Please wait - finding best movies...
The housewife Claire Cooper is married with the pilot Paul Cooper and their little daughter Rebecca is their pride and joy. When a stranger kidnaps a girl, Claire dreams about the man but Detective Jack Kay ignores her concerns. But when Rebecca disappears during a school play, Claire learns that he β¦r visions were actually premonitions and she is connected to the killer through her dreams. She has a nervous breakdown and tries to commit suicide. Her psychologist Dr. Silverman sends her to a mental institution and soon she finds that her husband will be the next victim of the serial-killer. Further, the serial-killer was interned in the same cell in the hospital where she is. Will Claire be able to save Paul? (Read More)
Themes: | mental illnessinsanitymurder |
Mood: | nightmare |
Locations: | truckkitchenwaterhelicopterhotelforesthospital |
Characters: | serial killerpsychiatristpolice detectivekillerfemale protagonistdoctor |
Story: | psychic linkdead body floating in waterunderwater townheroine diesslit wriststongue rippingpadded cellsedationdeath of main characterwoman drownedreservoirsnow whitesedativeescaped mental patientpsychiatric hospital β¦school playclairvoyanthitchcockianredsplit personalitydead childrenmental breakdowndragstabbed in the eyechaindeath of protagonistdaydreamvisionmental institutiondivingapplerealitytied to a bedchild murdersyringepsychicinjectiondrowningunderwater scenedrawingsuicide attemptbound and gaggedcomputerdreamcigarette smokingbased on noveltwo word titledogblood (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Themes: | mental illnessinsanitymurder |
Mood: | nightmare |
Locations: | hospital |
Characters: | serial killerpsychiatristkillerfemale protagonistdoctor |
Story: | sedativepsychiatric hospitalmental breakdownmental institutionsyringeinjectionunderwater scenesuicide attemptcomputerdreamblood |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | hospital |
Characters: | serial killerpsychiatristkillerdoctor |
Story: | sedativepsychiatric hospitalstabbed in the eyetied to a bedsuicide attemptdreamcigarette smoking |
A psychic doctor, John Clancy (Sir Anthony Hopkins), works with an F.B.I. Special Agent (Jeffrey Dean Morgan) in search of serial killer Charles Ambrose (Colin Farrell). After having lived in isolation for two years, since the death of his daughter, Clancy is asked by his friend Joe, an F.B.I. Speci β¦al Agent to help him solve several murders committed by a serial killer. The problem is that Ambrose is also psychic, and far ahead of Clancy. (Read More)
Themes: | murder |
Locations: | hotelhospital |
Characters: | serial killerkillerdoctor |
Story: | clairvoyantvisionchild murderpsychicblooddog |
A thought-provoking and haunting exploration of how reality and dream-states may combine to form complex interactions. The line between the imagination and reality blurs when an accomplished Psychiatrist takes on a patient that appears to be suicidal.
Themes: | mental illness |
Mood: | nightmare |
Characters: | psychiatrist |
Story: | mental institutionrealitysyringepsychicunderwater scenedrawingsuicide attemptdreamcigarette smokingdogblood |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
Themes: | mental illnessinsanity |
Mood: | nightmare |
Characters: | female protagonist |
Story: | slit wristssplit personalitymental institutionchild murdersyringedrowningcigarette smokingblood |
It's 1954, and up-and-coming U.S. marshal Teddy Daniels is assigned to investigate the disappearance of a patient from Boston's Shutter Island Ashecliffe Hospital. He's been pushing for an assignment on the island for personal reasons, but before long he wonders whether he hasn't been brought there β¦as part of a twisted plot by hospital doctors whose radical treatments range from unethical to illegal to downright sinister. Teddy's shrewd investigating skills soon provide a promising lead, but the hospital refuses him access to records he suspects would break the case wide open. As a hurricane cuts off communication with the mainland, more dangerous criminals "escape" in the confusion, and the puzzling, improbable clues multiply, Teddy begins to doubt everything - his memory, his partner, even his own sanity. (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | hospital |
Characters: | serial killerpsychiatristdoctor |
Story: | sedativeescaped mental patientdead childrenchainmental institutionchild murdersyringeinjectiondrawingdreamcigarette smokingbased on noveltwo word titleblood |
After the death of her ill mother in a fire, the young teenager Anna tries to commit suicide and is sent to a mental institution for treatment. Ten months later, Anna still cannot remember what had happened on the night her mother died. Her psychiatric Dr. Silberling, however, discharges her telling β¦ that she has resolved her issues. Her father and successful writer, Steven, brings her back home in an isolated mansion nearby the coast. Anna finds that her mother's former nurse, Rachel Summers, is her stepmother now. Anna meets her beloved sister, Alex, swimming in the sea. She discovers that Steven has not delivered the letters and CDs that Alex had sent to her. As time moves on, Anna is haunted by ghosts and she believes that Rachel killed her mother. Alex and Anna decide to look for evidence to prove that Rachel is the murderer and Anna discovers the truth about the fire in the boat house. (Read More)
Themes: | mental illnessmurder |
Mood: | nightmare |
Locations: | forest |
Characters: | psychiatristfemale protagonist |
Story: | slit wristssplit personalityvisionmental institutionchild murdersyringeinjectiondreamblood |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Themes: | mental illnessinsanitymurder |
Locations: | kitchenforest |
Characters: | serial killerpsychiatristkillerdoctor |
Story: | split personalitymental breakdowninjectiondrawingcomputerblooddog |
Death stalks the dreams of several young adults to claim its revenge on the killing of Freddy Kruger. Chased and chastised by this finger-bladed demon, it is the awakening of old memories and the denials of a past of retribution that spurns this hellish vision of a dreamlike state and turns death in β¦to a nightmare reality. (Read More)
Themes: | murder |
Mood: | nightmare |
Locations: | hospital |
Characters: | killer |
Story: | stabbed in the eyevisionrealitysyringedrawingdreamdogblood |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Themes: | murder |
Locations: | truckhospital |
Characters: | serial killerpsychiatristdoctor |
Story: | death of protagonistvisionchild murderpsychicdrowningunderwater scenedreambased on novelblood |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β¦p her from constantly getting visions of Jessica's fate. (Read More)
Themes: | mental illnessmurder |
Mood: | nightmare |
Locations: | water |
Story: | clairvoyantmental breakdownchainpsychicunderwater scenedreamtwo word titleblooddog |
In 1966, in North Bend, Oregon, the runaway Kristen is captured by the police after burning down a farmhouse and is locked in the North Bend Psychiatric Hospital. Kristen is introduced to Dr. Gerald Stringer, who uses experimental therapy. Then she meets the inmates Emily, Sarah, Zoey and Iris and t β¦he tough nurse Lundt. During the night and in the shower later, Kristen sees the ghost of a woman and she learns that she is Alice Leigh Hudson, a mysterious wicked intern that has disappeared. When Iris is ready to go home, she is attacked by the ghost of Alice in the basement and murdered. She vanishes and the inmates decide to seek Iris out. Then Sarah is abducted by the Alice and also killed; the next one is Emily. Meanwhile Kristen escapes from her room and meets Zoey, expecting to protect her. However, Zoey is kidnapped by Alice and Kristen runs to Dr. Stringer's office. She snoops his desk and finds a report with the truth about Alice. (Read More)
Themes: | mental illnessmurder |
Locations: | water |
Characters: | psychiatristfemale protagonistdoctor |
Story: | sedativeescaped mental patientpsychiatric hospitalsplit personalitysyringeinjectiondrawingtwo word titleblood |
The night he retires as a Nevada sheriff, Jerry Black pledges to the mother of a murdered girl that he will find the killer. Jerry doesn't believe the police arrested the right man; he discovers this is the third incident in the area in the recent past with victims young, blond, pretty, and small fo β¦r their age. So he buys an old gas station in the mountains near the crimes in order to search for a tall man who drives a black station wagon, gives toy porcupines as gifts, and calls himself the wizard: clues from a drawing by the dead girl. Jerry's solitary life gives way to friendship with a woman and her small, blond daughter. Has Jerry neglected something that may prove fatal? (Read More)
Themes: | insanitymurder |
Characters: | serial killerkiller |
Story: | split personalitydead childrenchild murderdrawingcigarette smokingbased on novelblood |
McMurphy has a criminal past and has once again gotten himself into trouble and is sentenced by the court. To escape labor duties in prison, McMurphy pleads insanity and is sent to a ward for the mentally unstable. Once here, McMurphy both endures and stands witness to the abuse and degradation of t β¦he oppressive Nurse Ratched, who gains superiority and power through the flaws of the other inmates. McMurphy and the other inmates band together to make a rebellious stance against the atrocious Nurse. (Read More)
Themes: | mental illnessinsanity |
Locations: | helicopter |
Characters: | doctor |
Story: | escaped mental patientpsychiatric hospitaldeath of protagonistmental institutionsuicide attemptcigarette smokingbased on novelblood |
An unknown and lethal virus has wiped out five billion people in 1996. Only 1% of the population has survived by the year 2035, and is forced to live underground. A convict (James Cole) reluctantly volunteers to be sent back in time to 1996 to gather information about the origin of the epidemic (who β¦ he's told was spread by a mysterious "Army of the Twelve Monkeys") and locate the virus before it mutates so that scientists can study it. Unfortunately Cole is mistakenly sent to 1990, six years earlier than expected, and is arrested and locked up in a mental institution, where he meets Dr. Kathryn Railly, a psychiatrist, and Jeffrey Goines, the insane son of a famous scientist and virus expert. (Read More)
Themes: | mental illnessinsanitymurder |
Mood: | nightmare |
Locations: | hospital |
Characters: | psychiatrist |
Story: | sedativeescaped mental patientpsychiatric hospitalmental breakdownmental institutiontied to a beddreamtwo word titleblood |
A young man transporting a car to another state is stalked along the road by a cunning and relentless serial killer who eventually frames the driver for a string of murders. Chased by police and shadowed by the killer, the driver's only help comes from a truck stop waitress.
Themes: | murder |
Locations: | truckhelicopter |
Characters: | serial killerkiller |
Story: | suicide attemptbound and gaggedtwo word titleblood |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Themes: | insanitymurder |
Characters: | serial killerkiller |
Story: | stabbed in the eyeblood |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j β¦ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Themes: | insanitymurder |
Locations: | hotelhospital |
Characters: | serial killerpolice detectivekillerdoctor |
Story: | bound and gagged |
SPOILER: Jang Kyung-chul (Choi Min-sik) is a dangerous psychopath serial killer. He has committed infernal serial murders in diabolic ways that one cannot even imagine and his victims range from young women to even children. The police have chased him for a long time, but were unable to catch him. O β¦ne day, Joo-yeon, daughter of a retired police chief becomes his prey and is found dead in a horrific state. Her fiance Soo-hyun (Lee Byung-hun), a top secret agent, decides to track down the murderer himself. He promises himself that he will do everything in his power to take bloody vengeance against the killer, even if it means that he must become a monster himself to get this monstrous and inhumane killer. (Read More)
Themes: | insanitymurder |
Locations: | foresthospital |
Characters: | serial killerpolice detectivekiller |
Story: | chainbound and gaggedcigarette smokingblooddog |
Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen β¦ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)
Themes: | mental illness |
Mood: | nightmare |
Locations: | kitchenhotelhospital |
Characters: | psychiatristfemale protagonistdoctor |
Story: | sedativehitchcockiansyringeinjectiondrawingdreamcigarette smokingbased on novelblood |
On his birthday, Walter Sparrow, an amiable dog-catcher, takes a call that leaves him dog bit and late to pick up his wife. She's browsed in a bookstore, finding a blood-red-covered novel, a murder mystery with numerology that loops constantly around the number 23. The story captivates Walter: he dr β¦eams it, he notices aspects of his life that can be rendered by "23," he searches for the author, he stays in the hotel (in room 23) where events in the novel took place, and he begins to believe it was no novel. His wife and son try to help him, sometimes in sympathy, sometimes to protect him. Slowly, with danger to himself and to his family, he closes in on the truth. (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | hotelhospital |
Characters: | psychiatristdoctor |
Story: | reddaydreammental institutiondreamcigarette smokingdogblood |
Themes: | murder |
Mood: | nightmare |
Locations: | waterhospital |
Characters: | psychiatrist |
Story: | mental institutionappledrowningcomputerdreambased on noveldogblood |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | truckforesthospital |
Characters: | serial killerkillerfemale protagonist |
Story: | child murderbound and gaggeddreamcigarette smokingblooddog |
Earl Brooks is a highly respected businessman and was recently named Portland's Man of the Year. He hides a terrible secret however: he is a serial killer known as the Thumbprint Killer. He has been attending AA meetings and has kept his addiction to killing under control for two years now but his a β¦lter ego, Marshall, has re-appeared and is pushing him to kill again. When he does kill a couple while they are making love, he is seen and photographed by someone who also has his own death and murder fetish. In a parallel story, the police detective investigating the murder is having problems of her own. She is going through a messy divorce and a violent criminal who had vowed revenge some years before has escaped from prison and is after her. (Read More)
Themes: | murder |
Mood: | nightmare |
Locations: | kitchenhotelhospital |
Characters: | serial killerpolice detectivekillerdoctor |
Story: | split personalitycomputerdreamblood |
John Murdoch awakens alone in a strange hotel to find that he has lost his memory and is wanted for a series of brutal and bizarre murders. While trying to piece together his past, he stumbles upon a fiendish underworld controlled by a group of beings known as The Strangers who possess the ability t β¦o put people to sleep and alter the city and its inhabitants. Now Murdoch must find a way to stop them before they take control of his mind and destroy him. (Read More)
Themes: | insanitymurder |
Locations: | waterhotelhospital |
Characters: | serial killerpsychiatristpolice detectivedoctor |
Story: | syringeinjectiondrawingdreamcigarette smokingblood |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Themes: | insanitymurder |
Locations: | truckkitchenwaterhospital |
Characters: | serial killerpsychiatristkillerdoctor |
Story: | redpsychicdrowningdrawingcigarette smokingtwo word titleblood |
On a remote island, the FBI has a training program for their psychological profiling division, called "Mindhunters", used to track down serial killers. The training goes horribly wrong, however, when a group of seven young agents discover that one of them is a serial killer, and is setting about sla β¦ying the others. Can the few that are left figure out who the killer is in time? (Read More)
Themes: | murder |
Locations: | kitchenhelicopter |
Characters: | serial killerkiller |
Story: | drowningunderwater scenecomputercigarette smokingblood |
Evan Treborn grows up in a small town with his single, working mother and his friends. He suffers from memory blackouts where he suddenly finds himself somewhere else, confused. Evan's friends and mother hardly believe him, thinking he makes it up just to get out of trouble. As Evan grows up he has β¦fewer of these blackouts until he seems to have recovered. Since the age of seven he has written a diary of his blackout moments so he can remember what happens. One day at college he starts to read one of his old diaries, and suddenly a flashback hits him like a brick! (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | hotelforesthospital |
Characters: | psychiatrist |
Story: | sedationmental institutionunderwater scenedrawingsuicide attemptdreamcigarette smokingblooddog |
Unable to cope with reality and the difficulty that comes with it, 18 year old Susanna, is admitted to a mental institution in order to overcome her disorder. However, she has trouble understanding her disorder and therefore finds it difficult to tame, especially when she meets the suggestive and un β¦predictable Lisa. (Read More)
Themes: | mental illnessinsanity |
Characters: | psychiatristfemale protagonistdoctor |
Story: | mental institutionrealitysuicide attemptcigarette smoking |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Themes: | murder |
Mood: | nightmare |
Locations: | truckwaterhospital |
Characters: | serial killer |
Story: | sedativepsychiatric hospitalstabbed in the eyeinjectiondreamblood |
John and Laura Baxter are in Venice when they meet a pair of elderly sisters, one of whom claims to be psychic. She insists that she sees the spirit of the Baxters' daughter, who recently drowned. Laura is intrigued, but John resists the idea. He, however, seems to have his own psychic flashes, seei β¦ng their daughter walk the streets in her red cloak, as well as Laura and the sisters on a funeral gondola. (Read More)
Themes: | mental illnessmurder |
Locations: | waterhotelhospital |
Characters: | serial killer |
Story: | reddeath of protagonistpsychicdrowningcigarette smokingblood |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | forest |
Characters: | serial killerkiller |
Story: | escaped mental patientpsychiatric hospitalchild murderdrowningunderwater scenedreamblood |
A well respected Chicago surgeon Dr. Richard Kimble has found out that his wife, Helen, has been murdered ferociously in her own home. The police found Kimble and accused him of the murder. Then, Kimble (without Justifiable Reason) was tried, convicted, and sentenced to death. However, on the way to β¦ prison, Kimble's transport crashed. Kimble escapes and is now on the run. Deputy Samuel Gerard from Chicago takes charge of the chase of Kimble. Meanwhile, Kimble takes up his own investigation to find who really killed his wife, and to lure Gerard and his team into it as well. (Read More)
Themes: | murder |
Locations: | helicopterhotelforesthospital |
Characters: | serial killerpsychiatristpolice detectivedoctor |
Story: | hitchcockianinjectioncomputerdreamcigarette smokingblood |
Signing a contract, Jack Torrance, a normal writer and former teacher agrees to take care of a hotel which has a long, violent past that puts everyone in the hotel in a nervous situation. While Jack slowly gets more violent and angry of his life, his son, Danny, tries to use a special talent, the "S β¦hining", to inform the people outside about whatever that is going on in the hotel. (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | kitchenhelicopterhotel |
Characters: | doctor |
Story: | child murderpsychictwo word titlebased on novelblood |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath β¦ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
Themes: | insanitymurder |
Locations: | helicopterhospital |
Characters: | serial killerpolice detectivekiller |
Story: | hitchcockiantied to a bedblooddog |
Famous symbologist on a trail of clues tied to the great Dante himself. When Langdon wakes up in an Italian hospital with amnesia, he teams up with Sienna Brooks, a doctor he hopes will help him recover his memories. Together, they race across Europe and against the clock to stop a madman from unlea β¦shing a global virus that would wipe out half of the world's population. (Read More)
Themes: | murder |
Mood: | nightmare |
Locations: | waterhelicopterhotelhospital |
Characters: | doctor |
Story: | visioninjectiondrowningunderwater scenebased on noveldogblood |
A group of thieves steal a rare gem, but in the process, two of the men double cross the leader of the thieving group, Patrick, and take off with the precious stone. Ten years later, prominent psychiatrist Nathan Conrad is invited to examine a disturbed young woman named Elisabeth. Patrick immediate β¦ly kidnaps Nathan's daughter, forcing Nathan to attempt to get Elisabeth to reveal a secret number which will ultimately lead Patrick to the whereabouts of the precious gem that has eluded him. (Read More)
Themes: | insanitymurder |
Characters: | psychiatristpolice detective |
Story: | psychiatric hospitalmental institutionsyringeinjectiondrawingcigarette smokingbased on noveldogblood |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | waterhospital |
Characters: | serial killerkillerfemale protagonistdoctor |
Story: | mental institutionunderwater scenedrawingdreamblood |
An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.
Themes: | insanitymurder |
Mood: | nightmare |
Locations: | hospital |
Characters: | serial killerdoctor |
Story: | divingdrowningunderwater scenecigarette smokingbased on noveltwo word titledogblood |
While taking a shower, Kate Miller, a middle-aged, sexually frustrated New York City housewife, has a rape fantasy while her husband stands at the sink shaving. Later that day, after complaining to her psychiatrist Dr. Robert Elliott about her husband's pathetic performance in bed, she meets a stran β¦ge man at a museum and returns to his apartment where they continue an adulterous encounter that began in the taxicab. Before she leaves his apartment, she finds papers which certify that the man has a venereal disease. Panicked, Kate rushes into the elevator, but has to return to his apartment when she realizes she's forgotten her wedding ring. When the elevator doors open, she's brutally slashed to death by a tall blonde woman wearing dark sunglasses. Liz Blake, a high-class call girl, is the only witness to the murder and she becomes the prime suspect and the murderess's next target. Liz is rescued from being killed by Kate's son Peter, who enlists the help of Liz to catch his mother's killer as Detective Marino who's in charge of the case is uncooperative in the investigation. (Read More)
Themes: | mental illnessmurder |
Mood: | nightmare |
Locations: | water |
Characters: | serial killerpsychiatristpolice detectivekiller |
Story: | hitchcockiansplit personalitymental breakdown |
Dr. Constance Petersen (Ingrid Bergman) is a psychiatrist at Green Manors mental asylum. The head of Green Manors has just been replaced, with his replacement being the renowned Dr. Anthony Edwardes (Gregory Peck). Romance blossoms between Dr. Petersen and Dr. Edwards but Dr. Edwards starts to show β¦odd aversions and personality traits. It is discovered that he is an impostor, and amnesiac, and may have killed the real Dr. Edwardes. Dr. Petersen is determined to discover the truth through unlocking the secrets held in the impostor's mind, a process which potentially puts her and others' lives at risk. (Read More)
Themes: | mental illnessmurder |
Locations: | hotel |
Characters: | psychiatristpolice detectivekillerdoctor |
Story: | sedativepsychiatric hospitaldreamcigarette smokingbased on novel |
The Mantle brothers are both doctors - both gynecologists - and identical twins. Mentally however, one of them is more confident than the other, and always manages to seduce the women he meets. When he's tired of his current partner, she is passed on to the other brother - without her knowing. Every β¦thing runs smoothly, until an actress visits their clinic, and the shy brother is the first to fall in love. Will they be able to 'share' her ? (Read More)
Themes: | mental illnessmurder |
Mood: | nightmare |
Locations: | hotelhospital |
Characters: | doctor |
Story: | mental breakdownsyringeinjectioncomputerdreambased on noveltwo word titleblood |
Detective Sergeant Tom Brant who is dispatched to take down a serial killer hell bent on killing off the police force one by one. "The Blitz" manages to slip through the grasp of Tom every time, and with the precious lives of his colleagues diminishing one by one, Tom is led to the question: if we c β¦an't protect our own, then what good are we? (Read More)
Themes: | murder |
Characters: | serial killerpolice detectivekiller |
Story: | drowningcomputercigarette smokingbased on noveldogblood |
Catharine Deane is a psychotherapist who is part of a revolutionary new treatment which allows her mind to literally enter the mind of her patients. Her experience in this method takes an unexpected turn when an FBI agent comes to ask for a desperate favour. They had just tracked down a notorious se β¦rial killer, Carl Stargher, whose MO is to abduct women one at a time and place them in a secret area where they are kept for about 40 hours until they are slowly drowned. Unfortunately, the killer has fallen into an irreversible coma which means he cannot confess where he has taken his latest victim before she dies. Now, Catherine Deane must race against time to explore the twisted mind of the killer to get the information she needs, but Stargher's damaged personality poses dangers that threaten to overwhelm her. (Read More)
Themes: | mental illness |
Locations: | waterhelicopter |
Characters: | serial killerpsychiatristkiller |
Story: | drowningdogblood |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Themes: | murder |
Locations: | kitchenforest |
Characters: | serial killerpsychiatristkiller |
Story: | mental institutionrealitycomputertwo word titleblood |
In this English-language remake of a deconstruction in the way violence is portrayed in the media, a family settles into its vacation home, which happens to be the next stop for a pair of young, articulate, white-gloved serial killers on an excursion through the neighborhood.
Themes: | insanitymurder |
Locations: | kitchen |
Characters: | serial killer |
Story: | dead childrendrowningbound and gaggeddogblood |
Mima leaves the idol group CHAM, in order to pursue her dream as an actress. Mima climbs up the rocky road to success by performing as rape victims and posing nude for magazines, but is haunted by her reflections of the past.
Themes: | mental illnessinsanitymurder |
Characters: | female protagonist |
Story: | split personalitystabbed in the eyerealitydreambased on novelblood |
In San Francisco, the criminal psychologist Helen Hudson is specialized in serial-killers. During a trial, the accused Daryll Lee Cullum kills a police officer and tries to kill her and she becomes agoraphobic. Now Helen lives a reclusive life with her gay friend Andy that helps her. Sometime later, β¦ there is a wave of crimes and Detectives M.J. Monahan and Reuben Goetz are investigating the murder cases. Helen identifies that the murderer is copycatting notorious serial-killers and she anonymously contacts the Police Department. After fourteen phone calls, she is identified by the police. Detectives M.J. and Reuben visit her and Helen teams up with them and prepares the profile of the killer that wants to be famous. But soon the copycat killer Peter Foley contacts and stalks Helen and M.J. and Reuben give protection to her. Will they be capable to stop Foley before the next murder? (Read More)
Themes: | murder |
Characters: | serial killerpolice detectivekillerfemale protagonist |
Story: | injectionbound and gaggedcomputerblood |
Det. John Hobbes is convinced that when killer Edgar Reese is executed, all of his troubles are over. But when people he knows and people on the street start to sing the same tune that Reese sang in the gas chamber, and those same people taunt him, he is told that maybe the cursed fallen angel Azaze β¦l is behind it all. Azazel is cursed to roam the Earth without a form, and he can switch bodies by any contact, making him hard to track. When Hobbes is forced to kill a man possessed by Azazel, he must clear his name while protecting his family and others from the evil, vengeful Azazel. (Read More)
Themes: | insanitymurder |
Locations: | forest |
Characters: | serial killerpolice detectivekiller |
Story: | death of protagonistsyringeinjectioncomputercigarette smokingblooddog |