Best popular movies like Captains Courageous:

Do you need specific genre & keyword selection to find films similar to Captains Courageous?
<< FIND THEM HERE! >>

Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Captains Courageous (1937)

Harvey Cheyne is a spoiled brat used to having his own way. When a prank goes wrong onboard an ocean liner Harvey ends up overboard and nearly drowns. Fortunately he's picked up by a fishing boat just heading out for the season. He tries to bribe the crew into returning early to collect a reward but β€¦ none of them believe him. Stranded on the boat he must adapt to the ways of the fishermen and learn more about the real world. (Read More)

Subgenre:
coming of age
Themes:
friendship
Locations:
fishing boatboat accidentsea rescue
Characters:
suicide by drowningfishermanboyfather son relationship
Story:
rich boysea adventuredeath with dignityportuguese americanfatherhood testship's cookshort pantsfish hookoverboardschoonerice cream parlorexpelled from schoollost at seasea captainseasickness β€¦spoiled childgluttonychild actorspoiled bratdying wordsorchestral music scoresailingdvdfather figurefishingaccidentface slapbased on novel (See All)

The Perfect Storm (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Perfect Storm (2000)

In October 1991, a confluence of weather conditions combined to form a killer storm in the North Atlantic. Caught in the storm was the sword-fishing boat Andrea Gail. Magnificent foreshadowing and anticipation fill this true-life drama while minute details of the fishing boats, their gear and the we β€¦ather are juxtaposed with the sea adventure. (Read More)

Subgenre:
tragedymelodrama
Themes:
deathmoneydrinkingdrunkennessfuneraldivorce
Mood:
tearjerker
Locations:
fishing boatbarhelicopterairplaneseashipstormyachtnew englandstorm at searescue boat
Characters:
fishermanfather son relationshipmother son relationship
Period:
1990s
Story:
sea adventuresailingfishingbased on novelsexcigarette smokingtitle spoken by characterthree word titlebased on true storycorpserescuewatching tvdrinksurvivalfish β€¦underwater scenelightningtragic eventmachismodisastericetv newscaptainworking classblockbusterlosssharktensionboston massachusettsthunderstormmarital separationdivorceemedia coveragelighthousehurricanenatural disasterportugalracial stereotypepool hallu.s. air forcechurch servicecity hallfat womanmarinaatlantic oceanmale camaraderiecamaraderiejamaicancoast guardbaittidal wavecoastal towncargo shipmeteorologistgroceriesship sinkingweather reportpick up lineu.s. coast guardman overboardswordfishman versus naturebermudaaerial refuelingtetanus shotrefuelingtempestseastorm (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Jaws (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jaws (1975)

It's a hot summer on Amity Island, a small community whose main business is its beaches. When new Sheriff Martin Brody discovers the remains of a shark attack victim, his first inclination is to close the beaches to swimmers. This doesn't sit well with Mayor Larry Vaughn and several of the local bus β€¦inessmen. Brody backs down to his regret as that weekend a young boy is killed by the predator. The dead boy's mother puts out a bounty on the shark and Amity is soon swamped with amateur hunters and fisherman hoping to cash in on the reward. A local fisherman with much experience hunting sharks, Quint, offers to hunt down the creature for a hefty fee. Soon Quint, Brody and Matt Hooper from the Oceanographic Institute are at sea hunting the Great White shark. As Brody succinctly surmises after their first encounter with the creature, they're going to need a bigger boat. (Read More)

Subgenre:
cult filmsuspensecreature featurecult classic
Themes:
deathmarriagefearmonstergreedpanicfear of water
Mood:
gore
Locations:
fishing boatboat accidenthospitalbeachhelicoptersmall townboatwaterseashipocean
Characters:
fishermanboyfather son relationshiphusband wife relationshipmother son relationshiptattoopolicemanlittle boymayor
Period:
1970s
Story:
orchestral music scorefishingface slapbased on novelfemale nuditybloodviolenceone word titledogfemale rear nuditynipplesexplosionsingingsurprise endingfire β€¦based on bookslow motion sceneshowdownriflemarijuanaislandsubjective cameraswimmingnew yorksevered headman with glasseschild in perilunderwater sceneskinny dippingdangerfirst of seriescharacter's point of view camera shotprankscarfirst partunderwatercult directorclass differencesgraffitilifting someone into the airmale bondingcaucasianblockbusterpart of trilogysharkanimal attackeaten aliveloss of sonautopsysevered legcharacters killed one by onefinal showdownkilling a dogpolice chiefsailboatraftbillboardresponsibilityscuba divingshockfamous scorefourth of julywoman slaps a mantelevision reporterbarrelnude bathinganimal killingfamous lineshark attackworld war two veteranmarinascreenplay adapted by authorferry boatship wreckreference to jack the ripperimitationnight swimmingkiller sharkauthor cameotrailer narrated by percy rodriguezoxygen tankcoastal townlicense plategreat white sharkrepairship sinkingdolly zoomfamous opening themefemale slaps maletown meetingswimchild eatensolitairenorth atlanticcontemporary settinglimerickmartha's vineyardshark featureman versus naturehuman versus sharkhigh conceptvertigo shotinflatable raftpredatorial horrorscientist heroday for nightchild killed by an animalfingernails on chalkboardgiant sharkchumshark cagewoman killed by a sharkeaten by shark (See All)

Serenity (2019)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Serenity (2019)

A lone fisherman, Baker Dill, who escaped from his past to a remote island, meets with his ex-girlfriend Karen. She asks Dill to kill her cruel husband, who also comes to the island. The swirling neonoire against the backdrop of exotic landscapes "Serenity" was shot by British director and screenwri β€¦ter Stephen Knight. The captain of a fishing vessel, Baker Dill, spends his days, indistinguishable from each other, on a tropical island, earns money from wealthy tourists and sees the purpose of his life in catching one particular tuna called Justice. (Read More)

Subgenre:
allegorypsychological dramarevenge plotpsychological
Themes:
murdergangsterobsessionabusechildhood trauma
Mood:
ambiguous endingmurder plot
Locations:
fishing boatboatblood in watersex on a boat
Characters:
fishermanfather son relationshipex husband ex wife relationshipbakermurder for hirereligious statue
Story:
fishingbloodmale nudityone word titlemale rear nuditysex scenetitle spoken by characterbeatingcatwritten by directorbare buttislandf wordchild abusenews report β€¦skinny dippingdomestic violenceunderwatercaptainfloridairaq warplot twistexistentialismabusive husbandsymbolismmoral dilemmanude swimmingviolence against womenreference to facebookdead fatherseagullhusbandgigoloplaying a video gamemale protagonistdomestic abusemale prostitutionjumping into waterblack cattropical islandsimulation gameptsdabusive relationshipwish fulfillmentbroken handnudismantiheroman undressingabusive stepfatherrummetagreat white sharkcontract killingboy geniusfantasy versus realityman overboardabused wifecliff divinggetting drunkopen worldreligious mantaking the law into one's own handsiraq war veteranopening creditsfinancial troublereligious overtones (See All)

Nim's Island (2008) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Nim's Island (2008)

Nim Rusoe is a girl who joins her father, a scientist, when he does research on marine life on an island. It's just the two of them but she spends her time making friends with all the animals she encounters, chatting on the computer and reading the adventure books of Alex Rover. When her father goes β€¦ to do some research but when a storm strikes the island he doesn't come back, she gets worried and frightened. She then e-mails Alex Rover hoping that he will come but what she doesn't know is that Alex Rover is a woman who is agoraphobic and germaphobic. But her creation comes to life and eggs her to go. Unfortunately she has never gone anywhere before and is denied her necessities like her sanitary gel by the customs officer at the airport. In the meantime, Nim tries to be strong while waiting for Alex to arrive. (Read More)

Subgenre:
coming of ageabsurdismslapstick comedyfish out of water
Themes:
surrealismfearescapeheromemorytravelparanoiapaniccouragenear death experienceobsessive compulsive disorder
Mood:
rainnightmare
Locations:
boat accidentbeachforesthelicopterairplaneboatbathtubdesertwatertaxiairportwoodsseashiprooftop β€¦oceanjungletaxi drivercampfirestormsan francisco californiastorm at sea (See All)
Characters:
boyfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipgirldancerwritersecurity guardaustralianamerican abroadsingle fatherhuman animal relationship β€¦ship captain (See All)
Story:
overboardlost at seasailingfishingbased on novelf ratedcharacter name in titleflashbackfightdancingphotographchasesurprise endingtelephone callfire β€¦voice over narrationcryingcell phonefoodrescueslow motion scenecomputercamerafalling from heightletterbookvomitingtearsbedhallucinationislandtelephonescientistsubjective cameraswimmingsurvivalsoccerflashlightcookingmountainvideo cameramontageeatinginternetmapfishradiochild in perilbathunderwater scenetreeauthordangerelectrocutionfantasy sequencecharacter's point of view camera shotactor playing multiple rolesproduct placementstorytellingrace against timesuitcasemissing personreadinglightningisolationloss of mothersingle parentpirateanswering machinefarceheavy raineggmachetequesttouristsurvivorlifting someone into the aircaptivespiderflatulencesharkhome movietorchpresumed deadfull moonpassportreverse footagefloodtelescopechild's point of viewbraveryinvasionfanmisunderstandinganimated sequenceobesitypower outageevacuationnovelistrowboatlostvolcanoaerial shote mailrainstormcaptureturtlecliffsailorbarbecuelanterndead motherbonfirenewspaper clippingfast motion scenecamelexplorationnovelwhaleshipwrecklizardeditorsailboattween girlfish tankimaginary friendseagullhurricanelavawormsouppalm treemotorboatcruise shipclimbing a treesurrogate mothermicroscopewet t shirtmetal detectortreehousegame playingrescue from drowninganimated creditsgolden gate bridgereclusemountain climbingrock climbingtreadmillagoraphobialeg injuryfemale writertropical islandscottish accenthelicopter pilotcoconutseal the animalrole modelvolcanic eruptioncatapultpinatatidal wavealternate worldlifeboatqueenslandbelchingsatellite dishcratersouth pacificwet jeansspyglasswater pumpstarfishpelicansea lionsolar powertug of warclosing credits sequencetoolswindsurfingsea turtleashwading in watertropicssinking boatcalling parent by first nameport a pottymarine biologistarachnophobiaanimated scenecall for helpmonsoonhomeschoolinghiding in a treeman versus naturespear fishingnational geographic magazineroasted pigsatellite phonecan openerdesolate islandplanktonsecurity checkpointalonenessboatmanbuccaneerhula danceroceanographerair hostessamerican expatriatesextantflossing one's teethtropical stormfear of spidershand sanitizersatellite telephonewoman girl relationship (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Boy A (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Boy A (2007)

A young man is released from prison after many years and given a new identity in a new town. Aided by a supervisor who becomes like a father to him he finds a job and friends and hesitantly starts a relationship with a compassionate girl. But the secret of the heinous crime he committed as a boy wei β€¦ghs down on him, and he learns that it is not so easy to escape your past. (Read More)

Subgenre:
coming of age
Themes:
friendshipmurderdeathlovesuicidedrugsrapejealousyprisondrinkingfeardrunkennessescapedancehero β€¦incestparanoiadepressiondrug usedysfunctional familycancerredemptionguiltdatingillnessabusebullyingchildhooddyingforgivenessregretdying mother (See All)
Mood:
nightmare
Locations:
barbeachrestauranttrainschoolcemeterybathtubbusnightclubwatertaxicourtroomrooftopcar theftsex in a bathtub
Characters:
boyfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationshipbrother brother relationshipteachergirlstudentpolicemandancerphotographerlawyerlittle girl β€¦bullywaitresssecretaryuncle nephew relationship (See All)
Story:
dvdfather figurefishingface slapbased on novelfemale nuditybloodmale nudityviolenceflashbackbare chested malesex scenekissfightdancing β€¦photographpartyknifebased on true storytelephone callcryingcell phonebeatingunderwearcar accidentmirrorrescuepunched in the facewatching tvcameradrinkcondomundressingbare buttsecretletterliebeertearsbirthdaybedcar crashcafejailhallucinationvoyeurclassroomrivercriminalreporternewspaperbraambulancefishchild abuseapologytrialdream sequencedrawingbirthday partyvangraveyardold womanconfessionprologuescreamingfired from the jobliarscreamhangingcourtgiftthreatdatewitnesslaptopmurdererex convictclasssleepingpubnewspaper headlinehateapplausetv newsidentityhuggingkilling an animalhead buttwarehouseloss of virginityfriendship between mensexual abusevandalismmale bondingclubfalse identitysocial commentaryembarrassmentpromiseremote controlhaunted by the pastnicknameshopliftinginnocenceshoessurveillance camerakickingtaking a pictureco workerfirst kissamusement parkschool uniformpridefriendship between boysmurder of a childbounty hunterpierpublic humiliationrelease from prisonmoral dilemmaadolescentsaving a lifenew jobporn magazinegatebirthday presentsneakersmen's bathroomfirst datefake identitytowerestatewalletbully comeuppanceroller coasterdiggingmale rapelandladywormecstasytrain trackstrain ridebreast cancerrehabilitationsecond chancefather son estrangementparolegravestonecarouselestrangementtabloidreference to the virgin maryshared bathhoodiemerry go rounddelivery manexposechild rapedressingtrespassingfleeingleg injurymcdonald's restaurantsurrogate fatherhappy birthdayhooded figurerascaltrain conductorsaying goodbyemedia frenzynew identitychild's drawingchild murdererfollowingparole officerboardwalkchild murders a childeellimpingname changecuttingmanchestersocial realismbountycuddlingsneaking outwatching a movie on tvwatching news on tvdishonestynewsstandsecret revealedsurrogate sonfootbridgebox cutterused condomearthwormdangerous friendamusement park ridedancing alonebirmingham englandlagerfirst day at worknottingham englandalecrying during sexsaying i love younew shoesrape of girlthrowing a bottletrain ticketviolent youthbrother brother incestreference to steven seagalreference to jean claude van dammebeach chairreference to don juanthank you note (See All)

Willy Wonka & The Chocolate Factory (1971)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Willy Wonka & The Chocolate Factory (1971)

The world is astounded when Willy Wonka, for years a recluse in his factory, announces that five lucky people will be given a tour of the factory, shown all the secrets of his amazing candy, and one will win a lifetime supply of Wonka chocolate. Nobody wants the prize more than young Charlie, but as β€¦ his family is so poor that buying even one bar of chocolate is a treat, buying enough bars to find one of the five golden tickets is unlikely in the extreme. But in movieland, magic can happen. Charlie, along with four somewhat odious other children, get the chance of a lifetime and a tour of the factory. Along the way, mild disasters befall each of the odious children, but can Charlie beat the odds and grab the brass ring? (Read More)

Subgenre:
coming of agecult film
Themes:
surrealismdancepovertyredemptionrivalrygreedwealthinheritance
Mood:
poetic justice
Locations:
restaurantschoolboatelevatorurban settinggermanytunnel
Characters:
boyfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenteachergirlsingle mothergrandfather grandson relationship
Story:
spoiled childgluttonyspoiled bratbased on novelcharacter name in titlepunctuation in titleslow motion scenecomputerbirthdayrivertelevisionspyfactorysplit screencontest β€¦giftsix word titleclass differencesampersand in titletv newsflyingfaintinglifting someone into the airfbi agenteccentricimpersonationwhite houseransomdwarfimaginationchild's point of viewinventorchild protagonistarizonadisfigurementcaneauctioncontractchocolatecandylaundrytv reporterprizechewing gumfriends who live togethertour guideschoolteacherrags to richesluckfamous scoreforgeryhonestypsychotherapytrapdoorreclusemontanaticketgooserecipeindustrialistminiaturizationscreenplay adapted by authorwish fulfillmentlifting male in airinvalidindustrial espionagecandy barbelchpleadingpaperboygeesegrandparentnewsstandwallpapersteamboatcandy storeoverweight childused car salesmanchocolate factorymanufacturersudden change in sizecouch potatoused car dealertelevision addictionimaginary creaturelaundresstest of characterpaddlewheel boattinkercompeting businessesconfectionerscanimate (See All)

To Have And Have Not (1944)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

To Have And Have Not (1944)

Harry Morgan and his alcoholic sidekick, Eddie, are based on the island of Martinique and crew a boat available for hire. However, since the second world war is happening around them business is not what it could be and after a customer who owes them a large sum fails to pay they are forced against  β€¦their better judgment to violate their preferred neutrality and to take a job for the resistance transporting a fugitive on the run from the Nazis to Martinique. Through all this runs the stormy relationship between Morgan and Marie "Slim" Browning, a resistance sympathizer and the sassy singer in the club where Morgan spends most of his days. (Read More)

Themes:
friendshipmurderpovertyabusealcoholism
Locations:
fishing boatbarhotelboatnightclubcaribbeanbar shootout
Characters:
singerlustalcoholic
Period:
world war two1940s
Story:
orchestral music scorefishingface slapbased on novelkisscigarette smokingpistolshootoutmachine gungunfightkissingrifleinterrogationcafepiano β€¦islandfemme fatalegunshotfugitiveevil manstreet shootouttrustfaintingrepetition in titlenicknamegunshot woundlove at first sightfogsongwriterlanterncellarmisogynyjobchloroformpiano playersidekickpickpocketdockpistol whipwhistlewhistlingbullet woundlighting a cigarettetitle same as booklimptommy gunfamous lineticketgestapoexpatriatestowawayfrench resistancenursinglounge singersource musicwoundedfirst aidhired gunautomatic riflewolf whistlewest indiesgangrenevichylighting a cigarette for a womanlighting someone's cigaretteboat captainhiccupsmartiniqueingenuereference to charles degaulleremoving a bulletbox of matchespatrol boatcharter boatfirst aid kitdelirium tremensreference to brazilfishing linemap on screenstray bulletwhistler (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ponyo (2008) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ponyo (2008)

The son of a sailor, 5-year old Sosuke lives a quiet life on an oceanside cliff with his mother Lisa. One fateful day, he finds a beautiful goldfish trapped in a bottle on the beach and upon rescuing her, names her Ponyo. But she is no ordinary goldfish. The daughter of a masterful wizard and a sea  β€¦goddess, Ponyo uses her father's magic to transform herself into a young girl and quickly falls in love with Sosuke, but the use of such powerful sorcery causes a dangerous imbalance in the world. As the moon steadily draws nearer to the earth and Ponyo's father sends the ocean's mighty waves to find his daughter, the two children embark on an adventure of a lifetime to save the world and fulfill Ponyo's dreams of becoming human. (Read More)

Subgenre:
disaster filmdisaster movie
Themes:
friendshiplovemagic
Mood:
animemyth
Locations:
fishing boatbeachsmall townboatseashipoceanearthfishing town
Characters:
boyfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipchildrengirlsister sister relationshipmotherdaughterfathermermaidin love
Story:
sea captaincharacter name in titleone word titlefishunderwater sceneprincesstransformationmagical realismmoonlifting someone into the airblockbusterfloodtrappedreconciliationson β€¦power outagewizardseasidecliffsailorreckless drivingharborlocal blockbustersenior citizenretirement homesorcerertsunamilifting person in airmagic spellfloodingjellyfishmagical powerhoneyyoung girlgeneratorham radiooverprotective fathertidal wavepre schoolmorse coderunning away from homesave the worldseaside town5 year oldthe moontoy boatfive year oldchildren adventuretest of loveyouth restoredbreaking freesenior centerloss of powerprehistoric fishramen noodlesbecoming humanwanting to be human (See All)

The Shipping News (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Shipping News (2001)

An inksetter in New York, Quoyle returns to his family's longtime home, a small fishing town in Newfoundland, with his young daughter, after a traumatizing experience with her mother, Petal, who sold her to an illegal adoption agency. Though Quoyle has had little success thus far in life, his shippi β€¦ng news column in the newspaper "The Gammy Bird" finds an audience, and his experiences in the town change his life. Then he meets the widow Wavey... (Read More)

Subgenre:
tragedy
Themes:
deathkidnappingmarriageinfidelityrapeadulterypregnancydrunkennessinvestigationmagicincestmemoryangerpovertyredemption
Mood:
rainnightmare
Locations:
boat accidenthospitalbarsnowsmall townboatnightclubvillagewoodsrural settinglakeshipcanadaoceancampfire β€¦storm (See All)
Characters:
fishermanfather son relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrendetectivemusicianphotographerbabywriterlittle girlsingle motherlittle boy β€¦employer employee relationshipsingle fatheraunt nephew relationship (See All)
Period:
winter
Story:
fishingaccidentbased on novelflashbacksex scenekissphotographpartythree word titlepantiescryingwoman on topdreamcorpsecar accident β€¦rescuecomputercamerathongvomitingtearscar crashislandrivertelevisiontelephonereporterdecapitationsurvivalnewspaperbracandleambulancebridgewidowdinerhousemapfishdinnerdrivingsevered headritualsearchvoice overgraveyardbartendercursewidowerfactorydolllightningscreamisolationunderwaterreference to william shakespearetypewriternewspaper headlinesingle parentchainsawiceropetraditionpirateteawoundreference to adolf hitlerbabysitterbuttockstimeirishjournalismcompassionback from the deadwatching televisionremote controlhaunted by the pastlandscapethunderplaygroundjob interviewsuperstitionice skatingice hockeyseasidecasual sexmarital problemferryweathersymbolismadulterous wifeauntbandageparenthoodmetaphoraccordionmental retardationoutsidersweatnewspaper articlekiteleukemiahearsebody bagfeverashesrainingsewing machinewakestorygravestonecarpenterriteurnmortalitycustomnewspaper editorcar wreckatlantic oceanmoosestarting overvisionscadaverpulitzer prize sourceancestordesertioncableouthousepaper airplaneprinterwirepatternpiracyincest rapenewfoundland canadanewspaper officehockey gamedeath in familyice skatescovenursery schoolnotesabusive wifecapsizeibmcairnreference to robert burns (See All)

Pee-wee's Big Adventure (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pee-wee's Big Adventure (1985)

The cartoonish and childish character Pee Wee Herman goes on a big adventure for the first time ever when his beloved shiny new bicycle is stolen by his nemesis Francis Buxton, a fellow man-child and neighborhood rich "kid." And he sets off on an obsessive cross-country journey, determined to recove β€¦r it. Pee-wee's awkward and childish attempts to be cool and mature. (Read More)

Subgenre:
cult filmclaymation
Themes:
surrealismghostgangsterdevilescape from prison
Mood:
spoofnightmare
Locations:
bicycleroad triptexasroad movie
Characters:
bullywaitresstruck driver
Period:
1980s
Story:
child actorspoiled bratorchestral music scorecharacter name in titledancingchasefiredreamcar crashcaliforniadisguisenuncowboypay phoneon the road β€¦convertiblefilm within a filmbasementdirectorial debutcult directorcross dressingrecord playerelectronic music scoresergeantpoolhitchhikerback from the deadhitchhikingbikeranimated sequencemovie setlonerfortune tellerpractical jokebicyclingescaped convictinfatuationhandcuffedmovie studiorodeotour guidetyrannosaurus rexfamous scoreman childevil clownmother superiorpayphonecrystal balldrive inhighway travelcastle thundercoors beerbellhoppet storebicycle racesemi truckdrive in theaternun costumefalling over a cliffalamostolen bicyclerube goldberg machinefake nunbreakfast machinefemale truck driverdisguised as a nunmagic shopschwinn bicyclehanging up without saying goodbye (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

All Is Lost (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

All Is Lost (2013)

Deep into a solo voyage in the Indian Ocean, an unnamed man (Redford) wakes to find his 39-foot yacht taking on water after a collision with a shipping container left floating on the high seas. With his navigation equipment and radio disabled, the man sails unknowingly into the path of a violent sto β€¦rm. Despite his success in patching the breached hull, his mariner's intuition and a strength that belies his age, the man barely survives the tempest. Using only a sextant and nautical maps to chart his progress, he is forced to rely on ocean currents to carry him into a shipping lane in hopes of hailing a passing vessel. But with the sun unrelenting, sharks circling and his meager supplies dwindling, the ever-resourceful sailor soon finds himself staring his mortality in the face. (Read More)

Themes:
drinkingloneliness
Mood:
rain
Locations:
boat accidentboatwaterseastormyachtstorm at sea
Characters:
one actor
Story:
lost at seasailingfishingflashbacktitle spoken by characterknifethree word titlefirevoice over narrationfoodmirrorrescuecomputerdrinkbook β€¦f wordswimmingsurvivalflashlightold maneatingmapfishapologyradiounderwater scenedangerreadingsleepingeyeglassesdisasterropeclaim in titleshavinglooking at oneself in a mirrorsurvivordesperationsharkwindbraveryhungersailorweatherall male castminimal castgloveshead woundalonevery little dialoguesailboatraftfalling into waterflareknocked unconsciousswimming underwaterone man showhammockin medias reswriting a letterwetnessinner title cardwetoverhead shotwrenchfloodingemergencydamagesolostatement in titlereference to ernest hemingwayhead bandagegodsshipping containersunburnglueminimal dialoguecargo shippaintbrushrepairdriftingnavigationcalling for helpmopping a floorsailindian oceansetting a fireboiling waternavalsinkingsosleakmessage in a bottlelife raftdeep seaone man filmfalling overboardradio signalsextantsleeping in a hammocksurvival kit (See All)

Jaws 2 (1978) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jaws 2 (1978)

Four years after the events of the original "Jaws", the town of Amity suddenly experiences series of mysterious boating accidents and disappearances. Chief of Police, Martin Brody, fears that another shark is out there, but he is ignored by the townsfolk. Unfortunately, he's right. There is another  β€¦Great White in the sea. And it wants revenge. (Read More)

Subgenre:
creature feature
Themes:
marriagefeardrunkennessangerobsessionparanoiapanic
Locations:
boat accidentbarbeachhotelhelicopterhelicopter accident
Characters:
boyfather son relationshiphusband wife relationshipbrother brother relationshipteenage girlteenage boymayor
Story:
sailingnumber in titlesequeltwo word titlebare chested malecigarette smokingphotographcorpsedigit in titlerescuesecond partnumbered sequelislandprayersurvival β€¦new yorkdeath of friendchild in perilunderwater scenebinocularsscreamingfired from the jobelectrocutionhairy chestteen angstbulletblockbusterpart of trilogysharkboxer shortsmisunderstandingcharacters killed one by onelighthousepolice chiefshipwrecksailboatraftscuba divingmale protagonistdarkroomshark attackexploding boatmarinashort shortsnumber 2 in titlewater skiingloss of boyfriendkiller sharktroubled productiongreat white sharkcyanidedisbeliefdisbelieving adultpower lineland developerwater balloontown meetingshark featurehuman versus sharkhystericssharksploitationbeached whalegiant sharkribbon cuttingeaten by sharkman wearing a swimsuit (See All)

The Water Horse (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Water Horse (2007)

A boy finds an interesting egg. His curiosity leads him to protect it and want to figure out what will come out of it. He didn't realize that it would turn into something magical. The boy and the Water horse grow a strong relationship together in this wonderful story.

Themes:
celtic mythology
Locations:
boat accidentbeachbathtubsea monster
Characters:
boymother son relationshipbrother sister relationshipsoldiersingle mothermilitary officer
Period:
world war two1940s
Story:
fishingbased on noveldogphotographsurprise endingsubjective cameratoiletno opening creditsfantasy sequencecharacter's point of view camera shotscarloss of fatherunderwaterpubegg β€¦told in flashbackcookscotlandrowboatthunderstormsailorhousekeeperwilhelm screamfountainhoaxrescue from drowninghandymanworld war two veterancountry estateecholoch ness monsterscottish highlandswar widowpatrol boatchild pet relationship (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Key Largo (1948)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Key Largo (1948)

Frank McCloud travels to a run-down hotel on Key Largo to honor the memory of a friend who died bravely in his unit during WW II. His friend's widow, Nora Temple, and wheelchair bound father, James Temple manage the hotel and receive him warmly, but the three of them soon find themselves virtual pri β€¦soners when the hotel is taken over by a mob of gangsters led by Johnny Rocco who hole up there to await the passing of a hurricane. Mr. Temple strongly reviles Rocco but due to his infirmities can only confront him verbally. Having become disillusioned by the violence of war, Frank is reluctant to act, but Rocco's demeaning treatment of his alcoholic moll, Gaye Dawn, and his complicity in the deaths of some innocent Seminole Indians and a deputy sheriff start to motivate McCloud to overcome his Hamlet-like inaction. (Read More)

Subgenre:
cult film
Themes:
murderdeathbetrayaldrinkingfeardrunkennessescapegangsterhumiliationalcoholismcouragemurder of a police officerclaustrophobia
Mood:
rain
Locations:
fishing boatbarhotelboatbathtubbuswheelchairpolice car
Characters:
policefather daughter relationshipboyfriend girlfriend relationshipsingerbrother brother relationshiphostagenative americanalcoholic
Story:
seasicknessorchestral music scoreface slapbloodgunphotographsingingpistolbased on playcorpseshot to deathdrinkplace name in titleislandprayer β€¦revolverflashlightwidowold womanbartendergunshotorganized crimelightningcrime bossshavingveteranmanhuntpower outagethunderstormfogwar veteranextortionsirenplaying cardsdockspit in the facewar herofirearmblackoutdrunkardhurricaneescaped convictlistening to radiocripplepalm treedisillusionmenthandicappedworld war two veteranstraight razorfather in law daughter in law relationshipoil lampcounterfeitboatingunconsciouscounterfeit moneypsychological tormentboathouseisland name in titlecanoeingflorida keyswar widowinner monologuemollinnocent mankey west floridagun mollmortal woundseminole indiandeportee (See All)

The Guardian (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Guardian (2006)

Ben Randall is a Coast Guard rescue swimmer. When his crew is killed in an accident and his marriage ends, his commander tells him he wants Randall to go to the US Coast Guard Rescue Swimmer "A" School to train other rescue swimmers. He encounters a guy named Jake who's a little cocky because he was β€¦ once a swim champion. So Ben puts him through the wringer to see if he can handle it. (Read More)

Themes:
deathlovedrunkennessmilitaryrivalryself sacrifice
Mood:
high school
Locations:
fishing boatbarrestaurantschoolswimming poolforesthelicoptersnowmotorcyclebuswaterwoodsseashipcave β€¦oceanstormalaskastorm at sea (See All)
Characters:
husband wife relationshipboyfriend girlfriend relationshipteachertough guywarriorbullyteacher student relationshipex husband ex wife relationshipship captain
Story:
accidentblooddogbare chested malephotographtitle spoken by characterexplosionfirevoice over narrationcorpserescuearrestsunglassesalcoholswimming β€¦ambulancedeath of friendmontageimpalementno opening creditsunderwater scenedrowningbartendertrainingcharacter repeating someone else's dialoguelocker roomlightningactor shares first name with characterpremarital sexchampionsacrificedisastericeanswering machineheavy rainjail cellwalkie talkielossbar fighthaunted by the pastfloodteampool tablerainstormexploding helicopterwedding receptionnewspaper clippinggraduationnavyflarehurricanehelicopter crashnewspaper articlewagerteamworkairfieldswimmerdeath by drowningfemale bartenderrookieresignationpagerreceptioncoast guardnaval officertidal waveinstructorstopwatchsinking shipestranged wifesearch and rescuenight vision binocularstroubled pastreference to f. scott fitzgeraldu.s. coast guardrecordsgraduation ceremonyopening creditsice watertropical stormhot shotbering straitcockyheroic death (See All)

Salmon Fishing In The Yemen (2011) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Salmon Fishing In The Yemen (2011)

A visionary sheik believes his passion for the peaceful pastime of salmon fishing can enrich the lives of his people, and he dreams of bringing the sport to the not so fish-friendly desert. Willing to spare no expense, he instructs his representative to turn the dream into reality, an extraordinary  β€¦feat that will require the involvement of Britain's leading fisheries expert who happens to think the project both absurd and unachievable. That is, until the Prime Minister's overzealous press secretary latches on to it as a 'good will' story. Now, this unlikely team will put it all on the line and embark on an upstream journey of faith and fish to prove the impossible, possible. (Read More)

Themes:
friendshipdeathmarriagereligionmoneydrinkingobsessionterrorismgrieffaithhopefalling in lovewealthjustice
Mood:
rain
Locations:
restaurantchurchhelicopterairplaneboatdesertlondon englandwatertaxicastleofficecampfirecanyon
Characters:
fishermanboyhusband wife relationshipmother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipchildrenphotographerreference to godmuslimchineseengineer
Story:
fishingbased on novelsexbare chested malegunkisscigarette smokingtitle spoken by charactertelephone callcryingcell phoneunderwearfoodslow motion scenecomputer β€¦cameradrinkundressingletterrifletearsanimal in titlerunningcafebritishreference to jesus christprayerriversciencetelephonescientistf wordsubjective cameraswimmingnewspaperjournalistassassinwineterroristvideo cameramontageeatingmapfishapologyunderwater scenenews reportumbrellamissiontentsplit screenthreatreunionnewspaper headlinepickup trucktv newstraitoranswering machinecaptainteasabotagedestructioncountry name in titleassassination attemptreference to adolf hitlerpropagandaislammagazinepress conferenceculture clashorchestragoatwatching televisionmiddle eastfloodbreakupboxer shortsministermobile phonescotlandpartnernewsreel footagemiracleafghanistanoilschool uniformarabvoice over lettertuxedomidlife crisisholding handsislamicprime ministertext messagingprayingsaving a lifehandshakeshynesswar heroterritory name in titlenaivetylistening to a radioquitting a jobunhappinessdamgiving a toastcelloplaying a video gamepressdeath of boyfriendluckinternet chatsleeplessnessradio newsdeath by drowningprivate jetintercomcellistoverhead shotscientific researchfloodingbad luckpublic relationsarabickneelingsaying goodbyesalmonwatching someonecandelabrabeing watchedhead scarfjoke tellingvisionarydead fishgeologistdining halltalking to an animaldessertheadsetdreamerworryingfly fishinghusband wife estrangementcivil servantmissing in actionmandarinphdfish in titlelooking through a windowbureaucrattrombonefishing netreference to queen elizabeth iisheikhreflection in waterwading in waterhubrisirrigationbritish prime ministerbritish governmentshreddersharing a bedburkayemenreference to californiafisheryreference to mars the planet10 downing streetpress secretaryreference to ark of the covenanttrombone playerkoi pondrod and reelgravelfish farmmoment of truthlistening to classical musicreference to geneva switzerlandsport fishingdangling feet in waterreference to a nazisluicespawning (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Disturbia (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Disturbia (2007)

After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu β€¦rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)

Subgenre:
black comedysuspense
Themes:
friendshipmurderdeathrevengekidnappingbetrayaljealousydrinkingescapeinvestigationvoyeurismpsychopathdeath of fatherparanoiaphotography β€¦panicmurder of a police officer (See All)
Mood:
neo noirhigh schoolslasher
Locations:
fishing boatswimming poolcarbicyclepolice carcourtroomrooftopstorm
Characters:
boyfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendteenage boyteacherserial killerstudentpolicemandancerwriter β€¦police detectivevillainterrorcousin cousin relationship (See All)
Story:
fishingaccidentbloodviolenceone word titledoggunkissfightdancingtitle spoken by characterpartyknifechasetelephone call β€¦cell phonecorpseblood splatterfoodcar accidentpunched in the facewatching tvcomputerdrinkarrestbikinibookplace name in titlerunningdead bodybathroomneighborhandcuffsvoyeurclassroomswimmingnewspapervideo camerawomaneatingimpalementstabbed to deathstabbed in the chestjudgesevered headtrialduelflash forwardbinocularssuburbmissing personevil manreadingrabbitbaseball batlightningskeletonpranklong takescarwighigh school studentstalkingwitnessbasementneck breakinggardenclassobscene finger gesturesubtitled scenegaragemaniacflirtingtv newsteen angstbreaking and enteringlistening to musicsociopathcaptiveassaultpsychoskullparking garagebroken legrampagebarefootwoman in jeopardywindtelescopethunderspanishbroken glassshovelscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreereckless drivingchocolatexboxpsychopathic killerbad guyearphonesmadmanboredomclosetlaundryhuman monsterhomicidal maniaccoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostlawn mowerchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All)

The Legend Of 1900 (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Legend Of 1900 (1998)

1900. Danny Boodmann, a stoker on an American passenger liner, Virginian, finds a baby abandoned on the ship. He names the child Danny Boodmann T.D. Lemon Nineteen Hundred '1900' and raises the child as his own until his death in an accident on the ship. The child never leaves the ship and turns out β€¦ to be a musical genius, especially when it comes to playing the piano. As an adult he befriends a trumpet player in the ship's band, Max Tooney. After several years on the ship Max leaves, and tells the story of 1900 to the owner of a music store. (Read More)

Themes:
deathlovetravellonelinesswealth
Mood:
rain
Locations:
new york citysnowseashipoceanstorm
Characters:
father son relationshipmusicianbabyship captain
Period:
1930s19th century1920s1910s1900s
Story:
seasicknessaccidentbased on novelflashbackkisscigarette smokingdancingexplosionchasetelephone callvoice over narrationfondlingcryingsecretvomiting β€¦rifletearspianoorphanbandimmigrantflash forwardchristmas treepianisttragic eventcontestrecord playerjazztwenty somethingitaliancaptainrecordingaccidental deathorchestranew orleans louisianadespairdynamitegeniuspiano playeraccordionabandonmentwagerchandelierpassengertrumpetdemolitionportstatue of libertycoalballroomchild prodigymusical instrumentsurrogate fathermusic storeabandoned babyturn of the centurygoodbyemotivationalocean linertrumpet playerfurnacerecording sessionitalian immigrantband memberburial at seaengine roomtransatlanticyear 1900luxury linermusical duelstokerseastorm (See All)

The Sisterhood Of The Traveling Pants (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sisterhood Of The Traveling Pants (2005)

The movie is based on the young adult book, The Sisterhood of the Traveling Pants, by Anne Brashares. As four best friends spend their first summer apart from one another, they share a magical pair of jeans. Despite being of various shapes and sizes, each one of them fits perfectly into the pants. T β€¦o keep in touch they pass these pants to each other as well as the adventures they are going through while apart. (Read More)

Subgenre:
coming of ageteen movieteen romancedocumentary filmmakingdocumentary footage
Themes:
friendshipdeathpregnancyweddingfuneralfilmmakingdatingfirst love
Locations:
fishing boathospitalbeachchurchcemeterynightclubairportkitchenmexicosinging in a car
Characters:
boyfamily relationshipsfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipteenage girlfemale protagonistgirlpriestlittle girlmaidfilmmakeramerican abroadchildhood friend β€¦self discovery (See All)
Period:
summer
Story:
based on novelf ratedcigarette smokingdancingphotographpartypantiesvoice over narrationcryingblondewatching tvcomputerlettertearscleavage β€¦soccerbracandlevideo cameraambulancewhite pantiescoffindrawingjeansvacationpianiststagefirst partloss of motherterminal illnesssupermarketteen angstloss of virginitygroup of friendsjoggingloss of friendloss of loved onetimetennisbrideremote controlpet doggreeceheadphonesfirst kisslaughingsirenadolescentmusic bandjoygirl in bra and pantiesdonkeywedding ceremonylatinasummer campfriendship between womenfemale friendshiptween girlparamedicfriendship between girlsstretcherballerinaleukemiasummer vacationcruise shipwindmillsoccer playerchick flicksoccer matchbabysittingstarsbus ridesick childmailmanpuerto ricanteenage girl in underweartailorclumsinessfamily feudmortalityvideo cassettemotor scooterwedding gowndocumentary crewairlinersmilingswimming in underwearsouth carolinabedriddenblue hairensemble filmdeath of parentfemale artistgoodbyedeath of a childmediterraneangreen hairbased on young adult noveltrouserssoccer coachsisterhoodsummer jobteenage girl in swimweargreek islandstring quartetpantssleep overgreyhound bussports brayoung filmmakerisland lifeaerobics classdepartment store clerk (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Julieta (2016) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Julieta (2016)

Julieta (Emma Suarez) is a middle-aged woman living in Madrid with her boyfriend Lorenzo. Both are going to move to Portugal when she casually runs into Bea, former best friend of her daughter Antia, who reveals that this one is living in Switzerland married and with three children. With the heart b β€¦roken after 12 years of total absence of her daughter, Julieta cancels the journey to Portugal and she moves to her former building, in the hope that Antia someday communicates with her sending a letter. Alone with her thoughts, Julieta starts to write her memories to confront the pain of the events happened when she was a teenager (Adriana Ugarte) and met Xoan, a Galician fisherman. Falling in love with him, Julieta divides her time between the family, the job and the education of Antia until a fatal accident changes their lives. Slowly decaying in a depression, Julieta is helped by Antia and Bea, but one day Antia goes missing suddenly after a vacation with no clues about where to find her, leaving Julieta desperate to understand the reasons of her missing... (Read More)

Subgenre:
autobiography
Themes:
friendshipdeathlovesuicidemarriageinfidelityadulterypregnancyfearmemoryextramarital affairlonelinessdeath of fatherobsessiondeath of mother β€¦depressionguiltgriefunfaithfulnessillnessfaithdeath of wifechildhoodmythology (See All)
Mood:
rainhigh school
Locations:
hospitaltrainsnowboatbathtubbustaxielevatorapartmentseashiptaxi driverstormtrain stationspain β€¦townstorm at seasex on a traintrain engineersuicide by train (See All)
Characters:
fishermanhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendtattoobrother sister relationshipteenage girlteachergirlstudentbabywriterartist β€¦best friendlittle girlsingle motherlittle boygrandmother granddaughter relationshipaunt niece relationshipgrandfather granddaughter relationshipcrying girl (See All)
Period:
1980s1990s2010s
Story:
lost at seafishingaccidentsexfemale nudityf ratedcharacter name in titlenudityone word titlebare breastsflashbackdogbare chested malekissfemale rear nudity β€¦cigarette smokingphotographtitle spoken by charactertelephone callcell phonefoodslow motion scenewatching tvundressingbare buttsecretletterbooksunglassesclassroomtelephonecookingwinemountainbasketballdeath of friendeatingapologyhit by a carsearchdrowningcoffeepainflash forwardauthorsuitcaseflowersfarmerdeath of sondeath of husbandloss of fatherclassbirthday cakeeyeglassestv newswaiterteacomahappinessloss of wifecrying womandesperationfollowing someonestreet lifebreakfastclockretirementpromisethunderbreakupbackpackspanishloss of sontitle appears in writingdespairsculpturehit on the headdeervoice over letterbalconyhousekeeperloss of husbanddead motherbenchneighborhoodbeing followedforename as titleheartbreakfarmingsculptorsummer campname callingfemale friendshipknocking on a doorfriendship between girlsstretcherunhappinessgiving a toastcookiemailbare feetlocked doorreading a bookrespectuniversity studentbroken heartmadrid spainportugalsilencesleeplessnesswriting a letterradio newschance meetingkiss on the cheeklocked in a roompackingintercomfanaticmissing daughter19 year olddoorbelltrain conductorhand kissingmultiple sclerosishospital visitkiss on the foreheadgaliciawoman in a bathtubhuman ashessubstitute teacher20 year oldfemale psychiatristmaturitymagazine editor9 year oldgarbage bagtrain compartmentmother daughter estrangementreference to new york cityloverbirthday card25 year oldmoroccandark glassesbaby strollerill motherconfronting the paststatuetterakesleeping in a chairtorn photographvoice over writingfishnetwoman wrapped in a towelidentifying dead bodypyreneesbubble wrapreference to italywoman on top sexdeath of grandsonidentifying a dead bodyill wifesweatshirtunpackingandalusianreference to ulyssesreference to vogue magazinetv news reporterpainting a roomproofreadingtroubled familyred deerreference to the addams familystrawberriescremated ashesfemale sculptorman's best friendmother and daughter share a bedtwo year oldbrushing someone's haircivil guardheart tattooreference to milan italyelectrolysisreference to cubaschool vacationsclerosis (See All)

Without A Paddle (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Without A Paddle (2004)

Three friends, whose lives have been drifting apart, reunite for the funeral of a fourth childhood friend. When looking through their childhood belongings, they discover a trunk which contained details on a quest their friend was attempting. It revealed that he was hot on the trail of the $200,000 t β€¦hat went missing with airplane hijacker D.B. Cooper in 1971. They decide to continue his journey, but do not understand the dangers they will soon encounter. (Read More)

Subgenre:
slapstick comedy
Themes:
friendshipdeathlovedrinkingfearfuneralredemptiongamblinghomophobiacampingwilderness
Mood:
raindarkness
Locations:
boat accidentmotorcyclecemeterysmall townbicyclerural settingcavemexicocampfire
Characters:
boyfather son relationshiphusband wife relationshiphomosexualpolicemother son relationshipfriendboyfriend girlfriend relationshipdoctortattoosingerteenage boypolicemannative american β€¦sheriffchildhood friendtalking to oneself in a mirror (See All)
Story:
orchestral music scorefishingsexbloodviolencedogbare chested malegunkissfightphotographexplosionsinging β€¦knifechasethree word titleerectiontelephone callfirecryingcell phonesongshootoutcorpseunderweartesticlesmachine gunurinationshotgunslow motion scenecomputerdrinkcondomundressingfalling from heightshootinglieriflebeertearsdead bodymarijuanahallucinationriversubjective camerahalloweenflashlightdeath of friendmapfishradiocoffingraveyardmarriage proposalcursebinocularsprologueliarpay phonechampagneumbrellamassagestorytellingsuitcaselightningskeletonscarpursuitpigreunionfirst partcabinwaterfallbearcorrupt coptwenty somethingpickup truckchainsawropeanswering machinehand grenadegrenadewoundfriendship between menlistening to musictreasurejumping from heightsurfinghome movieladderparking garageanimal attackpromisedentistrap musicboxer shortshippieinsectdynamiteparachutedeerthirty somethinghomoeroticismmineducklanternbriefscrude humorillegal immigrantengagement ringnews reportergamblerdead animalcanoestolen moneysurfertv reporterstonerharmonicaasthmamale rapeflaretape recordingstonedhillbillytreasure huntcdmeat cleaversurfboardbullet woundluckclimbing a treeoregoncontrabandtreehousedrug humorenvironmentalistreference to bill clintonphobiawedding anniversarycompassfootprintguard doghigh school graduationexcrementtreasure mapdrug tradebear trappaddlelassooathcoyotetreasure chestpocket knifesalmoncamping tripwashington statepneumoniarottweilerabandoned mineaction figureham radiobusiness executivegrizzly bearmine shaftriver rapidssource musichijackerhypothermiacosta ricasombreromountain manrappellingcampfire storyfalling treeinhalerpin upfalling over a cliffspooningtrailer houseconstellationlost treasurevitaminfamily curseoarreference to indiana jonesacorntree houseboy scoutscompulsive liarstarting a firefalling off a ladderhibernationall terrain vehicletime capsulehogtape deckblood oathcrossed eyestrouttree sittingrunning of the bullsstitching a woundbug spraycondormace the repellentfanny packflintmix tapehiding underwatermosquito netreference to mount everestdynamite fishingfetal positionfour wheelerhandfishingbreaking glass bottlemicrobereference to c3pobullfrogcellophanebed nettingpierced vaginadearriver guiderope burn (See All)

Indiana Jones And The Temple Of Doom (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Indiana Jones And The Temple Of Doom (1984)

Set in 1935, a professor, archaeologist, and legendary hero by the name of Indiana Jones is back in action in his newest adventure. But this time he teams up with a night club singer named Wilhelmina "Willie" Scott and a twelve-year-old boy named Short Round. They end up in an Indian small distresse β€¦d village, where the people believe that evil spirits have taken all their children away after a sacred precious stone was stolen! They also discovered the great mysterious terror surrounding a booby-trapped temple known as the Temple of Doom! Thuggee is beginning to attempt to rise once more, believing that with the power of all five Sankara stones they can rule the world! Now, it's all up to Indiana to put an end to the Thuggee campaign, rescue the lost children, win the girl and conquer the Temple of Doom. (Read More)

Subgenre:
martial artscult filmstop motion animationchrist allegorylow comedydieselpunk
Themes:
friendshipmurderdeathlovekidnappingtortureescapegangsterheromagicredemptionsadismcrueltyjusticestarvation
Mood:
gorepoetic justice
Locations:
airplanenightclubwatervillagejunglecampfireindiaairplane accidentnightclub shootoutmine car
Characters:
boyfather son relationshipchildrensingerwarrioraction herovillainamerican abroad
Period:
1930s
Story:
child actorfather figureface slapcharacter name in titlebloodviolencesequelbare chested malekisschasepistolfireshootoutfistfightblonde β€¦rescueswordgunfightfalling from heightriflesecond partrivercleavagesword fightbridgeprisonerstabbed in the chestsnakecultdisarming someoneone man armyargumentcursedangerperson on firepoisonevil manskeletonhangingstreet shootouttraplove interestmonkeyoccultcard gamebow and arrowspearballoonheroinegothiclifting someone into the airslaveryroyaltyelephanttempleblockbusterfemale singerpart of trilogyhonorcompassionmexican standoffcrushed to deathslaveeaten alivebarefootadventurerreverse footagediamondsevered fingerbraveryseven word titlewhipfalling to deathinsectairplane crashbooby trapheartfallmusical numbersexy womantuxedominepassionate kissvoodooprequelpalaceleather jacketheroismyellingbrainwashingspit in the facehuman sacrificecrocodilebugcomic reliefroller coasterforeignerraftadventure herofalling into watertriadlavaarcheologysoupunsubtitled foreign languagetyrantmacguffineyeballchild kidnappingkindnessfriends who live togetheralligatorperfumefamous scorearcheologistrighteous rageoutlaw gangshrineheart ripped outtommy gunsecret passagebanquetchosen oneexploding airplaneimmolationlifting person in airheart in handtap dancingfedorahinduismbeetlecaged animalchild laborgross out humorantidoteshacklesscreaming in fearfaminestudio logo segues into filmchild driving cartyrannyindiana jonesemaciationrickshawhand through chestlifting male in airbolt action riflebritish empirevoodoo dollrope bridgeconveyor beltmine shaftbelchshanghai chinawinkriver rapidschild driving a carbelchingburpcremated remainsburpingdeath trapgongsprayed with wateryawningsuspension bridgeplaying pokerturntablebritish colonialcheating at cardsprequel and sequelhallucinogeniclive chickenfemale dancervictim invited to dinnermusical sequence in non musical worksleddingthompson sub machine gunbeating heartlife raftreligious ceremonyeating brainsopening champagneflying batjourney shown on a mapkalimedium breastsyawnore cartwhite tuxedosplitsyear 1857ancient ritualcliffhangingeaten by a crocodilegrindstoneriding an elephantinnocent deaths avengedred carnationthuggeewhite dinner jacket (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Treasure Planet (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Treasure Planet (2002)

A futuristic twist on Robert Louis Stevenson's Treasure Island, Treasure Planet follows restless teen Jim Hawkins on a fantastic journey across the universe as cabin boy aboard a majestic space galleon. Befriended by the ship's charismatic cyborg cook, John Silver, Jim blossoms under his guidance an β€¦d shows the makings of a fine shipmate as he and the alien crew battle a supernova, a black hole, and a ferocious space storm. But even greater dangers lie ahead when Jim discovers that his trusted friend Silver is actually a scheming pirate with mutiny on his mind. (Read More)

Subgenre:
disneysteampunk
Themes:
murderdeathsurrealismescapegreed
Locations:
outer space
Characters:
boyfamily relationshipsmother son relationshipaliensingle mother
Period:
future
Story:
sea adventurefather figurebased on novelflashbacktitle spoken by characterchasefirerescueswordarrestrobotdeath of friendno opening creditsanti heroskeleton β€¦sadnesstrapeavesdroppingpirateloss of friendtreasurespacecraftplanetflatulencecyborganthropomorphismscissorsbooby traphologramjuvenile delinquentportalhugtaverntreasure hunteyeballpart computer animationshapeshiftingteenage herovillain turns goodgiant spiderloss of memorytreasure mapmutinyblack holefamily abandonmentprosthetic limbdistant futureoutrunning explosionshape shifting aliensupernovahoverboardastrophysicistmale with earringimax versionfemale captainholographic map (See All)

The Blue Lagoon (1980) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Blue Lagoon (1980)

On a journey to San Francisco, Richard, his father and cousin Emmeline find themselves on a ship about to explode. Rushed to a lifeboat with Paddy Button, the two children escape while their father (and uncle) are on another lifeboat. In the chaos following, the lifeboats are separated. Paddy, Richa β€¦rd and Emmeline find themselves with no food and no water stuck in the middle of nowhere. After some time, the three come across an uncharted paradise, where Paddy quickly teaches the children fishing, hunting and building. After maybe a month or two, Paddy gets very drunk off a barrel of rum found on the island when they first arrive, and drowns in the middle of the night. Emmeline and Richard, now alone and very scared, move location and rebuild their island home. Many years later, the two young teenagers have developed a very real home, but hormones and feelings between the two strain their friendship, until Richard, who is still very determined to reach San Francisco, is let down by Emmeline when a ship passes by the island and she does not light the signal fire. Throwing her out of the home they had built together, Emmeline attempts to survive on her own but is hurt. After Richard finds her dying, he realizes how he really feels for her and manages to save her. Nature runs its course and their friendship turns into love as the couple learn about the facts of life, when Emmeline has a baby and does not understand why. (Read More)

Subgenre:
coming of ageteen movieteen romance
Themes:
friendshipmarriagechristmaspregnancydrunkennessnaturesexualityfalling in lovewildernessmother natureback to nature
Locations:
beachboatseashipcampfireship fire
Characters:
boyfather daughter relationshipteenagermother daughter relationshipteenage girlteenage boygirlbabylittle boycousin cousin relationshipyounger version of character
Period:
1900s1890s
Story:
ship's cookfishingbased on novelsexfemale nuditynuditybloodmale nudityfemale frontal nuditymale frontal nuditymasturbationmale rear nuditybare chested malesex scene β€¦photographsingingthree word titleerectionfireremakerescuebeddead bodyislandmale pubic haircolor in titlealcoholdecapitationsurvivalold manmontageweaponbirdunderwater scenespankingflash forwardskinny dippingpoisonskeletonchildbirthfirst partunderwatersacrificeteenage sexteen angstloss of virginitycookblockbustersharkskullteenage protagonistdivingattempted suicidechild protagonistrowboatmentorbananayoung lovetribesailorgrowing upparrotmudvictorian eranude swimmingsexual awakeningteenage pregnancygiving birthbeheadingmenstruationbreast feedingpubertystrandedhuman sacrificeshipwreckcorporal punishmentsailboatraftblood staindolphinnativeteenage sexualityunplanned pregnancynewborn babyhammockcrabmusic boxoctopusshrineintergenerational friendshipdeath by drowningsex in naturebarrelnude bathingincestuous desirenude photographchristmas carolpacific oceansailing shiptropical islandloinclothblond boyhutshackturn of the centurypearlhuman skullsuicide pactcastawayrumdrummingsunburnclotheslinesearch partyexploring sexualitylagoonmarblelifeboatdesert islandnative tribeunderwater photographymenarchespyglassstarfishcovered in mudsandcastlecoral reefmorning sicknesssea turtlecoraloarstranded on an islanddrownedswimlacepearl divingberrieschristmas stockingspear fishingsouth seasadriftnude in naturenude female silhouettepuffer fishhandfishingforagingsignal fireabandoning shipfoot cutgutting fishmistaken for godnative ritual (See All)

The Sound Of Music (1965)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sound Of Music (1965)

In 1930's Austria, a young woman named Maria is failing miserably in her attempts to become a nun. When the Navy captain Georg Von Trapp writes to the convent asking for a governess that can handle his seven mischievous children, Maria is given the job. The Captain's wife is dead, and he is often aw β€¦ay, and runs the household as strictly as he does the ships he sails on. The children are unhappy and resentful of the governesses that their father keeps hiring, and have managed to run each of them off one by one. When Maria arrives, she is initially met with the same hostility, but her kindness, understanding, and sense of fun soon draws them to her and brings some much-needed joy into all their lives -- including the Captain's. Eventually he and Maria find themselves falling in love, even though Georg is already engaged to a Baroness and Maria is still a postulant. The romance makes them both start questioning the decisions they have made. Their personal conflicts soon become overshadowed, however, by world events. Austria is about to come under the control of Germany, and the Captain may soon find himself drafted into the German navy and forced to fight against his own country. (Read More)

Subgenre:
cult film
Themes:
marriageescapewedding
Locations:
churchcemeterybuscatholic church
Characters:
father son relationshipfamily relationshipsfather daughter relationshipchildrensingerbrother brother relationshipbrother sister relationshipteenage girlfemale protagonistteacherpriestsister sister relationshipcatholicsingle father β€¦catholic priestnazi officer (See All)
Period:
1930syear 1938
Story:
overboardsea captainorchestral music scorebased on novelf ratedtitle spoken by charactersingingpartychasebased on true storysongguitarmansionnunmarriage proposal β€¦widowerconvertiblepursuitsabotagelifting someone into the airblockbusterfrogpicnicrowboatthunderstormnew jobwhistlestepmotherconventtomboyredheaded womanaustriabishopsurrogate mothercathedralchapeltelegrammusic festivalhiding placecryptballroom dancinglifting female in airlarge familymother superiorbroken engagementnobilitypuppet showmessengercigarette holdergovernesscountry estatemarionettebased on stage musicalgazebosinging contestfamous songtheatrical agentbell towerroman catholicabbeynovicebaronesshitler youthfolk dancesalzburg austriamusic contesttony award source70mm filmabbessaustria hungarypushing a vehiclesinging familycheerfulnessnun in lovefamous entrancesinging nunnunhoodpostulanttrapp family singertyrol (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Vozvrashchenie (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Vozvrashchenie (2003)

Two teenage Russian boys have their father return home suddenly after being absent for 12 years. The father takes the boys on a holiday to a remote island on a lake in the north of Russia that turns into a test of manhood of almost mythic proportions.

Subgenre:
coming of ageindependent filmsuspenseallegorychrist allegorybiblical allegory
Themes:
deathlovedrinkingfearredemptioncampingwildernessfear of water
Mood:
rain
Locations:
beachrestaurantforestboatbuswoodsshiptruckrussiacampfire
Characters:
boyfather son relationshipfamily relationshipsmother son relationshipteenagerbrother brother relationshipteenage boyphotographerrussian
Story:
fishingface slapone word titlebare chested malefightphotographknifechasetelephone callcryingunderwearfoodcameradrinkfalling from height β€¦booktearsrunningcafeislandreference to jesus christtelephoneswimmingaxemontageeatingchild abuseunderwater scenepilotpay phoneon the roadvacationtentdiarytragic eventhateaccidental deathstrangerladderfalling to deathrowboatabsent fatherabusive fathertowerjournalbreadabandonmentfallingsouptravelingmuggingreturnfather son estrangementjumping into waterspeedoverbal abuseboot camptelling a jokeship wreckstickfear of heightsdragging a dead bodychild driving a carhiketarkovskyesquesinking boattarsoaked clotheshitting someonemidnight sunburied boxreturn of father (See All)

Richie Rich (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Richie Rich (1994)

The richest kid in the world, Richie Rich, has everything he wants, except companionship. While representing his father at a factory opening, he sees some kids playing baseball across the street. Richie wants to join in, but they don't want him around. When a plot to kill the Rich family is devised  β€¦by Rich Industries' top executive, Laurence Van Dough, Richie must take over control of the company while searching for his lost parents with the help of some new friends. (Read More)

Subgenre:
cult filmconspiracy
Themes:
friendshipbetrayaljealousyprisonlonelinessdysfunctional familywealthescape from prison
Locations:
baseballlaboratory
Characters:
father son relationshipmother son relationshipprofessor
Story:
lost at seagluttonycharacter name in titledogexplosioncomputerswordbombbased on comic booktoiletfalse accusationchild in perilparkattempted murderfactory β€¦product placementmissing personclass differencescard gamecagelifting someone into the airlaserscampresumed deadswitchbladesurveillance camerapool tablebutlerbulletproof vestshipwreckacidroller coasterbillionairelatinroller skatingvaultfart jokemagnifying glassvillain arrestedtoothbrushmcdonald's restaurantblond boyrich kidfamily lovemount rushmorerollerbladingoverweight childprivate planemanuretakeovergroup of childrenrubber boatlife raftgumball machinechild bossreference to louis vuittonsteak on black eye (See All)

A River Runs Through It (1992) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A River Runs Through It (1992)

The Maclean brothers, Paul and Norman, live a relatively idyllic life in rural Montana, spending much of their time fly fishing. The sons of a minister, the boys eventually part company when Norman moves east to attend college, leaving his rebellious brother to find trouble back home. When Norman fi β€¦nally returns, the siblings resume their fishing outings, and assess both where they've been and where they're going. (Read More)

Subgenre:
coming of ageindependent filmtragedyautobiographical
Themes:
religiongamblingalcoholismchildhoodwilderness
Mood:
affection
Locations:
trainsmall townboattunneltrain tunnel
Characters:
father son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipteenagerbrother brother relationshipactorprofessorself discovery
Period:
1920s1910s1900s
Story:
fishingbased on novelfemale nuditynuditymale nuditymale rear nuditydogfighttitle spoken by charactervoice over narrationbare buttriverreporterfishvoice over β€¦death of brotherdeath of sonwaterfalljournalismministerdrunkcareersunbathingreflectionrear nuditygeneration gaptrain tracksamericanabishopslice of lifenude sunbathingnostalgicfly fishingsunburnindian womanmetronomepresbyteriandartmouth college (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Bitter Moon (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bitter Moon (1992)

British couple Fiona and Nigel Dobson are sailing to Istanbul en route to India. They encounter a beautiful French woman, and that night Nigel meets her while dancing alone in the ship's bar. Later he meets her crippled American husband Oscar, who tells him their story. While living in Paris for sev β€¦eral years trying to be a writer, he becomes obsessed with a woman he met by chance on a bus. He tracks her down and they start a steamy love affair. Soon Oscar finds himself enslaved body and soul by her love, and continues to tell Nigel the details of this relationship in various stages over a number of visits to Oscar's cabin. (Read More)

Subgenre:
black comedypsycho thriller
Themes:
murderdeathrevengesuicidemarriageinfidelityjealousyadulterypregnancylesbianismdrinkingdrunkennessweddingextramarital affairobsession β€¦unfaithfulnesshumiliationsadismabusebreak upcrueltyabortionwriting (See All)
Mood:
rainmurder suicide
Locations:
hospitalbarrestaurantairplaneparis francebathtubbusnightclubelevatorwheelchairseashipsex in showerstorm at sea
Characters:
husband wife relationshipprostitutegirlnursedancerwriterwaitressolder man younger woman relationshipfrenchpimp
Story:
seasicknesssailingaccidentface slapbased on novelsexfemale nuditybloodmale nudityfemale frontal nudityflashback β€¦male rear nuditydoggunkissfightcigarette smokingdancingnipplesphotographpartylesbian kissleg spreadingerectionshowertelephone callcryingbeatingunderwearfoodurinationshot in the headwatching tvcomputerdrinkundressingbare buttshootingvomitingtearscafebisexualcandlebandstrangulationeatinggarter beltspankingfemme fataleshot in the legauthorbinocularswidowerchampagneumbrellaproduct placementpassionstorytellingvacationinjectionpigwhippingsex toyshavingsyringediscored dresssadomasochismcarnivals&mmilkpicnicbroken leghaircuttarget practicecynicismamusement parkcard playingbathingblack eyetuxedoinsulthousekeeperbrushing teethmiscarriagepromiscuityadulterous wifeparalysisgun in moutheiffel tower parismasochismcostume partyferris wheelrazorcripplefootsie under the tablepearl necklacekarmacruise shiprainbowfatal attractionbeggingmerry go roundsex shopbow tiedragging a bodyzippo lighterfemale to male footsie playingplaying footsiedance classwomen's bathroomconcussionpoodletoasterfemale stockinged footnew year's eve partydrinking from the bottlesex addictfoot massagesex gamehand kissingbottled waterbouquet of flowersskeleton costumeconfettiparty hattrust funderotic dancingcarnival ridehopscotchplaying catchfeznotre dame cathedralstraight edge razorhot chocolateerotic dancenirvanareference to the titaniccroissanthit by a vanwedding photographsee through gownvacuum cleaningfire placelatex dressbridge the card gamereference to henry millersashchinese characterslapping a womandriving capslurping a drink with a strawdrink umbrellafoghornocean voyagewool hatno smoking signport holeocean cruisetraction (See All)

Mud (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mud (2012)

14 year-old Ellis (Tye Sheridan) lives on a makeshift houseboat on the banks of a river in Arkansas with his parents, Mary Lee (Sarah Paulson) and Senior (Ray McKinnon). He sneaks out early one morning to meet his best friend, Neckbone (Jacob Lofland). Neckbone, also 14, lives with his uncle, Galen  β€¦(Michael Shannon), who makes a hardscrabble living diving for oysters. The two boys set out to an island on the Mississippi River, where Neckbone has discovered an unusual sight-a boat, suspended high in the trees, a remnant of an extreme flood some time in the past. They climb the tree and into the boat only to find fresh bread and fresh footprints. Realizing that they are not the only ones who have discovered the treehouse boat, they decide to leave. When they reach the shore, they find the same footprint in their boat. And that's when they meet Mud (Matthew McConaughey). Mud is a gritty, superstitious character; his clothes are dirty, his tooth is cracked, and he needs help. He tells the boys he will give them the treehouse boat, his current hideout, in exchange for food. Neckbone is reluctant, but Ellis brings food to Mud, and they develop a tentative friendship. Ellis learns that Mud has killed a man in Texas, and police and bounty hunters are looking for him, but Mud is more concerned about reuniting with his longtime love, Juniper (Reese Witherspoon). Ellis, who has recently developed his own crush, agrees to help Mud escape with Juniper. Ellis and Neckbone carry out bold sc… (Read More)

Subgenre:
coming of agecoming of age film
Themes:
friendshipdysfunctional family
Locations:
forestboat
Characters:
fishermanboyteenagertattooteenage girlteenage boygirlfriendsingle father
Story:
father figurecharacter name in titleone word titletitle spoken by characterriverfugitivefirst kissblack eyefriendship between boysbounty hunterpunchmysterious manjunkyard14 year oldmessage β€¦motorboatclimbing a treeteenage crushprotective maleman boy relationshipsharpshooterstate trooperpactwanted mannickname as titlepenthouse magazinediving suitseparated parentspearlshouse boatpoisonous snakepoisonous snake bitesnake pitpolice roadblockreusewanted for murdereating from a can (See All)

The Cider House Rules (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Cider House Rules (1999)

Homer is an orphan in remote St. Cloud, Maine. Never adopted, he becomes the favorite of orphanage director Dr. Larch, who imparts his full medical knowledge on Homer, who becomes a skilled, albeit unlicensed, physician. But Homer yearns for a self-chosen life outside the orphanage. When Wally and p β€¦regnant Candy visit the orphanage Dr. Larch provides medically safe, albeit illegal, abortions Homer leaves with them to work on Wally's family apple farm. Wally goes off to war, leaving Homer and Candy alone together. What will Homer learn about life and love in the cider house? What of the destiny that Dr. Larch has planned for him? (Read More)

Subgenre:
coming of ageindependent film
Themes:
friendshipdeathlovesuicidedrugspregnancydeceptionincestadoptionabortionfather daughter incest
Locations:
beachrural settingwheelchairnew england
Characters:
boymother son relationshipfather daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorgirlnurselove trianglemilitary officerpregnant by incest
Period:
world war two1940s1930s1920s
Story:
orchestral music scorebased on novelfemale nuditymale nudityfemale rear nuditycigarette smokingvoice over narrationvomitingorphanstabbingdeath of friendscantily clad femaleracial slurpilotprologue β€¦storytellingdeath of childconvertiblegiftpremarital sexloss of virginitysexual attractionoverallsmovie theaterfraudrailway stationbirthorphanageburialappledrug overdoseknife fightrainstormnew jobparalysisdockx rayilliteracyparaplegicforgerysick childlobstermainementor protege relationshipunwed pregnancyscreenplay adapted by authormigrant workerchild driving carsnowball fightboard meetingpro choiceprotegeauthor cameocheating on boyfriendorcharddrive in theaterwar injurymusic score features pianoanestheticdiplomaabortionistcideretherincineratorreading to someonewoman dies from abortionapple orchardbronchitisapple cider (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Short Cuts (1993) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Short Cuts (1993)

While helicopters overhead spray against a Medfly infestation a group of Los Angeles lives intersect, some casually, some to more lasting effect. Whilst they go out to concerts and jazz clubs and even have their pools cleaned, they also lie, drink, and cheat. Death itself seems never to be far away, β€¦ even on a fishing trip. (Read More)

Subgenre:
independent film
Themes:
friendshipmurdersuicidemarriageinfidelityrapejealousyadulterydrinkingdrunkennessincestextramarital affairdrug usecancerredemption β€¦unfaithfulnessalcoholismrape and murder (See All)
Locations:
hospitalbarswimming poolhelicoptermotorcyclelos angeles californianightclubbicycleurban settingcity
Characters:
fishermanfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfrienddoctorsingerpolicemanmusicianbaby β€¦sister sister relationshipartistwaitresslustsnipergrandfather grandson relationshipbakerdeath of boy (See All)
Story:
fishingsexfemale nuditybloodmale nudityfemale frontal nuditymale frontal nuditydogbare chested malefemale rear nudityfemale full frontal nuditycigarette smokingejaculationphotograph β€¦partypantieslabiatelephone callcryingcorpseunderwearcar accidenturinationwatching tvcameradrinksex in bedbare buttsecretvomitingliebeertearsbirthdaylingeriedead bodymarijuanarivercleavagebandconcertcaliforniabasketballfemale pubic hairfishwhite pantieschildpainterscantily clad femalehit by a carcontroversycoffeeskinny dippinglimousinepilotblack pantiesclownpuppetbased on short storyproduct placementbaseball batfemale removes her clothesdeath of sonreunionobscene finger gesturecheating wifejazzsurgerychainsawbirthday cakeno pantiesvandalismloss of loved onedysfunctional marriagepicnicapartment buildingearthquakedrug overdoseunfaithful wifetheatre audienceensemble castaquariumpanties pulled downsalesmansongwriterenvironmentalismalarm clocklingerie slipmelancholychauffeurcoffee shophit and runadulterous wifeharassmentmultiple storylinemagic tricklaundrybreast feedingmake upepisodic structuretrailer homephone sexredheaded womangoldfishstethoscopebakerycellotrailer parkcoincidenceburlesquenaked dead womanquarantinemotorcycle copironingtoy gunfreewaypanties hit the floorcellistbudweiserfather in law daughter in law relationshipconcussionbottomlessbig citycmnfmakeup artistsnoopinggrandfather clocksouthern californiafly fishingwoman in a towelbludgeoned to deathdestruction of propertycovered female frontal nudityfemales talking about sexjazz scorepool cleanerred pubic hairprank telephone callstepsister stepsister relationshipjazz combocarbon monoxide poisoningdiaper changepatrolmansmothered to deathhouse sitterobscene telephone callwatching a cartoon on tvmusical quartettraffic copdouchehousesittingdeath of grandsonintersectionblood clottraffic ticketchildren's partysmelling fingercutting handstripscratching one's butt (See All)

The Spiderwick Chronicles (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Spiderwick Chronicles (2008)

Once upon a time, upon moving into the run-down Spiderwick Estate with their mother, twin brothers Jared and Simon Grace, along with their sister Mallory, find themselves pulled into an alternate world full of faeries and other creatures. Unable to explain the strange disappearances and accidents th β€¦at seem to be happening on a daily basis, the family blames it all on Jared. When he, Simon and Mallory investigate what's really going on, they uncover the fantastic truth of the Spiderwick estate and of the creatures that inhabit it. (Read More)

Themes:
friendshipghostmonstermagictheftdysfunctional family
Characters:
boyfather son relationshipfamily relationshipschildrenbrother brother relationshipmermaid
Story:
father figurebased on novelcharacter name in titlefightdancingknifebookcompetitionmansionsnakeno opening creditschild in perilactor playing multiple rolestherapysingle parent β€¦strong female charactertalking animalvandalismfairyelfbriberydual roletrollidentical twinsgoblincontrabandshape shiftersiblingssaltclosing credits sequencemagical creaturephoenixfantasy landgreat auntwyverngryphonbrownie the creature (See All)

In The Heart Of The Sea (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Heart Of The Sea (2015)

In the winter of 1820, the New England whaling ship Essex was assaulted by something no one could believe: a whale of mammoth size and will, and an almost human sense of vengeance. The real-life maritime disaster would inspire Herman Melville's Moby-Dick. But that told only half the story. "In the H β€¦eart of the Sea" reveals the encounter's harrowing aftermath, as the ship's surviving crew is pushed to their limits and forced to do the unthinkable to stay alive. Braving storms, starvation, panic and despair, the men will call into question their deepest beliefs, from the value of their lives to the morality of their trade, as their captain searches for direction on the open sea and his first mate still seeks to bring the great whale down. (Read More)

Subgenre:
coming of ageindependent filmtragedycreature featuredisaster movie
Themes:
deathrevengesuicidepregnancyfearescapeparanoiarivalryhopecannibalismcourageself sacrificenear death experiencestarvation
Locations:
beachboatwaterfarmseashipcaveoceanstormnew englandstorm at seaship fire
Characters:
boyfather son relationshiphusband wife relationshipwritertough guylittle girlcousin cousin relationshipdaughtership captain
Period:
19th century1850s1820s
Story:
schoonerlost at seabloodbare chested malegunphotographexplosionknifechasesurprise endingpistolbased on true storyfirebased on bookcorpse β€¦horseshot in the headslow motion scenefalling from heightlettervomitingrifleheld at gunpointhallucinationislandsubjective camerasurvivalaxedeath of friendimpalementmapnonlinear timelineno opening creditsbirdchild in perilunderwater scenenecklaceconfessionattempted murderauthorlegendattackcharacter's point of view camera shotcover uplightningskeletonamerican flagpigchickensubtitled scenedisastercaptainwhat happened to epilogueheavy rainsurvivortold in flashbackloss of friendskullanimal attackmexican standoffsocial commentaryretirementwhiskeyhaunted by the pasttensionfloodbraverycannibalhungerevacuationnovelistrowboataerial shotrainstormsailormoral dilemmaexpeditiontestimonywhaleshipwrecksailboatyoung version of characterhurricanedolphintavernindustrysouth americamassachusettsinnexploding shipsole survivorcockney accentanimal killingrookiegiant animalvoyagecompasspacific oceansailing shipthirststarts with narrationflintlock pistolhorse drawn carriageleadershipblond manspaniardbritish actor playing american characteremaciationharpoontidal waveecuadorcastawayanchorabandoned shipmalnutritionsinking shipdesert islanddehydrationhuman skeletonlancespyglassreference to moby dickrationingsailclosing eyes of dead persongiant wavewhalinginquirysinking boatnepotismunderwater explosionmaroonedwill to liveessexinquestman versus naturenecklace yanked offcutting a ropemale rivalrybrigrow boatwhalercabin boyfive dollar billnantucket islandyear 1850capsizing shipdrawing strawsrepairing a roofwhite whaleyear 1821first matesperm whale (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Secret Garden (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Secret Garden (1993)

Living in India, Mary Lennox, a young, privileged girl, is left orphaned when her parents are killed in an earthquake. She is sent back to England where she goes to live on her uncle's estate. It is a fairly isolated existence and she has to find things to keep herself occupied. She finds a sickly y β€¦oung boy...and a secret garden. (Read More)

Subgenre:
costume drama
Themes:
friendshipmagicnaturelonelinessdeath of fatherdeath of motherredemptiongriefhopecrueltychildhoodwealth
Locations:
bathtubrural settingwheelchairindia
Characters:
boyfather son relationshipfamily relationshipsfriendgirllittle girllittle boymaidcousin cousin relationshipemployer employee relationshipuncle niece relationshipself discovery
Period:
19th century
Story:
face slapbased on novelfemale nudityf rateddogphotographtitle spoken by characterfirevoice over narrationcryingtitle directed by femaledreamunderwearhorsecamera β€¦secretneighbororphanmansiondream sequenceportraitpuppetkeywidowergardenstrong female charactericelifting someone into the airelephantloss of wifeservantstrong female leadtorchearthquakereconciliationchild's point of viewtime lapse photographyrosefrustrationyoung loveswinghousekeeperhorse and carriagebonfirepigeonunclehorseback ridingvictorian eratriple f ratedparalysismedical maskweedestatestaircasediscoverygardenerhideoutbellmusic boxhiding under a bedsick childcarriagetantrumpuppet showliverpoolsecret passagewaymanor househidden doormaster servant relationshipoil lampjigsaw puzzlesunlightwhite horseseedneglecttemperorphan girljigsawchild as main characterneglected childcomfortspiritual healingivorystrange noisebluebellsrobintapestryemotional healingshut inwidowed fatheryorkshire englandinner strengthchange of seasonswater lilymaharajaenglish gardenwoman slaps a girllearning to walk (See All)

Chinatown (1974) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Chinatown (1974)

JJ 'Jake' Gittes is a private detective who seems to specialize in matrimonial cases. He is hired by Evelyn Mulwray when she suspects her husband Hollis, builder of the city's water supply system, of having an affair. Gittes does what he does best and photographs him with a young girl but in the ens β€¦uing scandal, it seems he was hired by an impersonator and not the real Mrs. Mulwray. When Mr. Mulwray is found dead, Jake is plunged into a complex web of deceit involving murder, incest, and municipal corruption all related to the city's water supply. (Read More)

Subgenre:
cult filmblack comedysuspenseconspiracypolitical conspiracy
Themes:
friendshipmurderdeathmoneybetrayalpoliticsadulteryfeartorturedrunkennessgangsterinvestigationdeceptionincestextramarital affair β€¦racismcorruptionbrutalityparanoiadysfunctional familysurveillancehome invasion (See All)
Mood:
neo noircar chasenight
Locations:
beachrestaurantlos angeles californiabathtubdesertwaterapartmentpolice stationfarmofficerooftopmexicousayachtfollowing someone in a car
Characters:
fishermanfamily relationshipshusband wife relationshippolicefather daughter relationshipmother daughter relationshippolice officerdetectivehostagelawyersister sister relationshiphitmansecurity guardpolice detectivemaid β€¦secretaryemployer employee relationshipmayorpolice chaseengineercoronerchinese american (See All)
Period:
1930s
Story:
orchestral music scorefishingface slapfemale nuditymale nudityviolenceone word titlebare chested malefightcigarette smokingphotographtitle spoken by characterknifesurprise endingpistol β€¦showertelephone callbeatingcorpseshot to deathfistfighthorsecar accidentshot in the chestshot in the headrescuepunched in the facecamerabrawlsecretshowdownrifleheld at gunpointplace name in titlecar crashdead bodyinterrogationhandcuffsrevolvertelephoneshot in the backambushmansionwomanbridgewidowmapfalse accusationanti herodouble crossfemme fataledrowningracial slurattempted murderbinocularscharacter repeating someone else's dialogueprotestcover upevil manknocked outfarmerdomestic violencelong takeconvertibletragic eventthreatpremarital sexsuspicionthreatened with a knifeshot in the armhandgunnewspaper headlinehenchmanprivate detectivescandaleyeglasseseavesdroppingshavingsabotagevandalismmorguekicked in the stomachnosebleedimpersonationrape victimfollowing someonescammexicanthugcrime scenehaunted by the pastswitchbladeimpostormillionaireplot twistrowboatescape attemptaquariumbutlerpunched in the chestdark heroautopsyaccidental killingwisecrack humordisfigurementdark pastlieutenantloss of husbandethnic slurmelancholypolitical corruptionprivate investigatorsouthern accenttaking a photographdirector cameoex copset uphomageassumed identitybarbergardenerreal estatelawsuitretirement homeknocked unconsciousshot in the eyepocket watchkiss on the lipsgreat depressiondambusiness cardman kills a womanpalm treealtered version of studio logopondfamous scoretragic pasttragic endingdistrustchinatownimplied sexbarbershopfade to blackfamous linetrespassingtycoonsocial decaycocktaildroughtman slaps a womansecret pastbarber shopcity hallorangegovernment corruptionprotective malebloody facecrutchcorrupt businessmansnoopingobituarytelling a jokebeaten uphidden truthlandownerscapegoatorchardends with deathcaught in a liedishonestypolitical cover upmystery womancity councilincestuous relationshipjazz scoremusic score features pianoyawningreservoirsad endingnaked dead mansevered noselos angeles storm drainhard boiledshocking truthphoto labtelephoto lenschinatown los angelessalt waterreference to confuciusmale slaps femalenose bandageyawnbandaged nosewater rightskilled in a carlighting cigarette for womanlos angeles riverco worker co worker relationshiphall of recordsreal estate fraudshot while trying to escapecatalina island californiahanging up without saying goodbyecatalinareal estate scam (See All)

I Killed My Mother (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Killed My Mother (2009)

Teenager Hubert haughtily regards his mother with contempt, and only sees her tacky sweaters and kitsch decorations. In addition to these irritating surface details, there is also his parent's cherished mechanisms of manipulation and guilt. Confused by this love/hate relationship that obsesses him m β€¦ore and more each day, Hubert drifts through the mysteries of adolescence - artistic discoveries, illicit experiences, the opening-up to friendship, and ostracism. The turbulent relationship between mother and son unfolds with a compelling combination of savage fury and melting affection. The stunning, semi-autobiographical directing debut of 20-year-old actor Xavier Dolan. (Read More)

Subgenre:
coming of agesemi autobiographical
Themes:
friendshipmurderloveweddingangerdivorceblackmaildrug usedysfunctional familyguiltpoetrychildhoodinheritancegay love
Mood:
high school
Locations:
restaurantschoolbusbicycle
Characters:
father son relationshipmother son relationshipfriendteenage boyteacherstudentgay sexdancerreference to godgay kisssingle motherlittle boymotherhomosexuality β€¦teacher student relationshipcatholicgay teenagergay relationshipparent child relationshipboyfriend boyfriend relationshipgay student (See All)
Story:
dvdface slapmale nudityflashbackbare chested malecigarette smokingdancingknifechaseshowertelephone callcell phonebeatingunderwear β€¦foodmirrorslow motion scenewatching tvcomputerundressingletterpaintingliecafemarijuanareference to jesus christclassroomrivertelephonef wordgay slurcookingvideo cameramontageeatingsubwayapologylibrarycoming outfantasy sequencepay phonewritten and directed by cast memberdollmanipulationpursuitobscene finger gesturehatesingle parentchessrunawayclaim in titlepot smokinglgbtteen angstlooking at oneself in a mirroroverallsrebellionhome moviereconciliationboxer shortsbackpackkickingrejectiontime lapse photographyschool uniformgay sonboarding schoolmale male kissbriefsbrushing teethphoto albumvideo tapegay bashingvideo storeadolescencevacuum cleaner17 year olddomineering motherschool principal16 year oldgay clubdivorced parentsoverbearing motherinner title cardbipolar disorderwashing dishesreference to bugs bunnyreference to james deanreference to buddhalove hate relationship7 year oldreference to leonardo dicaprioboys' bathroompublic schoolmother son conflictlove hatebegins with a quotemale homosexualityreference to jackson pollockmother slaps sonreference to jean cocteaucontemptreport cardreference to christmasimaginary worldsaint lawrence riverspeed the drugwriting contestthrowing a telephone (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Eyes Without A Face (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Eyes Without A Face (1960)

After causing an accident that left his daughter Christiane severely disfigured, the brilliant surgeon Dr. Genessier works tirelessly to give the girl a new face. He does so however by kidnapping young women and attempting face transplants. He has been woefully unsuccessful to date. The doctor's wor β€¦ld begins to collapse around him when his daughter realizes just what he has been doing. (Read More)

Themes:
murderdeathlovesuicidekidnappingescapefuneralinvestigationlonelinessdepressionguiltfaithhopedeath of wifetrauma β€¦police investigationradiation (See All)
Mood:
goreraineuro noirnoir
Locations:
hospitalrestauranttraincemeteryairplaneparis francebuspolice stationfrancelaboratory
Characters:
boypolicefather daughter relationshipdoctorserial killernursestudentdetectivepriestprofessorsecretaryfrenchdaughtersuicide by jumping
Story:
accidentface slapbased on novelblooddogkisscigarette smokingphotographtelephone callcorpsefoodcar accidentmirrorsecretfalling from height β€¦maskpaintingliecafesciencescientistsubjective camerawinecandlemansionstabbingeatingdrivingtrialbirdradiocontroversygraveyardnecklacedrowningscreamingsuburbliarcharacter's point of view camera shotmistaken identitysuitcasemissing personcollege studentscardisappearancecountrysidestalkingratfreeze framemaniacsurgeryexperimentapplausewaiterwoundlistening to musicfaintinghatmorguepress conferencefollowing someoneshopliftingresearchstabbed in the throatstabbed in the neckmedical examinationhit on the headbookstoredisfigurementsurgeonreckless drivingchloroformmoral dilemmatombbarking dogface maskplastic surgerybandageschemeeiffel tower parislecturestairwayestateinventiondisposing of a dead bodyx rayburnt faceunconsciousnessscalpelelectric shockkidnapperpearl necklacecountry housedisfigured faceoperationbechdel test passedtraumatic experiencedog attackpencilpart of the body in titleswindledovemedical professionmad doctorcryptresearcherman slaps womansurgical operationmissing girlweepingcaged animalportrait paintingsecret doorhidden roompick axereference to pablo picassosecret passagewayskinhospital gownrailroad crossingobituaryoperating roomscarred faceseine riversidewalk cafetransplantbirdcagemedical clinicsecret laboratorydragging a dead bodyguinea pigrejuvenationdead body in a car trunkcarrying a dead bodycaptive womansanatoriummigrainewreathgrand guignolidentificationface woundbitten by a dogdoctor nurse relationshipulcerwanting to diekilled by a doghemorrhageweeping womanrotting fleshfuneral wreathtransplantationexsanguinationfalse identificationantibodycombing one's hairelectroencephalogramnecrosisface bandageskin graftstabbed with a scalpelface transplantyoung women (See All)

The Poseidon Adventure (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Poseidon Adventure (1972)

A passenger ship, on her way to the scrap yard is pushed to her limits by the new owners to save on the dismantling fees. A tidal wave hits her, flipping her over so that all the internal rooms are upside down. A priest takes a mixed band of survivors on a journey through the bowels of the ship in a β€¦n attempt to survive. (Read More)

Subgenre:
cult filmsuspensedisaster filmdisaster movie
Themes:
deathmarriagechristmasfearescapeangergriefdeath of wifepaniccourageself sacrificeclaustrophobia
Locations:
helicopterwateroceanstorm at seaescape by helicopterrescue helicopter
Characters:
father son relationshiphusband wife relationshipdoctorsingerbrother sister relationshipnursepriestjewishlittle boypolice detectiveship captainjewish americanex prostitute
Period:
1970s
Story:
seasicknessface slapbased on noveldancingexplosionsingingthree word titlepantiesfiresongrescuefalling from heighttearsswimming β€¦survivalflashlightbandunderwater scenebinocularsmicrophonerace against timechristmas treescreamstagedie hard scenariounderwaterheart attackdisasterropedestructionsurvivorjoggingloss of wifeblockbusternew year's eveladderpreacherearthquakecelebrationfloodtrappedbraveryministerobesitychaospsychotronicdeath of protagonistone dayloss of brotherweathermusic bandmain character diessermonsaving a lifehysteriaalarmtelling someone to shut uprestroombachelorswimming underwaterreverendpassengercruise shipnatural disasterrescue from drowningbarbershopensembleradardeterminationvoyagechurch servicecruisejealous husbandfloodingreference to mosesatlantic oceannew year's eve partypendantrescue attempthot pantsweldingjumping on a bedmediterranean seasteamocean linertidal wavecorporate greedcrisis of faithfire hosenew year's dayretireeair ductagainst the oddsship sinkingfemale corpseclaustrophobicreference to napoleon bonaparteunderwater explosionsostrapped underwatervisceralauld lang syneengine roomhaberdasherluxury linercapsizehigh seasolder sister younger brotherartificial christmas treewelding torchbra less woman (See All)

Empire Of The Sun (1987) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Empire Of The Sun (1987)

Based on J. G. Ballard's autobiographical novel, tells the story of a boy, James Graham, whose privileged life is upturned by the Japanese invasion of Shanghai, December 8, 1941. Separated from his parents, he is eventually captured, and taken to Soo Chow confinement camp, next to a captured Chinese β€¦ airfield. Amidst the sickness and food shortages in the camp, Jim attempts to reconstruct his former life, all the while bringing spirit and dignity to those around him. (Read More)

Subgenre:
coming of ageepic
Themes:
friendshipmurderdeathsurrealismsuicidebetrayalprisonescapemilitaryrobberyracismthefttheatredyingcourage β€¦starvation (See All)
Locations:
hospitalchurchswimming poolhotelmotorcycleairplaneboatbicyclewaterjapanshiptruckbaseballchinaairplane runway
Characters:
boyfather son relationshiphusband wife relationshipmother son relationshipfrienddoctorsingerteenage boyteachernursestudentthiefreference to godjapanesechinese β€¦americanu.s. soldierjapanese soldierchinese soldier (See All)
Period:
world war two1940s
Story:
orchestral music scoreface slapbased on novelbloodgunkissfightphotographexplosionsingingpartychasebased on true storycryingsong β€¦beatingdreamunderwearfoodbattleswordshootingtearssunglassesdead bodypianobritishsurvivalcandlebridgeprisonernunno opening creditsradiocoffinbathgraveyardcigar smokinglimousinepilotbinocularscharacter repeating someone else's dialoguecostumesuitcasestatuetankflowerspursuitgardensleepingfireworksrefugeeclass differenceshaterecord playerchesspoempirategolffalling down stairsgrenadeflyingrace relationsfaintingcomic booksurvivorrecordinghong kongstealingsergeantexploding buildingwristwatchmobculture clashtennisdead womanmilkstreet lifetokyo japanbombingchild's point of viewbraveryu.s. armykatana swordchild protagonisthungerevacuationheavenaviationdead childfrustrationparachuteprisoner of warchoirsoulcapturestadiumdead woman with eyes opencoincrowdatheistchauffeurmudphilippinespiano playerdormitorychocolatebarbed wirepeasantharbordockstonestreet marketcorporal punishmentabandoned housesingaporeatomic bombblack marketharmonicashoecostume partystethoscopecolonialismhead injurykitefeverteethu.s. navyluckbettingcadillacair raidradio newssurrendermovie camerapotatou.s. air forceexploding airplaneeyesfleeingfootprintmotorcycle with a sidecarricepowpretending to be deadpick axearmy lifepearl harborweldingtrademodel airplaneparatrooperhiroshima japanjapanese armyconey island brooklyn new york citycountry clubscavengercaninginnocence lostsalutestarving childseparation from familyinternment campwatchtowerabandoned shipshanghai chinawaterfrontjapanese occupationkite flyingokinawa japancholeraboys' choirvitaminchinese armywreathfleetnagasaki japanmarblestoy airplanefaucetreference to franklin d rooseveltsoldier of fortunebartertin canarchgocartoxenfar eastmangosymphonic music scoreindochinastealing from a dead bodyproteinreference to norman rockwellsalt minecooliedeath marchtextile milldysenterylegless manyangtze riverbridge the card gamemosquito netair droprear end car accidentmusic score features choirboy sopranoid tagjapanese air forcedowned airplaneaircraft explosiongolf shoesjapanese surrender (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Coda (2021)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Coda (2021)

As a CODA (Child of Deaf Adults), Ruby is the only hearing person in her deaf family. When the family's fishing business is threatened, Ruby finds herself torn between pursuing her love of music and her fear of abandoning her parents.

Subgenre:
coming of agedomestic drama
Themes:
friendshiplovefirst love
Mood:
high school
Locations:
fishing boatbarschoolboatseaocean
Characters:
fishermanfamily relationshipsteenagersingerbrother sister relationshipteenage girlteacherstudentmotherdaughterfatherparent child relationshipdeafnessthe familymean girl
Story:
fishingbare chested malesex scenefightsingingsongtitle directed by femaleremakefightingswimmingfishpoint of viewbusinesshigh school studentbrother β€¦stagesleepingobscene finger gesturesisterhuggingoverallsrehearsalclockmexicansonlaughtermeetingsign languagedeafmarketfemale friendship17 year oldlanguagehugreference to youtubemassachusettsmusic teacherinterpreterreference to bob dylanyoung girlchorusstrong sexual contenthearingreference to david bowiebarroom brawlwoman directormusic schoolamerican sign languagefishersmall town girlworking class familyobscene hand gesturedeaf parentway of lifeschool choirbritish actress playing american character (See All)

Hearts In Atlantis (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hearts In Atlantis (2001)

This is a gentle, innocent film about the reflections of an aging man, who returns to his home town after the death of his best friend. Memories of life at age 11 floods back as it was a magical time that changed his life. Three 11 year old children (Bobby, Carol, and Sully) share their lives. Carol β€¦ and Bobby have a special affection for one another including sharing a kiss "by which all others will be measured". Bobby lives with his mother, a bitter, vain woman who looks for pleasures for herself without sharing much with her son. Into their lives comes a mysterious new boarder, who befriends the boy but generates distrust from the mother. As time passes, the man and boy share confidences and special powers are revealed. The man warns the boy to be on the lookout for the "lowmen", who were seeking him. The two share a summer's adventures and come to love one another before the inevitable happens. A confrontation with a school bully also changes everyone. (Read More)

Subgenre:
coming of agesuspense
Themes:
friendshiprapemoneybetrayalfuneralmemorysupernatural powergamblingchildhood
Locations:
barsmall townbicycle
Characters:
boymother son relationshipphotographerbullysingle motherchildhood friend
Period:
1960s
Story:
father figureface slapflashbackkissbirthdayorphanwidowfootballboxingon the runpay phonestorytellingbaseball batamerican flagcinema β€¦psychicrecord playerassaultcompassionwatching televisionnostalgiafirst kissamusement parkbilliardslingerie slipchildhood memorylighthousereading aloudtween girlinformantgoldfishferris wheelwagervirginiastation wagonpsychic powermiddle classwoman smokerenigmaclairvoyantmysterious strangerboarding housechildhood sweetheartfairgroundconnecticutmysticreference to bugs bunnyhelium balloonbased on novellabased on the works of stephen kingwind chimebaseball glovedollar billstraw hatblowing bubblesworking latedislocated shoulderweeping womancarnival gamewrong numbermindreaderhanging laundrybased on multiple workslibrary cardthree card montequeen of heartspocket billiardsculvert (See All)

Stand By Me (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Stand By Me (1986)

It's the summer of 1959 in Castlerock, Oregon and four 12 year-old boys - Gordie, Chris, Teddy and Vern - are fast friends. After learning of the general location of the body of a local boy who has been missing for several days, they set off into woods to see it. Along the way, they learn about them β€¦selves, the meaning of friendship and the need to stand up for what is right. (Read More)

Subgenre:
coming of agecult filmcoming of age film
Themes:
friendshipdeathbetrayalfuneralmemoryredemptioninsanitygriefchildhoodwritingcouragecamping
Locations:
traincarsmall townwoodscampfire
Characters:
boyfather son relationshipfamily relationshipsteenagerfriendtattoobrother brother relationshipteenage boywriterbest friendbullymotherchildhood friendboy in underwearboy with a gun
Period:
1950ssummer
Story:
fishingbloodflashbackdogbare chested maleguncigarette smokingsingingknifethree word titlepistolvoice over narrationcryingsongdream β€¦corpsecomputervomitingdead bodygay slurbedroomdeath of friendbridgenonlinear timelinechild abusedrivingno opening creditsgunshotauthoron the roadstorytellingbaseball batscarconvertibledeath of brotherglassestwinnewspaper headlineeyeglasseshuggingloyaltyfaintingcomic booktitle based on songgroup of friendsloss of friendmale bondingjumping from heightswitchbladegrocery storeinnocencenostalgiachild protagonistswampdead childfriendship between boysdeerdead boyloss of brothermoral dilemmachildhood memoryplaying cardsheroismunderdognarrated by character12 year oldstoreoutcastinsecurityimperative in titlejunkyardplaying poolinspirationfencetelling someone to shut updiggingboy with glasseslistening to a radiobare chested boybaseball caphamburgertrain tracksimmaturitypierazor bladewalkingunderage smokingbereavementoverweightoregontreehouselunaticreference to supermanwet clothesjuvenile delinquencypool hallfamous linetrespassingchild with gunpre teenguard dogtitle appears in songtroubled teenchild swearingtalking to selfcanteenaspiring writerdecomposing bodyrailroad trackdog tagclothes linegolden retrieverreference to mickey mousepacific northwesthowlingleechchild uses guncrawlingbased on novellaporchbased on the works of stephen kinginnocence losttypingtearchild smoking cigarettechased by a dogcorpse with eyes openkicked in the buttyounger brotherclimbing a fencefat boymale tearsoverhearing a conversationhearing noisescampfire storydrinking and drivingmarshmallowshortcutsleeping outsidereference to coca colasummertimechain link fencecombeating contestfishing rodyear 1959traumatic childhoodoverweight childolder brotherfoot racesobbingflick knifetoothpickfour friendstattoo on armbaseball cap worn backwardslistening to a car radiotin canreference to the lone rangerstore ownerstory within the storyfour best friendstoasting marshmallowsrailroad bridgeflipping a coinwalking on train trackslong walkwater canteenbottle of beerno trespassing signreference to donald ducksleeping on the groundargument between friendskilled by a trainplaying chickentripping overdoepinky swearrailroad trestlereference to abbott and costelloboy smoking a cigaretteclimbing over fencereading a comic booksitting on the floortrestlepez dispenserundressing selfwet underwearcigarette behind eardunking head in wateryankees baseball capgroup vomitmourning for sonportable radio.45 calibre pistoldrinking while drivingreference to mighty mouseaccidentally firing a gunblood on one's handblueberry piecrawling on hands and kneesfainting at the sight of bloodfeeling insultedgmc truckpie eating competitionreference to pluto the dogrunning on a bridgefainting boyhugging one's friendimitating the firing of a gunmuddy clothes (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Peter Pan (1953) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Peter Pan (1953)

An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.

Subgenre:
coming of age2d animationdisneyswashbuckler
Themes:
friendshipsurrealismkidnappingjealousyheromagicangerchildhoodmythology
Locations:
boatlondon englandseaenglandcavejunglecity of children
Characters:
boyfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother brother relationshipbrother sister relationshipgirllittle girlnative americanlittle boymermaid
Period:
1900s
Story:
based on novelcharacter name in titledogfighttitle spoken by characterbased on playdreamrescueswordbedislandgood versus evilorphansword fightmap β€¦journeycigar smokingprincessduelattempted murderumbrellarabbitfirst partwaterfallbearmonkeypiratecaptainflyingwoundlifting someone into the airblockbusterimpersonationteddy bearclockexplosivefairychild protagonistshadowpipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassesseagullcloudfantasy worldfriends who live togetheraltered version of studio logoskyoutlaw gangracial stereotyperaccoonhookpirate shiprhinocerosbig ben londonskunkhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandseashell bikinimagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All)

The Finest Hours (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Finest Hours (2016)

In February of 1952, one of the worst storms to ever hit the East Coast struck New England, damaging an oil tanker off the coast of Cape Cod and literally ripping it in half. On a small lifeboat faced with frigid temperatures and 70-foot high waves, four members of the Coast Guard set out to rescue  β€¦more than 30 stranded sailors trapped aboard the rapidly-sinking vessel. (Read More)

Subgenre:
tragedydisaster film
Themes:
friendshipdeathlovefearheroparanoiahopepaniccouragenear death experience
Mood:
against all odds
Locations:
fishing boatbarchurchsnowsmall townboatnightclubwaterpolice carseashipoceanstormnew englandstorm at sea β€¦singing on a boat (See All)
Characters:
fishermanmother son relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshiptough guysingle motherengineerfiance fiancee relationshipship captain
Period:
1950swinter
Story:
dancingphotographexplosionsingingpartysurprise endingbased on true storybased on bookcorpsecar accidentrescueslow motion scenesurvivalflashlightaxe β€¦widowdinermapno opening creditsradiounderwater scenesearchmarriage proposalflash forwardbinocularscharacter repeating someone else's dialoguedangerpay phonemissionrace against timelong takeautomobilesingle parentdisastercard gamedestructionwhat happened to epilogueheavy raincookphone boothjumping from heighthitchhikerhitchhikinghaunted by the pasttensionfloodbraveryitalian americanobesitypower outage3 dimensionallove at first sight3daerial shottitle at the endrainstormsailorpierdark pastrescue missionweathersouthern accentheroismlighthouseprayingfirst dateshipwreckno title at beginningredheaded womanblizzardaltered version of studio logomassachusettstragic pastdistrustportradarcompassgas explosionworld war two veteransnowstormbritish actor playing american charactercoast guardboiler roomtidal wavesearchlightsinking shiplifeboatcoastal townsearch and rescueyear 1952seamangiant waveemployee employee relationshipfreighteru.s. coast guardoil tankeryear 1951commanding officernorth atlanticyoung widowrejecting a marriage proposalman versus natureradio operatorassertive womanwoman proposes marriagecapsizing shipship run agroundsmall town america (See All)

The Guns Of Navarone (1961)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Guns Of Navarone (1961)

Two powerful German guns control the seas past the Greek island of Navarone making the evacuation of endangered British troops on a neighboring island impossible. Air attack is useless so a team of six Allied and Greek soldiers is put ashore to meet up with partisans to try and dynamite the guns. Th β€¦e mission is perilous enough anyway but are the Germans on the island getting further help too?. (Read More)

Subgenre:
martial artscult filmsuspense
Themes:
betrayaltortureweddingherodeceptionmilitary
Locations:
fishing boathospitalhotelmotorcycleboatvillageseacavegermanynazi germanyairplane accidentstorm at seasea battle
Characters:
brother sister relationshipsoldiertough guyaction heroprofessorsnipersniper rifle
Period:
world war two1940syear 1943
Story:
face slapbased on novelviolencegunkissfightexplosionsingingknifepistolvoice over narrationshootoutfistfightmachine gunbattle β€¦gunfightbrawlshowdownriflehand to hand combatbombplace name in titleinterrogationislandcombatswimmingambushmountaindisguiseambulancestabbingmontagemixed martial artssuicide attemptexploding cardisarming someoneprologuekaratewidowertough girltankmercenarysemiautomatic pistolsilencerbattlefieldeavesdroppingtraitorshavinghand grenadesabotageblockbusterbroken legcannonexplosiveresistancegreeceplanespecial forcesdynamitecommandocapturekarate chopwedding receptionwar crimeswastikaruinsgreekmonasteryfemale fighterwar herofirearmwar violencemajorsailboatcommando unitfortresscommando missionexploding truckbehind enemy linesamputationbayonetbritish armymilitary uniformmotorboatsubmachine gunjudofamous scorecommando raidtitle same as bookairfieldair raidaircraftdemolitionssadmiralvictorytommy gunresistance fighterfighter planemountain climbingcavernshoulder holsterexploding boatbattleshipnazi uniformseaplanejudo throwsharpshooterair strikeartilleryship wreckmortarsearchlightmountaineercar falling off a cliffbritish navyship sinkingalliesfalling over a cliffmp 40 machine gunsailtruth serumisland name in titlegangrenedestroyerexplosives expertclothes torn offss officerelectronics expertaegean seaclimbing a cliffamphibious landingfictional island (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Pirates Of The Caribbean: Dead Men Tell No Tales (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pirates Of The Caribbean: Dead Men Tell No Tales (2017)

Captain Jack Sparrow finds the winds of ill-fortune blowing even more strongly when deadly ghost pirates led by his old nemesis, the terrifying Captain Salazar, escape from the Devil's Triangle, determined to kill every pirate at sea...including him. Captain Jack's only hope of survival lies in seek β€¦ing out the legendary Trident of Poseidon, a powerful artifact that bestows upon its possessor total control over the seas. (Read More)

Themes:
murderrevengedrunkennessweddingdeath of father
Mood:
night
Locations:
beachboatseashipjunglecaribbeanghost shipship on fire
Characters:
boyfather son relationshiphusband wife relationshipfather daughter relationshipwitchyounger version of character
Story:
sailingface slapviolencesequelflashbackfighttitle spoken by characterchasehorsebattlebookriflejailbritishisland β€¦candlemapcurseskeletonbankhangingdiaryhorse ridingtied upundeadmonkeypirateclaim in titlebeardsharktorchcannonbarefootrowboatdead manlanternchainfifth partsmokecrowdimprisonmentmudsunsetastronomypocket watchartifactbayonetpalm treeprison breakrooffather son reunionwaking updreadlockswavecompassguillotinecryptrewardbandanarowingbank vaultchestharpoondawneyepatchastronomerexecutioneranchorshorebell towerpiracyrubytridenttidecannonballabysssideburnscoralsailhorticultureropespeg legsabership in a bottlestairhammerhead sharkforced weddingpirate flagreturn to liferudderscabies (See All)

Manchester By The Sea (2016) is one of the best movies like Captains Courageous (1937)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Manchester By The Sea (2016)

Lee Chandler is a brooding, irritable loner who works as a handyman for a Boston apartment block. One damp winter day he gets a call summoning him to his hometown, north of the city. His brother's heart has given out suddenly, and he's been named guardian to his 16-year-old nephew. As if losing his  β€¦only sibling and doubts about raising a teenager weren't enough, his return to the past re-opens an unspeakable tragedy. (Read More)

Themes:
friendshipdeathpregnancydrinkingdrunkennessfuneralmemorydeath of fatherdepressiongriefadoptiondeath of daughter
Mood:
high school
Locations:
fishing boathospitalbarsnowboat
Characters:
husband wife relationshipmother son relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipdoctorbrother brother relationshipteenage girlteenage boychristianlittle girlcatholicuncle nephew relationshipbaby boy β€¦alcoholic mothergirl in underwear (See All)
Period:
2010s
Story:
fishingbloodflashbackbare chested malefightphotographpantiesfirecryingfooddrinkbeerdead bodyreference to jesus christf word β€¦braambulancewomaneatingsuicide attemptnonlinear timelinegraveyardpainflash forwardblack pantiescity name in titledeath of brotherhigh school studentdeath of sonloss of fatherteenage sexcoachbeer drinkingmorguecrying womanaccidental deathlosscrying manburialbar fightmale underwearbra and pantieshaunted by the pastjanitorbloody noseboxer shortsattempted suicideboston massachusettsice hockeyrefrigeratorloss of brotherunclelocation in titleman cryinggirl in bra and pantieshit in the facelast will and testamentdead children16 year oldteenage sexualityawkwardnessguardianbereavementmassachusettsdumpsterteenage girl in underwearhandymanhouse firepanic attackfemale editornephewburning houseman undressingmother son reunionheart conditionlooking for a jobcold the temperaturereference to star trekboatinggirl in braactor shares last name with characterteen sexualityfishing poleplumbingguilt riddenawkward silenceheart failureteen sexclogged toiletengine troubleshovelling snowfacial woundcrying teenage boycustodianteenage bandfrozen chickendestroyed by fireleaking waterdestroyed homeloss of children (See All)

Funny Games (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Funny Games (2007)

In this English-language remake of a deconstruction in the way violence is portrayed in the media, a family settles into its vacation home, which happens to be the next stop for a pair of young, articulate, white-gloved serial killers on an excursion through the neighborhood.

Subgenre:
independent filmpost modern
Themes:
murderdeathkidnappingvoyeurismpsychopathinsanityhumiliationhome invasionmurder of family
Mood:
breaking the fourth wallhorror movie remake
Locations:
kitchen
Characters:
boyfamily relationshipshusband wife relationshipserial killerhostage
Story:
sailingface slapbloodviolencebondagedogknifechasesurprise endingpantiescryingcell phonecorpseshot to deathblood splatter β€¦shot in the chestremakeshot in the headshotgunvomitingvoyeurprayertelevisioncleavagebound and gaggedstabbed to deathwhite pantiesscantily clad femaleacronym in titlechild in perillooking at the cameradrowningtalking to the camerapainproduct placementlong takefemale removes her clothestied upgirl in pantiesmaniackilling an animalnipples visible through clothingeggsociopathlifting someone into the aircaptivesocial commentarybroken legremote controlball gagpunched in the stomachdark humorhousewifemurder of a childtitle at the endbettied feetbroken armduct tapedead dogbarking dogbag over headforced to stripdockdead animalfemale removes her dressdead childrengolf clubsailboatdegradationdouble barreled shotgunmind gameteasingwetting pantsupper classwoman in lingeriecountry housetied up while barefootpsychological torturewoman smokerleg woundcat and mousebloody body of a childeggsglovechild with a gunno survivorshair dryerchild killergolden retrieverraincoatgolf ballcarpetpliersgolferno musicduct tape gaghit with a golf clubmurderer duoremake by original directorlifting a male into the airchain link fencechild shot in the headsummer houseweird behaviorwading in waterrewindcar stereoanti violencerandom violencebroken eggsail boatbound hand and footwire cuttersleg splintmurdered pet (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Captains Courageous?
<< FIND THEM HERE! >>