through the airbank vaultbank heistcowboy shirtsneezingtranquilizer dartforensicsfemale thiefenforcergrappling hookauditoriumspursfoaming at the mouthspyglassmaster of disguiseescalationpoison dartcat fightgeopoliticsforensic scienceland ownerhiccupsfemale robberice skaterompfemale bank robber (See All) |
Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the β¦ Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)
Subgenre: | cult film |
Themes: | weddingfriendshipmoneypregnancydrinkingdrunkennessdancememory |
Mood: | breaking the fourth wall |
Locations: | barnew york citybeachchurchhotelmotorcycleairplanenightclubtaxirooftopoceanyacht |
Characters: | dancerfemale protagonistsingerhomosexualfather daughter relationshipmother daughter relationshipfriendmusicianwriterpriestsingle motherolder woman younger man relationship |
Story: | bridebartendertearssingingdancingf ratednuditymale nudityflashbackmale rear nuditydogsex scenekissejaculationphotograph β¦partypunctuation in titlecryingsongtitle directed by femalemirrorslow motion scenedrinkthongbare buttfalling from heightletterbookpianoislandguitarswimmingbandwomanbridgetoiletinternetfishno opening creditsdrawinglimousinebinocularsfantasy sequencesuitcaseflowersscene during end creditsdiaryexclamation point in titlepianistsplit screencloseted homosexualtouristfaintinglifting someone into the airtitle based on songbarnoverallsarchitectbuttocksblockbusterladdergoatearthquakepassportbarefootdivinginterracial romancehippiegreecewedding ringferryreckless drivingwedding receptiondonkeypeasantharbortriple f ratedlaundrydocksailboatold flameraftmailmailboxillegitimate childmusic boxjumping into waterbagpipesbride and groomcanceled weddingpaternitylifting female in airbridesmaidcrossing selfgirl bandbiological fathermediterraneanlifting an adult into the airbased on stage musicaltoilet stallplaying against typebachelorette partygreek islandmiddle age romancescubapushed into waterair guitarpromiscuous pasttitle sung by characterengaged couplenubile womanjukebox musicalfeather boapaddle boatresort hotelswinging on a ropesummer romancewindchimeabbafalling through the ceilingflower powerreference to aphroditeswim flippers (See All) |
A young neurosurgeon (Gene Wilder) inherits the castle of his grandfather, the famous Dr. Victor von Frankenstein. In the castle he finds a funny hunchback called Igor, a pretty lab assistant named Inga and the old housekeeper, frau Blucher -iiiiihhh!-. Young Frankenstein believes that the work of h β¦is grandfather is only crap, but when he discovers the book where the mad doctor described his reanimation experiment, he suddenly changes his mind... (Read More)
Subgenre: | cult filmhorror spoofmadcap comedy |
Themes: | theatrekidnappingmarriagemonsterpanicblindnesscheatinginheritance |
Mood: | spoofnightmareparodybreaking the fourth wallwedding night |
Locations: | traincemeteryvillagewoodscastleusalaboratory |
Characters: | husband wife relationshippolicepolice officerstudentlittle girlprofessorcheating on one's girlfriend |
Period: | 1970s1940s1930s |
Story: | theatre audiencebridefireplacecabinstagepaintingsingingdancingcharacter name in titlebased on novelsex scenesurprise endingcorpsehorsemirror β¦blondejailclassroomscientistcleavagecandlestrangulationcoffincreaturecigar smokinggravelibraryperson on firelightningskeletonhangingtrappremarital sexratflowerexperimentdestinyfarcehypodermic needlegothiclifting someone into the airmad scientistblockbusterskullrailway stationviolintorchfull moonburglaryhit in the crotchthunderstormsketchfrustrationdungeonfogsexy womancapturehousekeeperblind mangadgetpolice inspectorsurgeonbrainflat tireviolinistirreverencefianceejournallecturemakeoverwellgramophonescalpelassistantblackboardgiving a toastsoupkitefriends who live togetherchainedorchestral music scoresmall breastsnewlywedhorse and wagonhermitsecret passagereference to charles darwinvillagerlifting person in airhunchbackfrankenstein's monstertap dancinggrave diggingsittingjail breakportrait paintingmedical experimentphonograph recordhornreanimationtransylvaniaturbanprosthetic limbgallowslifting male in airmedical schoolgrandfather clockhowlinglifting an adult into the airblowing a kisscaught in a netdartsedativespit takename changebattering ramcastle thundersearch partygrave robbingashtrayone armed manmusic hallbookcasecharadescobweblecture hallreference to gary coopertown meetingprosthetic body partbrain transplantcreator creation relationshipplaying with foodseesawmusical sequence in non musical workdoor knockerknife in the thighstabbing oneselfsadistic prison guardshoeshine boyexpression taken literallymedium breastswipemob scenefrankenstein spoofprivate librarywartsilly walkmoving bookcase (See All) |
Lt. John Dunbar is dubbed a hero after he accidentally leads Union troops to a victory during the Civil War. He requests a position on the western frontier, but finds it deserted. He soon finds out he is not alone, but meets a wolf he dubs "Two-socks" and a curious Indian tribe. Dunbar quickly makes β¦ friends with the tribe, and discovers a white woman who was raised by the Indians. He gradually earns the respect of these native people, and sheds his white-man's ways. (Read More)
Subgenre: | independent filmepicrevisionist western |
Themes: | weddingmurderfriendshipsuicidemarriageherobrutalitycouragehunting |
Locations: | campfirerural setting |
Characters: | native americansoldiertough guywarriorself discoverymilitary officer |
Period: | 19th century1860s1840s |
Story: | sioux tribefrontierbow and arrowcowboyrescuecharacter name in titlebased on novelbloodmale nudityviolenceflashbackmale rear nuditytitle spoken by characterknifethree word title β¦pistolvoice over narrationshootoutbeatingshot to deathblood splatterhorseslow motion scenebattleswordgunfighthand to hand combatanimal in titlerevolvercombatambushstrangulationmassacrearmywidowcontroversycoffeeattackstorytellingtough girlskeletondiaryprankdirected by stargiftpremarital sexdirectorial debutgeneraltrustbattlefieldcivil warwolfwhat happened to epiloguehead buttspearfaintingcowboy hatassaultblockbusterflatulenceclubculture clashhonoranimal attackinterracial romanceknife fightprisoner of warrainstormraidbonfirehorseback ridingdefecationwar violencejournalmigrationarcheryanimal abusecowboy bootslanguage barriertennesseewetting pantsbayonetamerican civil warfamous scoremusketorchestral music scorekansassix shooteradopted daughterfortrepeating rifleshot with a bow and arrowflintlock riflestockholm syndromebuffalocowboy shirtscreenplay adapted by authortranslationnebraskascalpingwestern heroname changestampedetomahawkspear throwingoutpostmedicine manadoptive fatheru.s. civil warsouth dakotawar paintcarcassbisonkilling a horsewarrior racemale soldieradoptive father adopted daughter relationshiptradingcarbinefield hospitalhenry riflegrasslandgreat plainssymphonic music scoreriver battlesquawadoptive parentnative american white relationshipsadopted girlnative american chiefnative american languageleitmotiftribal warsiouxnoble savagewestward expansionnorth american indianlakota indianpawnee indian (See All) |
Reuben Feffer thinks he's found the love of his life but on his honeymoon he discovers her cheating on him with a scuba instructor. Reuben travels back home to get his life on track. On a night out with best pal, Sandy Lyle, Reuben discovers an old school friend, Polly Prince. Reuben feels a connect β¦ion straight away, and tries constantly to get her to like him. But it's not going to be easy for Reuben, especially when he spends his days calculating risks, and when someone unexpected turns up. (Read More)
Subgenre: | screwball comedy |
Themes: | angerweddingfriendshipmarriageinfidelityadulteryextramarital affairunfaithfulnessdatingblindness |
Locations: | barnew york citybeachrestaurantairplanelos angeles californianightclubrooftopcaribbean |
Characters: | dancersingerhusband wife relationshiphomosexualfather son relationshipmother son relationshipfriendtattooboyprostituteactorphotographerwriterbest friend β¦waitresssecurity guardlatinojewfrenchgay friendinsurance agentjewish wedding (See All) |
Story: | wedding gownmusic bandbridestagebartendersingingdancingbloodmale nuditysex scenekissphotographpartyknifetelephone call β¦urinationslow motion scenecomputercamerasex in bedvomitingliecafemarijuanaislandreference to jesus christprayerswimmingwinebandbasketballwomantoiletspankingpublic nuditymicrophonechampagnestorytellinghairy chestfireworkskissing while having sexredheadcheating wifefreeze framepizzawaiteranswering machinegolfdiscobuttockseccentricrehearsalflatulencesharkaudiencewomanizerart galleryembarrassmentwatching televisionspanishsculptureparachutetrophywedding receptionlaptop computerspittingmen's bathroomfilm crewgolf clubbreadlizardhoneymoonsailboatbillionairestage playdance clubscuba divingurinalinsurancemichiganhorninesshome videositting on a toiletbutt slappillowwatching a videocubanfrenchmanlobsterbagpipesnew york skylineneuroticcommitmentloudspeakernudistmotor scooterdance lessontoothairlinerdance classfrench accentindian americanmotocrosslong island new yorkbasketball courtwine bottleplay rehearsalfear of commitmentsweatinghippopotamuslaundry drying on clothes linecandy barboatingchildren's bookinsurance companygreat white sharkbase jumpingcatererferretracquetballwedding videobowel movementextreme sportreference to judashell's kitchen manhattan new york cityshipwreckedkomodo dragoncommunity centerclogged toiletsitarsalsa musicsecond familyrisk takingracket balltoilet plungeroverflowing toiletdouche bagdirty dancinghairy backshark divingforbes magazineirritable bowel syndromeflooded bathroomhand on someone's buttcommunity theatreseastorm (See All) |
High-flying, adored! The film adaptation of the hit Broadway musical depicting the infamous real-life story of Eva "Evita" Duarte de Peron, the wife of President Juan Peron, who rose from poverty to become the most famous Argentine woman in history. Her huge political influence and constant charity β¦works earned her scorn and fear from the military and upper classes but adoration and love from the workers and descamisados. Evita's legendary life is displayed before your eyes as the most hated and most beloved woman in Argentina. (Read More)
Subgenre: | cult filmrock musical |
Themes: | weddingmurderdeathmoneypoliticsdrinkingfuneralfilmmakingmilitaryseductiondeath of fatherpovertycancergriefunemployment β¦fashionwealthrevolution (See All) |
Mood: | rainbreaking the fourth wall |
Locations: | trainbarhospitalrestaurantchurchairplanebusvillagewheelchairitalyspaincatholic churchtheatre performance |
Characters: | dancerfemale protagonistsingerfamily relationshipshusband wife relationshipteenage girlprostitutephotographeractresscatholicfilm directorolder man younger woman relationshipmilitary officer |
Period: | 1940s1950s1930s1920s |
Story: | theatre audiencehorse and carriagetearssingingdancingcharacter name in titlesexone word titlephotographexplosionshowerfirevoice over narrationcryingsong β¦horsedrinkarrestcafejailprayerguitarnewspaperoperacandlewomanmontagearmypoliticianmodelradiocoffinlimousineumbrellatankbusinesspresidentfilm within a filmgovernmentclass differencesriotfamecrucifixdemonstrationwatching a movierebelrebellionrailway stationparadeviolinearthquakemovie theatrehookershoesargentinamourningnewsreel footageimmortalitychoirtourdictatorviolinisthorseback ridingrevolutionaryelectricitypopefencingindustryhearserallysouth americaillegitimate childsoccer ballrainbowclothingin medias resbuenos aires argentinavotingmovie cameradeathbedvice presidentballroomradio broadcastsocial climberglamourfortunedying youngdance hallprocessionreference to benito mussolinioperating roommarchingtear gasbased on stage musicalpolitical unrestcinderella storymilitary couppolitical rallyrise to powerpoloreference to francofuneral cortegereference to lauren bacallargentine historysinging narratorperonismreference to christian diorlying in statedeification (See All) |
Loosely based on Homer's "Odyssey," the movie deals with the picaresque adventures of Ulysses Everett McGill and his companions Delmar and Pete in 1930s Mississipi. Sprung from a chain gang and trying to reach Everett's home to recover the buried loot of a bank heist they are confronted by a series β¦of strange characters--among them sirens, a cyclops, bank robber George "Baby Face" Nelson (very annoyed by that nickname), a campaigning governor and his opponent, a KKK lynch mob, and a blind prophet who warns the trio that "the treasure you seek shall not be the treasure you find." (Read More)
Subgenre: | cult filmslapstickdieselpunk |
Themes: | angerfriendshipreligionmoneybetrayalescapegangsterracismcorruptiontheftobsessionpovertyfaithapocalypseblindness β¦escape from prisonamerican mythology (See All) |
Mood: | satirecar chase |
Locations: | campfiretrainrestaurantchurchforestsmall townwaterwoodsrural settingfarmroad movieprison farm |
Characters: | singerhusband wife relationshipfather son relationshippolicefather daughter relationshipmusicianbabylittle girlwaitresslittle boycousin cousin relationshipex husband ex wife relationshipamericanpolice arrest |
Period: | 1930s |
Story: | music bandposterwhipimpersonationapplausestagerescuesingingdancingbased on novelblooddogfightphotographexplosion β¦firecryingbeatingunderwearfistfightmachine gunsecretrifleprayerguitarriverconcertold manpoliticianboxingcoffinquestion in titleritualsearchjourneycigar smokingon the rungunshotconfessiongravemicrophonefugitiveon the roadlightningscreambankringfarmerhangingpursuitpigelectionbank robberychickenwhippingcowropeentertainmentnipples visible through clothingfarceperformancelifting someone into the airrecordingbarnguitaristwatching a moviecountry musicclubfrogaudiencetorchpreacherhitchhikingcelebrationguardredneckmovie theatredwarffloodthunderfanprophecyswampbutterflydynamiteoutlawdemocracysalesmanconvictgasolineblind maneye patchfieldrecording studioalienationmeetinggunfirerobbersouthernerbaptismbicyclingperformerbank robbergovernorwhistlecattleradio stationescaped convictgramophonepocket watchmegaphonelistening to radiohillbillygreat depressiontreasure huntcampaignpieamericanarallynoosevanitychainedfamous scoreprison breakbadgeacoustic guitarentertainerritecashku klux klanblues musichorse and wagonprophetlynchingmississippihoodcanceled weddingamerican southsolidaritygospeltoadfloodingcandidatebased on poemsouthjail breakbanjophonograph recordshackbipolar disorderhornpick axehaygetawayone eyed manbayouposseoil lamprudenessreference to the book of matthewpastichefiddleon the lamsledge hammerfolk talescaffoldspeakerbountywalking canescreenauditoriumcrossroadspolitical rallyhorsebackobeseracial injusticepardonchain gangsurroundedreformsiren the creaturecooperationyodelingbluegrasseconomic inequalitycritique of capitalismrailroad tracksinterrupted hangingmandolincrackerbluegrass musichair netgopherdouble basshoundjuggubernatorial candidatewhittlingriver baptismbible salesmantennessee valley authority (See All) |
Two sisters, plus a dead mother, a remarried father, and a hostile step-mother. The sisters, each in her way, have perfected the art of losing. The elder, Rose, is an attorney, responsible, lonely, with a closet full of shoes. The younger is Maggie, beautiful, selfish, and irresponsible. Her drunken β¦ behavior gets her tossed by her step-mother from her dad's house; worse behavior gets her tossed from Rose's apartment. Then, while searching in her father's desk for money to filch, Maggie finds an address; the past and the future open up to her and, with any luck, may open to her sister as well. (Read More)
Themes: | weddingdeathfriendshipsuicidemarriagemoneydrinkingdrunkennesslonelinesstheftdeath of motherdysfunctional familycancerguiltgrief β¦mental illnesspoetrydeath of wifeunemploymentforgivenessdeath of daughtersuicide of mothersuicide of daughter (See All) |
Mood: | rain |
Locations: | chicago illinoistrainbarbeachrestaurantswimming poolhotelsnownightclubofficetrain stationsex in a bathroomjapanese restaurant |
Characters: | dancerfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipfrienddoctorteachernursemusicianlawyersister sister relationshipthiefjewishwaitress β¦japaneseprofessorjewamericangrandfather grandson relationshipgrandmother granddaughter relationshipstepmother stepdaughter relationship (See All) |
Period: | 2000s |
Story: | wedding gownplaying cardsmusic bandbridebartendertearsdancingsexf ratedbased on novelflashbackdogkisscigarette smoking β¦photographpartyknifepantiestelephone callvoice over narrationcryingcell phonehigh heelsunderwearfoodcar accidenturinationblondewatching tvcomputerdrinkbikinisecretletterbookvomitingliebeercafenewspaperbrawineold manvideo camerabasketballwomaneatingwidowdinertoiletsearchold womanlimousineliarpay phoneumbrellaauditionstatuereadingscreamringdeath of husbandreunionpickup truckpoemsupermarketballoonice creamfloridaphone boothswimsuitmilkcelebrationyogaremote controlrear entry sexgrocery storereconciliationshoespet dogshoppingco workermedicationengagementdeceitphiladelphia pennsylvaniablind manpuppyfamily secretpromiscuitycrowdphoto albumengagement ringlaptop computerjewelrylaundryinsecuritysenior citizenmetaphormakeoverstepmotherponytailrumorretirement homemaking outcredit cardunconsciousnessmtvcabaretarenailliteracynursing homegroommonitorclothingpun in titlesushimonumenttai chipigtailssuicide notereggaemortalitysleeping on a couchslide showreference to josef stalincity parkjob seekingspectatorlaw firmtv cameramanic depressionhigh school reunionsnoopingphone bookbusiness tripplaying chesstiaracuisineclass reunionpet shopdyslexiablamejudgmentscreen testwalking canelunchboxmultiple narratorsretireepet storereference to fred astairebimbodog walkerchopsticks the eating utensillearning disabilitygreeting cardresumedelicatessenkeychainvisually impaired persondisgruntled customerprinceton universityslobbridal showerreference to jackie kennedyteleprompterjob applicanttowing a carwant admiami beach floridadisplay caseauto impound lotbrooklyn dodgerscorsagebongosleave of absencemazel tovshuffleboardstilettobasketball matchreference to e.e. cummingswant adsassisted living facilityreference to sonny and cherautocidehaagen dazs ice creamfudge (See All) |
Allen Bauer is rescued from drowning as a young boy off Cape Cod by a young mermaid. Years later, he returns to the same location, and once again manages to fall into the sea, and is rescued once more by the mermaid (Allen isn't sure what he has seen and what he has imagined). Using maps from a sunk β¦en ship, the mermaid decides to search for Allen in New York City, sprouting legs when her tail dries. On finding Allen, they fall in love, but she has a secret, which will no longer be a secret if she gets her legs wet. (Read More)
Subgenre: | fish out of water |
Themes: | weddingdrunkennessvoyeurismmilitarysurveillancepanicfalling in love |
Mood: | car chaseaffection |
Locations: | barbeachrestaurantchurchhelicopterboatbathtubwaterelevatorurban settingpolice stationpolice carmuseumsea food |
Characters: | family relationshipsbrother brother relationshipsoldierpolice officerlittle girllittle boyself discoverymermaidpolice arrest |
Story: | music bandimpersonationapplausebartendertearsrescueface slapsingingdancingfemale nudityone word titlebare breastsflashbacksex scenefemale rear nudity β¦chasepantiestelephone callfoodblondewatching tvcamerabare buttvoyeurtelevisionscientistreporterbracandlemapfishdinnerunderwater scenemarriage proposalnecklacetransformationpublic nuditybinocularsu.s. presidentspeechkissing while having sexnewspaper headlinehypodermic needlebuttocksblockbusternaked womantowelfull moondentistboxer shortsaquariumice skatingsexy womanturtletuxedobroken armviolinistt shirthappy endinginvestigatorsecret servicefountainnudesubtitleswalletshipwreckbrooklyn bridgerear nudityfemale genitaliadepartment storehead injurystatue of liberty new york cityrobescuba divingmotorboatpresschick flicklobsterstatue of libertyrevolving doorvillain turns goodwater fountainnew york city new yorkswedishprotestorjugglingwater hoselong blonde hairexaminationbutt nakedcmnfnaked buttwoman's bare buttstruck by lightningpokieslanguage learningclothed male naked femalecmnf scenecinderella storyfish marketbullhornarm castsunken shipbare butt womanpenthouse magazinewater tankracquetballcharacter appears in newspapermedical testsiren the alarmporterlearning englishplacardcape cod massachusettsfood marketskating rinkreference to the new york yankeeslifesaverpeking chinahair covering breastsnovocainereference to the new york knicksfish factoryhypodermic needle attack (See All) |
New York City. Melvin Udall, a cranky, bigoted, obsessive-compulsive writer, finds his life turned upside down when neighboring gay artist Simon is hospitalized and his dog is entrusted to Melvin. In addition, Carol, the only waitress who will tolerate him, must leave work to care for her sick son, β¦making it impossible for Melvin to eat breakfast. (Read More)
Subgenre: | sketch comedy |
Themes: | angerfriendshipjealousytheftdepressionredemptionmental illnesshomophobiaprejudicewritingpolice investigationobsessive compulsive disorderunlikely friendship |
Locations: | hospitalnew york cityrestaurantwheelchairapartmentroad trip |
Characters: | homosexualmother son relationshipmother daughter relationshipafrican americanfrienddoctorpolice officernursewriterartistsingle motherwaitresslittle boypsychiatrist β¦older man younger woman relationshipgrandmother grandson relationshipgay friend (See All) |
Story: | music bandbartenderpaintergay slurtearspaintingsingingdancingfemale nuditynuditymale nuditybare breastsdogkisstitle spoken by character β¦beatingurinationpunched in the facewatching tvcomputerbare buttvomitingneighborpianonew yorkwomandrawingbathritualscarpianistautomobilesingle parentnipples visible through clothingblockbustereccentriccompassionpet dogsuperstitionage differencepublisherasthmasicknessbusiness cardkindnessopposites attractriteposingmale modelolder man younger womanposing nudeanimal in cast creditsbedriddenbigotmisanthropewalking canearm castdog trainingyounger woman older man relationshiplove hatecallboymoral transformationsurgical stitchesreference to george gershwindress codeoddballlap dogreference to henri matisse (See All) |
Rancher Dan Evans heads into Bisbee to clear up issues concerning the sale of his land when he witnesses the closing events of a stagecoach robbery led by famed outlaw Ben Wade. Shortly thereafter, Wade is captured by the law in Bisbee and Evans finds himself one of the escorts who will take Wade to β¦ the 3:10 to Yuma train in Contention for the reward of $200. Evans's effort to take Wade to the station is in part an effort to save his land but also part of an inner battle to determine whether he can be more than just a naive rancher in the eyes of his impetuous and gunslinging son William Evans. The transport to Contention is hazardous and filled with ambushes by Indians, pursuits by Wade's vengeful gang and Wade's own conniving and surreptitious demeanor that makes the ride all the more intense. (Read More)
Subgenre: | action adventureaction movie |
Themes: | murderdeathmoneydrinkingtortureescapeseductionrobberythefthumiliationjusticestarvationdying father |
Mood: | gorerain |
Locations: | campfiretrainhotelcemeteryrooftoptunneltrain stationcave inshootout at a train station |
Characters: | singerhusband wife relationshipfather son relationshipmother son relationshipdoctorboyprostituteteenage boythiefartistaction heroreference to godkillervillainbible β¦sniperchinese american (See All) |
Period: | 19th century1880s |
Story: | frontier townfrontierstagecoachsalooncowboybartenderprisonersinginggunfemale nuditynuditynumber in titlebloodviolencekiss β¦fighttitle spoken by characterexplosionknifechasesurprise endingpistolfirepunctuation in titlesongshootoutbeatingdigit in titleshot to deathblood splatterfistfightfoodhorseshot in the chestremakeshot in the headshotgunpunched in the facedrinkarrestgunfightkissingshootingshowdownrifleplace name in titledead bodypianohandcuffsprayerrevolvershot in the backgangambushmassacreeatingcolon in titletrialdrawinggraveyardgunshothotel roomelectrocutionbased on short storymissiondebttentevil manopening action scenestreet shootoutdeath of brothercrossexploding bodyhorse ridingmurderershot in the armkissing while having sexarsonshoot em upbulletburned alivekilling an animalshot in the stomachcowboy hatbarncaptivecrucifixrailway stationtorchmexican standoffgun fugun battleguardwhiskeyveterandual wieldstabbed in the throatgunshot woundshoveldynamiteoutlawarizonabounty huntercapturehomoeroticismranchgunfiregatling gunshot multiple timesmain character dieshorseback ridingvillain played by lead actorprayingrobberveterinariantime in titlegun held to headbank robberrailwaycattledouble barreled shotgungunslingerknocked unconsciouscowboy bootspartial female nudityunconsciousnesspocket watchgun actioncoughingelectric shockrailroaddying mantrain ridegun violenceaction violenceshot point blankkicked in the headhit with a shovelhold upoutlaw ganglimpfemale bartenderhorse and wagongang leadergunfighterhawkvillain arrestedwinchester rifledroughtleg injuryburning buildingsaying gracerewardposing nudeimplied nudityhorse chasewagonbarmaidchild with a gunmortgagegun shotforkbritish actor playing american charactershoot outfamily conflictwestern townsharpshooterfall to deathgun held to one's headlootrancheru.s. marshalpossecowboys and outlawsgunmanconcealed nudityhomoeroticshared bedsaddlewestern herostampedesketchingbiblical quotefast drawrusemarshalunconsciousgun fightone legged manchild uses a gunhorsebackrailroad stationgun shootingpoor familyapacheclass conflictsmall western townracist remarkgun firenude drawingpartial nuditystabbed with a forkgunplayarizona territorycivil war veteransketch artistgunned downshot repeatedlygang of outlawsapache indianmoral transformationsaloon girlhorseback chasechristian subtextstagecoach robberytrain depotcorrupting influence of capitalismhorse drawn wagonprosthesisshoot to killapache tribeblack hatdead bodiesman urinatingrailway platformgun pointed at headquoting biblereference to san francisco californiaapache territorygun holsterbarn firegun shot victimmining camprailroad constructionthrown from a cliffcattle ranchercough syruphit with a riflepayrollshooting into the airburning barninjured mantrain whistlecattle stampedeconfederate uniformgun beltgun in handguns and bulletspinkertonsranchingstrongboxtravoiskicked in stomachnotorioustrain platformyuma prisondead body in the streetfrontier lifegun held to one's backranch houserancher's sonshooting with two gunsbisbee arizonadodge city kansasshooting victimshot in cold bloodtrampled by a horsewestern movieyuma arizona (See All) |
An anonymous, but deadly man rides into a town torn by war between two factions, the Baxters and the Rojo's. Instead of fleeing or dying, as most other would do, the man schemes to play the two sides off each other, getting rich in the bargain.
Subgenre: | cult filmblack comedychrist allegoryspaghetti westerncult classicrevisionist western |
Themes: | angermurderdeathfriendshiprevengekidnappingmoneybetrayaltortureescapegangsterherodeceptioncorruptionbrutality β¦sadismhome invasiongreed (See All) |
Locations: | barcemeterysmall towndesertvillage |
Characters: | husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guywarriorlittle boyvillainsheriff |
Period: | 19th century |
Story: | stagecoachwild westsaloonwhipcowboybartenderrescueface slapgunbloodviolencebare chested maleexplosionpartyknife β¦pistolfirecryingshootoutbeatingcorpseshot to deathblood splattermachine gunhorseshot in the chestremakeshotgunpunched in the facecatbattlegunfightshowdownrifleheld at gunpointlow budget filminterrogationrevolverriveralcoholcriminalshot in the backsubjective cameragood versus evilgangambushmassacrearmyimpalementstabbed in the chestanti herodisarming someoneone man armycoffinchild in perildouble crosspolice officer killedcigar smokingshot in the legone against manyorganized crimeperson on fireevil manhorse ridingfirst partshot in the armhandgunwhippingcult directorarsonpowercrime bossmachismoeavesdroppinggoldmachetecowboy hatbarnstrangerhonorcompassionmexicandamsel in distresstarget practiceu.s. armypsychotronicpunched in the chestlaughterdynamiteoutlawbooby trapwisecrack humorbulletproof vestknife throwinglonerbody countlaughingabusive husbandgatling gundriftergang warset upstreet gangspit in the facearms dealerquick drawundertakeranimal crueltywelldouble barreled shotgungunslingercowboy bootsbellsawed off shotgunhand over mouthnihilismstreet fightcriminal ganggun duelkindnessnoosefriends who live togetherfamous scoreoutlaw gangsix shooterpsychotronic filmcavalrygang leaderhouse firebarrelman hits a womancasketgrindhouse filmman with no namewinchester rifletear on cheekbullet proof vestgrave diggingpower strugglerepeating riflehorse chasecowboy shirtanimated opening creditsshoot outwestern townhostilityburning housecowboys and outlawsabandoned minegunpowdergang warfareman kills womanballadeermoney in titlechild knocked unconscioushero for hiremaverickarizona territorycovered wagonman murders a womanshooting a womanbullwhipponchosaved from hangingmurder of a womangang that lives togetherfalse informationsuspended by armsgun for hiregun holstermexican armyfake drunkennesscrawling on the groundman shoots a womannew mexico territoryarizona desertbell tollingriding at a gallopbellringereye swollen shutfording a riverfour against oneu.s. mexican borderpretending to be drunk (See All) |
After an outlaw unknowingly leads a band of cannibalistic Troglodytes into the peaceful western town of Bright Hope, the monsters kidnap several settlers, including the wife of a local rancher. Despite his injured leg the rancher joins a small rescue party with the sheriff, his aging deputy and a st β¦rong-willed gunslinger. What follows is a journey into hell on earth as the posse comes to realize it is up against a foe whose savagery knows no bounds. The film takes place at the turn of the century around the border of what is now Texas and New Mexico. (Read More)
Themes: | murderdeathkidnappingprisonescaperacismabductioncannibalismwilderness |
Mood: | gore |
Locations: | campfirebar |
Characters: | native americanhusband wife relationshipwarriorsheriffpregnant womanpregnant |
Story: | saloonbartenderprisonerrescuegunfemale nuditybloodmale nudityviolencemale frontal nuditymale rear nuditybare chested malesex sceneshot to deathletter β¦riflejailsurvivalambushshot in the leggunshotflash forwardsurgerycagejail cellbroken legdead mantribemustachelanternarrowimprisonmenthorseback ridingpiano playerdrifterscene before opening creditsshot with an arrowwhistleflaskpocket watchdeputyheld captivecowgirl sex positionopiumthroat cutposseconcealed nudityhuman skullscalpingdeputy sherifftorn in halftomahawkrusewoundedfalling down a hillspyglassquadriplegiccivil war veteranpunch in the faceblindedhowldragged along the groundplaying checkersman using crutchesreload guntroglodyteindian scoutleg splintwheezinglever action rifle (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
Subgenre: | live action and animation |
Themes: | angerdeathfeardancemagicmilitarypanic |
Locations: | beachmotorcyclesmall townlondon englandbicyclevillageenglandcastlejunglemuseumtrain stationsubmarine |
Characters: | dancersingerchildrenbrother brother relationshipboysoldiermusicianpriestlittle girllittle boywitchgermanhuman animal relationship |
Period: | world war two1940syear 1940 |
Story: | chorineplaying cardsmusic bandposterballbow and arrowapplausesingingdancingfightexplosionknifepistolfirecrying β¦based on booksongmachine gunmirrorpunched in the facebattleswordletterbookriflebombrunningbedbritishislandcompetitioncombatorphansoccerflashlightcandleold manfishchilddream sequencefishingkingcigar smokingnecklacetransformationgunshotlibrarybinocularsuniformfantasy sequencetentrabbitscreampianistpursuitcountrysideunderwaterbearmonkeyropewaitercaptainentertainmentgrenadeathleteflyingspearperformancelifting someone into the airrageelephantmagiciancaptivemousetoyenemywitchcraftfraudaudiencepart animationparadecolonelfull moonanthropomorphismshieldexplosiveinvasionanthropomorphic animalevacuationdrummercon artistlaughterlionarmorcliffraidsailortrophypigeoncrowdrefereeimprisonmentspellauntmagic tricknotebookchoreographystreet marketbicyclingperformergorillatween girlwhistlecrowndrummedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiometamorphosisunsubtitled foreign languagepotionpalm treealligatortrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentkangarooapprenticeliquidpet catanimal that acts humangiraffelockballroomvulturehookmarchstreet vendorbroomretreatscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerleopardlongingostrichvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelinehyenaincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingroarcalypsogoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All) |
Aviator Andre Jurieux has just completed a record-setting flight, but when he is greeted by an admiring crowd, all he can say to them is how miserable he is that the woman he loves did not come to meet him. He is in love with Christine, the wife of aristocrat Robert de la Cheyniest. Robert himself i β¦s involved in an affair with Genevieve de Marras, but he is trying to break it off. Meanwhile, Andre seeks help from his old friend Octave, who gets Andre an invitation to the country home where Robert and Christine are hosting a large hunting party. As the guests arrive for the party, their cordial greetings hide their real feelings, along with their secrets - and even some of the servants are involved in tangled relationships. (Read More)
Subgenre: | comedy of manners |
Themes: | theatremurderdeathlovefriendshipmarriageinfidelitymoneyjealousyadulterydrinkingfeardrunkennessheromemory β¦extramarital affairdivorcetheftdepressionhopewealthcouragehunting (See All) |
Mood: | rain |
Locations: | trainairplaneparis franceairportwoodskitchenwheelchaircastle |
Characters: | love triangledancersingerhusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipfrienddoctorpolicemanthiefmaidjewgrandfather grandson relationship β¦aunt niece relationshipchildhood friendtruck driverhunting party (See All) |
Story: | stage showtheatre audienceapplausemistaken identityface slapsingingdancinggundogkissfightcigarette smokingpartychasepistol β¦telephone callsongfistfightfoodcar accidentmirrorpunched in the facedrinksecretshootinglieriflepianovoyeurnewspapercookingwinedisguisemansionbridgeaccidentdinnerapologyradiogunshotduelparkpilotcostumefired from the jobwidowerliarfactoryumbrelladollrabbitflowerspianistpursuitcountrysidegovernmentgeneralpoetsacrificeclass differencestrusthateteaentertainmentbulletkilling an animalfarceinjuryfaintinghappinesscookhunterservantfateembarrassmentcelebrationtarget practicetelescopesufferingattempted suicidecynicismmourningintriguebackstagecigarette lighterbutlercard playingbilliardslipstickshadowduckgunfirereckless drivingflightholding handsaristocratgeniushairdresserspittingdead animaladvertisementestateautographsquirrelradio stationhuntfencinggramophonegreenhouselistening to radiohostdisappointmentchandelierupper classactual animal killednoosetrumpetcapeperfumecowardromantic rivalrybourgeoisieweekendmartyrmusic boxdecadencegame playingsleeplessnesshorse and wagoninvitationdeath by gunshotheadacheping pongspotlighthigh societysurrogate fatherheterosexualitycard trickpoachersleeping pillmemoircannescigarette holdercountessbarontraffic lightcountry estatetable tenniswaltzhostessgoodbyechambermaidbatonchateaufake beardmasqueraderomanticismskeleton costumeanimal trapmusic conductorsearchlightcloakpetty criminalradio broadcastingamateur actoramateur actressaviatorclass conflictrulesbear costumedead rabbitpre world war twocigarette caseamateur theaterradio announcerupstairs downstairsreference to victor hugoarthritisgamekeeperanti semitic slurmarquisshoeshinepheasanttrumpetercurtain callmanservantparisianhound dogrich couplesnarebridge the card gamereference to charles lindberghtransatlantic flightdeep focusreference to buffalo billgame wardengypsy costumelarkdrawing roommechanical toystray bullet (See All) |
The Burlesque Lounge has its best days behind it. Tess, a retired dancer and owner of the venue, struggles to keep the aging theater alive, facing all kinds of financial and artistic challenges. With the Lounge's troupe members becoming increasingly distracted by personal problems and a threat comin β¦g from a wealthy businessman's quest to buy the spot from Tess, the good fortune seems to have abandoned the club altogether. Meanwhile, the life of Ali, a small-town girl from Iowa, is about to change dramatically. Hired by Tess as a waitress at the Lounge, Ali escapes a hollow past and quickly falls in love with the art of burlesque. Backed by newfound friends amongst the theater's crew, she manages to fulfill her dreams of being on stage herself. Things take a dramatic turn though when Ali's big voice makes her become the main attraction of the revue. (Read More)
Themes: | theatreloveart |
Mood: | rain |
Locations: | small townlos angeles californianightclubtowntwo on a motorcycle |
Characters: | love triangledancerfemale protagonistgirlmusicianwaitressin love |
Story: | stagebartendersingingdancingf ratedmale nudityone word titlebare chested maletitle spoken by characterpartysongbare buttcleavagewoman β¦roommatepantyhosetheaterauditionthreatpremarital sexjazzquestaginghollywood californiaclubbarefootbackstagerivalsexy womansoulattractiontank topmale objectificationreal estate agentblonde womanlegsperformercabarettransvestismburlesqueentertainerhomosexual subtextiowabluesapplying makeupvaudevilleblowing out candlelooking for a jobperseverancerainy dayrhythm and bluesmorning sicknesssunset stripsmall town girlburlesque dancerwant adregular customerfan dancerriding buscarrying a womanfinancial troublesexy legshiding moneycomposing musicbuyoutjagermeisterinfinity pool (See All) |
Mitch is a middle aged big-city radio ads salesman. He and his friends Ed and Phil are having mid-life crisis. They decide the best birthday gift is to go on a two week holiday in the wild west driving cattle from New Mexico to Colorado. There they meet cowboy Curly who not only teaches them how to β¦become real cowboys, but also one or two other things about life in the open air of the west. (Read More)
Themes: | adulterydrunkennessfuneral |
Mood: | rain |
Locations: | campfireschoolairportrural settingbaseballspainschool teachernew mexicocable car |
Characters: | husband wife relationshipfather son relationshipfather daughter relationshipdoctorbest friendlittle boy |
Period: | 1990s |
Story: | six gunlassowild westmusic bandcowboydancingnuditytitle spoken by characterknifeunderwearfistfightcameraheld at gunpointbirthdayclassroom β¦new yorkchildradiobirthday partygravetentlightningfireworksfriendship between mentape recorderbuttocksblockbusterbirthfestivalburialcelebrationguestknife throwingranchmidlife crisiscattleharmonicaradio stationcoloradobullaudio cassettehorse and wagonreference to john waynemovie cameraairlinerreference to pablo picassostampederiver rapidsspursriver crossingcovered wagoncorralcalfreference to ingmar bergmancattle drivereference to montgomery cliftrunning of the bullsreference to gene kellychapsreference to mickey mantlereference to willie maystoropamplona spainthe one that got awaybirth of calfreference to yogi berra (See All) |
Josey Wales makes his way west after the Civil War, determined to live a useful and helpful life. He joins up with a group of settlers who need the protection that a man as tough and experienced as he is can provide. Unfortunately, the past has a way of catching up with you, and Josey is a wanted ma β¦n. (Read More)
Subgenre: | cult filmrevisionist western |
Themes: | murderrevengerapebetrayalheromilitarysadismdeath of wifevengeancemurder of familyghost town |
Mood: | moving |
Locations: | barsmall towndesertrural settingfarmtexasbar shootout |
Characters: | native americansoldierphotographerhostagesniper riflemilitary officer |
Period: | 19th century1860s |
Story: | frontier townsalooncowboyprisoneraxesingingdancingcharacter name in titlefemale nuditybased on novelviolenceflashbackdogsex scenekiss β¦surprise endingpistolfireshootoutcorpsemachine gunhorsebattleswordgunfightshowdownheld at gunpointpianoprayerrevolverrivershot in the backambushmassacrestabbingdeath of friendarmyanti heroold womanduelgraveprologuefugitiveopening action sceneattempted rapefarmerstreet shootoutdirected by stardeath of sonhorse ridingtrapmercenaryhandgunkissing while having sexarsoncaptiveloss of wifebuttocksburialgun battleindianwhiskeyu.s. armydual wieldloss of songunshot woundsenatoroutlawarizonawisecrack humorsalesmanbounty hunterrainstormslaughtersiegedead boytragic heroinjusticeferrywar crimegatling gunbanditspittinganti waraccordioncattlegunslingertavernscorpionamerican civil warmusketreference to abraham lincolnkansassix shootersurrenderhymnmain character shotcavalrygunfightercamera focus on female buttlootingrewardflintlock riflehorse chasedeath by hangingbanjomissourioathmoral ambiguitywestern towngeneral storeintercoursetarget shootingwestern herogracefast drawfolk songchieffiddlertexas rangerencampmentconfederatenavajoreal life father and son playing father and soncottonindianssabrecivil war veteranwoman beatertrucepledgeconfederacynavajo indianconfederate soldierblood oathchewing tobaccofrontier justicesquawlong range rifletrading postcomancheunion soldiermortal woundpillagingplowingcroneriver raftcomanche indianbattle hymn of the republicdockyardraiderssnake oil (See All) |
GRAND BUDAPEST HOTEL recounts the adventures of Gustave H, a legendary concierge at a famous European hotel between the wars, and Zero Moustafa, the lobby boy who becomes his most trusted friend. The story involves the theft and recovery of a priceless Renaissance painting and the battle for an enor β¦mous family fortune -- all against the back-drop of a suddenly and dramatically changing Continent. (Read More)
Subgenre: | black comedyconspiracyabsurdismmadcap comedy |
Themes: | weddingmurderdeathfriendshipmarriagemoneyjealousyprisonescaperacismtheftpsychopathhumiliationpoetrygreed β¦wealthinheritanceprison escapeescape from prisonmurder of sister (See All) |
Locations: | trainchurchswimming poolhotelsnowmotorcyclecemeterybathtubbusbicycletaxielevatorcourtroomrooftopgas station β¦museumsewercable cartwo on a motorcyclehotel kitchen (See All) |
Characters: | policemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshiptattooboybrother sister relationshipsoldierpolice officerpolicemanwriterlawyersister sister relationshipthief β¦artistlittle boymaidfrenchgermanolder woman younger man relationshippolice arrestbaker (See All) |
Period: | 1980s1960s1930swinteryear 1968year 1985 |
Story: | wedding gownbridepainterprisoneraxegay slurtearspaintingface slapsinginggunsexfemale nuditybloodmale nudity β¦violenceinterviewflashbackdogbare chested malekisscigarette smokingphotographtitle spoken by characterknifechasepistoltelephone callcryingshootoutcorpsefoodpunched in the facecatarrestgunfightsecretletterbookrifleplace name in titlerunningbirthdaydead bodyreference to jesus christtelephonef wordsubjective cameradecapitationbisexualfoot chasenewspaperorphanflashlightwinecandleold manstrangulationmountainstabbingmontageeatingarmywidowstabbed to deathimmigrantnonlinear timelinejudgesevered headnuntrialno opening creditscoffindrawingfictional warbathvoice overold womanmarriage proposallooking at the cameratalking to the cameragunshotflash forwardconfessiontheatergraveauthorhotel roombinocularsuniformpay phonechampagnefugitivepoisonstatuepursuitgiftwitnessratcinemahandgunrefugeetypewriternewspaper headlineeuropehatehenchmanflirtingeyeglassespoemwaiterfarcelawtreasurehidingwatching a movienosebleedphone boothservantaudienceladderpart animationfollowing someonemonkguardbloody noseattorneytelescopesevered fingerguestanimated sequencetitle appears in writingblack and white scenebutlerrosedeath of sisterblack eyefascismconvictskiingcliffsnowinglanternsirenpajamaspipe smokingimprisonmentman cryingbeing followednarrated by charactersaving a lifepresentbarking doghandshakemonasterypost warspiral staircaselast will and testamentsubtitlesalarmpolice chiefmotorbikeconfessionalsecret societytombstoneborder crossinghideoutjuryflaskold ladyfall from heightcookiebunk bedcripplesense of smellcheesedocumentheirperfumevanitycowardprison breakcodetelegraminmatereading a newspaperfacial scarspaplancarouseldead catblack catfiring squadmonumenteastern europefirst person narrationmemorialalpstoy gunhappy birthday to youtrapdoormerry go roundflashback within a flashbackstaffcaskettear on cheekmentor protege relationshiptennis courtcentral europeluggagemultiple time framesbirthmarkfictional countrysledfingerreading a lettersuit of armortrolleyhooded figureoathstreetcarturbanhaypassenger trainvisawillalibiart theftskiersnitchobservatoryhotel lobbyborder guardmotorcycle ridingcologneluxury hotelpenis slurstabbedon the lamspeakerconciergeinternment campswitchhit with a rifle buttbullhornpoisonedpastrywall safebellhopabbeyexhibitbondthree sistersconfession boothhotel ownerdeath squadspeaking to audienceyear 1932depositionscentstolen paintingcatacombsrope ladderknocking on doorpantrytrap doordumbwaiterelevator operatorpastry chefdelivery truckpushed off a cliffsleddingpastry shopski jumpkissing a dead bodyshoeshine boywicker basketpersian catpompositybobsledlaundry chuteloaf of breadstrychninebunkclubfoothanging from a ledgepolice whistletalking to a corpsesommelier84 year oldcoat checklying in statevaluable paintingchapter titlespastry boxreference to egon schiele (See All) |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β¦hanted. (Read More)
Subgenre: | coming of agetragedyfairy taleslapstick comedyfish out of waterdisneydark fantasybased on fairy tale |
Themes: | loverevengesurrealismkidnappingjealousyfearescapedancemonsterdeceptionmagicobsessionsupernatural powerdeath of motherblackmail β¦redemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All) |
Mood: | poetic justice |
Locations: | barforestsnowparis francebathtubvillagewoodsfrancelakecastlerooftop |
Characters: | love trianglefemale protagonistsingerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipbabyhostageartistlittle boymaidwitchgrandmother grandson relationship β¦single fatherex soldier (See All) |
Story: | ballfireplacecabinbartenderpaintingrescuesingingdancingcharacter name in titleflashbackdogbare chested malekissfightphotograph β¦title spoken by characterexplosionpartychasesurprise endingpistolfirevoice over narrationbeatingcorpsehorsemirrorshot in the chestremakeslow motion scenepunched in the facebattleswordkissingbrawlfalling from heightshowdownrifleheld at gunpointbedpianoshot in the backbedroomcandlesword fightmountaindisguisewomanmontagebridgefour word titlemapfalse accusationno opening creditsbirddrawingcontroversykingcreaturetransformationflash forwardattempted murderlibrarycursedangerprologuewidowerrace against timeknocked outlightningmanipulationwigtied upgardenloss of motherlove interestreference to william shakespearequeenprincesingle parentchesswerewolficeropefalling down stairswolfdressheroineheavy raintalking animalhunterloss of wifeblockbustereccentriccomposerservantjumping from heightculture clashstrong female leadcgitorchcompassionanimal attackclockfull moonanthropomorphismfight to the deathinventorfalling to deathescape attemptensemble castbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monsterspiral staircasemarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillfamous scoremusketclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstudio logo segues into filmstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All) |
During the reign of the Tang dynasty in China, a secret organization called "The House of the Flying Daggers" rises and opposes the government. A police officer called Leo sends officer Jin to investigate a young dancer named Mei, claiming that she has ties to the "Flying Daggers". Leo arrests Mei, β¦only to have Jin breaking her free in a plot to gain her trust and lead the police to the new leader of the secret organization. But things are far more complicated than they seem... (Read More)
Subgenre: | martial artstragedywuxia |
Themes: | murderdeathrevengemarriagerapebetrayaljealousyprisondrinkingtorturedrunkennessescapeheroseductioncorruption β¦death of fatherpovertyblindnesswealth (See All) |
Locations: | campfireforestsnowwatervillagewoodschinabrothel |
Characters: | love triangledancersingerhusband wife relationshippolicesoldierpolice officermusicianwarriorlust |
Story: | bow and arrowprisonertearsrescuesingingdancingsexnuditynumber in titlebloodviolencekissfightchasesurprise ending β¦firecryingsonghorseslow motion scenedrinkbattleswordarrestsecretshowdownhand to hand combatcombatspyassassinsword fightambushthroat slittingarmyhouseassassinationdouble crossdueltreestabbed in the backfugitivecharacter's point of view camera shotpassionflowerspursuitgovernmenthorse ridingtied upgeneralmagical realismtruststylized violenceflirtingcaptainflyingspearwoundmachetecaptiverebelrebellionfollowing someonehonoraction heroineshieldtrappedwindbraverykatana swordstabbed in the throatbathingbooby trapsword duelsecret identitydaggerswordsmanemperordrumdeputyautumnsword fightingstar crossed loversromantic rivalrytragic lovedoublecrossbrothel madamimperialismblind girljail breakshowgirlwire fumatchmakerdutyswordplaybamboowuxia fictionswordswomanancient chinapatrolcaptive womanfalling treerebel armytug of warvisually impaired persongreen dressyoung loverstang dynastypavillion9th centurycorrupt governmentwoman with long hairfalling horse (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ β¦le'. (Read More)
Subgenre: | martial artsblack comedyabsurdismspy spooflow comedyspy comedy |
Themes: | weddingmurderdeathfriendshiprevengekidnappingdrugsbetrayalfeartorturedrunkennessescapedancedeceptionseduction β¦brutalityterrorismparanoiadrug usesurveillancepaniccannibalismamnesiaself sacrificetechnologynear death experience (See All) |
Mood: | goresatireraincar chasejames bond spoof |
Locations: | barhospitalnew york cityforestcarhelicoptersnowairplanelondon englandwatertaxiwoodsapartmentpolice caritaly β¦englandjungletaxi driverlaboratorysewercable car (See All) |
Characters: | singerhusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshiptattoosoldierhostagelawyertough guywarrioraction herosecurity guardamerican abroad β¦older woman younger man relationshipex boyfriend ex girlfriend relationshipex soldieramerican in the uk (See All) |
Period: | 2010s |
Story: | lassosaloonwhipfireplacecabincowboybartenderaxepaintingrescuesingingdancinggunbloodviolence β¦sequelflashbackdogbare chested malefightcigarette smokingphotographtitle spoken by characterexplosionknifechasesurprise endingpistolcell phoneshootoutbeatingshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshot in the headshotgunslow motion scenepunched in the facewatching tvcomputercondombattlearrestgunfightbrawlbased on comicshowdownrifleheld at gunpointhand to hand combatsunglassesbombsecond partbedcar crashinterrogationrobotpianohallucinationhandcuffsbritishrevolveralcoholfightingshot in the backf wordsubjective cameragood versus evilspybraassassinbased on comic bookambushstrangulationmountainambulancemansiondeath of frienddrug dealermontageimpalementfour word titlemixed martial artsdinertoilettied to a chairmapdinnerexploding carfalse accusationman with glassesno opening creditsanti herodisarming someonedouble crossunderwater scenekingfemme fatalenews reportprincessmarriage proposalshot in the foreheadlatex glovesattempted murderone against manydrug addictorganized crimecharacter repeating someone else's dialoguebeaten to deathdangerelectrocutionpay phoneumbrellacharacter's point of view camera shotmissionundercoverproduct placementrace against timesuitcasestatuetentknocked outkicked in the facebaseball batu.s. presidentopening action scenestreet shootoutshot in the shouldermanipulationscaramerican flagbodyguardinjectiontragic eventexploding bodylaptopneck breakingcharacter says i love youthreatened with a knifemercenarysemiautomatic pistolsevered armprofanitygeneralhandgunsecret agentobscene finger gestureespionagequeensubtitled sceneheroinbattlefieldwashington d.c.stylized violencehenchmanmaniaceyeglasseseavesdroppingmissiletraitorgoldshavinghand grenadesabotagedestructionbullethead buttassassination attemptwarehousehypodermic needlelooking at oneself in a mirrordrugwoman with glassessociopathdiseaseviruscowboy hatloss of friendsecurity camerawalkie talkieexploding buildingkicked in the stomachcaucasianmovie theatervillainesseccentricwristwatchphone boothsevered handculture clashdriving a carrocket launcherwhite housegun fuinterracial friendshipcrushed to deathsocial commentaryback from the deadbar fightandroidmexicanpresumed deaddrug overdosethugredneckwhiskeybra and pantiesreverse footageshieldcameofloodexplosivefight to the deathdual wieldmercilessnesspool tableresurrectionshot in the facejunkiecigarette lightermarvel comicspunched in the chestsafebutterflyassault rifleinfectionaccidental killingaerial shotknife fightparachutewisecrack humorhologramundercover agentbody landing on a carraised middle fingersiegemustachered pantieseye patchbowlingbroken armstadiumpuppytourgadgetterrorist plotburned to deathgunfirecrude humorswearingdrug lordmoral dilemmagatling gungrenade launchermedia coveragesouthern accenttorso cut in halftracking devicememory lossenglishman abroadtext messagingdesert eaglebazookareference to elvis presleygay manfinal showdownreturning character killed offbongparalysisstuffed animalreference to facebookabuse of powerarmored carsuit and tiecomputer crackerworld dominationdroneamputeemegalomaniacyoung version of characterfemale spyunited kingdomcowboy bootscambodiaanarchycomputer hackerfighter jetbowling alleystrong languagebaseball caphamburgerstatue of liberty new york citycrashing through a windowmeat cleaversaving the worldtour guidefight the systemfinal battletop secretteamworkfilmed killingtwo way mirrorhigh techreference to twittermusic festivalsuperhuman strengthcurerogue agentcar radioexploding housetragic pastspy heroman wearing glassessix shootercut into piecesdrug cartelcamera phonealpsred brafemale bartendertailorimprovised weaponshot through a doorvice presidentbarrelanimal killingbreaking a bottle over someone's headknocked out with a gun buttarmorywiretappingbilingualismsurveillance footagechrysler building manhattan new york citythrown from a carepic battlemartiniscottish accentlandminecryogenicsswedishkentuckyloss of memoryslow motion action sceneantidotegadgetrysexual innuendodetonatorhit with a chairdouble entendrecowboy shirtsecret organizationbrandinggadget carbig ben londonbritish actor playing american characterzero gravityone eyed manshot through a wallbroken handmanor houseprosthetic limbblond hairflash drivenanotechnologycaged humanthrown through a windshieldbowling ballbroken windshieldeye injuryover the topsecret laboratorycar stuntcratervintage carsex joketwo against onegolden gunreference to instagramspectaclescirclecut in halfsinkholeukmeat grindersalonlost citymountain cabinpugsecret headquartersfemale sociopathamnesiachit with a fire extinguisherspray canrobot dogtooth knocked outhousing estatepiccadilly circus londoncriminal organizationsecret hideoutamphibious vehicleends with weddingexploding eyeknife in shoewhiskyblow darticon comicssmashed car windshieldimpeachmentretrograde amnesiabreaking a car windshieldarmorerdrug userminesweepermetal handpirate broadcasttailor shopweapons cabinetglastonburymetal armreference to john denverreference to tinderrobotic armteam workthrown through windshieldgoing through windshield (See All) |
The setting is Camp Firewood, the year 1981. It's the last day before everyone goes back to the real world, but there's still a summer's worth of unfinished business to resolve. At the center of the action is camp director Beth, who struggles to keep order while she falls in love with the local astr β¦ophysics professor. He is busy trying to save the camp from a deadly piece of NASA's Skylab which is hurtling toward earth. All that, plus: a dangerous waterfall rescue, love triangles, misfits, cool kids, and talking vegetable cans. The questions will all be resolved, of course, at the big talent show at the end of the day. (Read More)
Subgenre: | cult filmalternative comedybased on sketch comedy |
Themes: | friendshipdrinkingvoyeurismrobberytheftdrug usefalling in lovedrug addiction |
Mood: | satirespoof |
Locations: | campfiremotorcycleboatkitchenitalyouter space |
Characters: | love triangledancersingerhomosexualteenagerfriendboyfriend girlfriend relationshipboyteenage girlteenage boyteachergirlgay sexlawyerthief β¦jewishgay kisscomedianjewex husband ex wife relationshipfrench kissgay wedding (See All) |
Period: | 1980syear 1981 |
Story: | applausecabingay slurrescueface slapsingingdancingsexmasturbationbare chested malekissfightcigarette smoking β¦lesbian kisschaseshowertelephone callcryingsongunderwearcar accidentmirrorblondeslow motion scenecomputerdrinkbikinibeersunglassesmarijuanabathroomcollegepianovoyeurguitarrivertelephoneswimmingcleavagebradrug dealermontagecocaineman with glassesscantily clad femalechild in perilvandrowninglibrarydrug addictvirginactor playing multiple rolesmassagerabbitamerican flaginjectionchickenwaterfallobscene finger gestureheroincloseted homosexualnerdracenipples visible through clothinghelmetsexual attractionbarncookvietnam warflatulenceswimsuitcrushvirginitygoatdinosaurdrug overdosetelescopestarhippiepunched in the stomachone dayrefrigeratorbarbecuelonermale male kisstrophymeetingdivorceebonfirewilhelm screamsurprise after end creditstracking devicefemale female kissdormitoryneedlecafeteriasummer campflutejournalhikingpiano playingcomedy troupeguitar playingloserraftmaking outteasingelectric guitarmotorboatcollege professorchewing gumshirtmarriage engagementcrotch grabtalent showlifeguardlunchmainedicebaseball teamcometvietnam war veteranradio djbroomtitle appears in songphysicistshort shortssolar systemwater skiinghand on crotchdining hallinfirmarylubricantdungeons and dragonsshrimpcamp counselormarshmallowlesbian slurbeekeeperreference to nasabanana peelhit with a doorgroup hugwhite water raftingarts and craftsastrophysicsastrophysiciststallioncapture the flagcrack housemusical stage productionchild drowningback rubcatskillscrabsswitching clothesslow clappeeling potatoesdouche bagreference to david ben guriontubesocksskylabcatskill mountainslighting a fartoxymoronspace debrisleague of nationscar crashes into a tree (See All) |