Best popular movies like Looking For Eric:

Do you need specific genre & keyword selection to find films similar to Looking For Eric?
<< FIND THEM HERE! >>

Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Looking For Eric (2009)

Eric Bishop, a middle-aged postman working for the Manchester sorting office, is going through a dreadful crisis. For starters, his second life companion has not resurfaced although she was released from prison a few months ago. He is left alone with two stepsons to look after, which is no bed of ro …ses since the two teens disrespect him and keep disobeying him. To make matters worse, Ryan, the older boy, fascinated by Zac, a dangerous gangster, has accepted to hide his gun in Eric's house. On the other hand, he is asked by Sam, his student daughter who has a newborn baby, to get back in touch with Lily, his separated wife. Now, Eric left her not long after she gave back to their daughter. As a result Eric panics... Having lost all his bearings, Eric Bishop soliloquizes face to the poster of his idol, another Eric, French footballer Eric Cantona, when the latter appears just like the genie out of Aladdin's lamp. Through a series of aphorisms peculiar to him, the footballer-philosopher will help remorse-ridden desperate Eric Bishop to get by. (Read More)

Themes:
dysfunctional familymemorygangsterdrugsfriendship
Locations:
kitchenbicyclebuscarhospital
Characters:
baby girlold loveself helpself confidenceself pitystepfather stepson relationshipself esteempolice arrestself discoverysingle fatherex husband ex wife relationshipsingle motherbabyfriendfather daughter relationship …family relationships (See All)
Story:
british soccermanchester unitedpaintball gunmail deliveryreference to youtubesoccer starsoccer fansoccer playerimaginary friendcar accidenthit on the head with a gunhit with a gunfictional character based on real life personreference to gordon ramsaytelevision smashing …champions leagueenglish premier leaguereference to sammy davis jr.pair of shoesson hits fatherreference to jack nicholsonreference to nelson mandelaconfronting the pastpast catching upinterracial familylife coachpolice bustreference to fidel castropostal workerhidden gunsuicide contemplationsackreference to gandhihoodlummanchesterreference to frank sinatrafamily abandonmentrottweilergranddaughterdaydreamingdance contestgoalpanic attackfather son conflictsolidaritygang leaderpaintballtelevision settrunkhiding placepost officepillowmailmanjumpingbased on real personbabysittingpostmantrumpetmaillost lovepostcardreference to elvis presleyposterbulletproof vestgrandfatherhaunted by the pastfriendship between menyoutubeworking classgroup of friendsjogginghuggingsingle parentpubrock 'n' rollcollege studentbaseball batdrivingjokecookingsoccerbritishmarijuanarunningmaskwatching tvunderwearcryingpartysingingphotographdancingcharacter name in titlegunblooddogflashback (See All)

Bend It Like Beckham (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bend It Like Beckham (2002)

A comedy about bending the rules to reach your goal, Bend It Like Beckham explores the world of women's football, from kick-abouts in the park to freekicks in the Final. Set in Hounslow, West London and Hamburg, the film follows two 18 year olds with their hearts set on a future in professional socc …er. Heart-stopping talent doesn't seem to be enough when your parents want you to hang up your football boots, find a nice boyfriend and learn to cook the perfect chapatti. (Read More)

Subgenre:
coming of ageteen movietv sports programsoccer movie
Themes:
friendshipmarriagereligionjealousypregnancydrinkingdanceweddingdeceptiontravelracismparanoia
Mood:
archive footage
Locations:
cartrainhotelairplanenightclublondon englandairportenglandgermany
Characters:
friendfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipteenage girlteenage boystudentdancersister sister relationshiplove trianglegay friend …mother in law daughter in law relationship (See All)
Story:
british soccersoccer starsoccer fansoccer playergoaljumpingpostercookingsoccerrunningwatching tvunderwearcryingpartydancing …character name in titlef ratedkissfighttitle spoken by characterpantiestelephone callfirecell phonetitle directed by femalefoodcameradrinklietearslingeriebedprayersubjective cameracleavagebedroombravideo cameramontagehouseimmigrantsubwayritualracial slurstrippinglocker roomfantasy sequencescene during end creditsuniversityscarsadnessstrong female charactertwenty somethingcoachcloseted homosexualtraditiondiscodressinjurytempleculture clashstrong female leadinterracial friendshipcelebrationshoesteamhit in the crotchkickingnewsreel footageshoppingdiscriminationliving roomlaughingethnic slurbenchwedding receptionrefereet shirtjoyunderdogceremonywomen's rightsbloopers during creditsimperative in titleshortssports teamescalatorhindutomboydance clubgeneration gapteenage daughtercricket the gamescholarshipshirtfashion modeltv studiomarriage engagementhamburg germanymatchsoccer ballsoccer matchpark benchbechdel test passedcultural differencemulticulturalracial discriminationvictorybride and groomveilcanceled weddinghinduismsikhdefeatsoccer footballmusclesoccer teamasian indianteenage angstfoosballsit upssoccer coachinterracial lovepunjabibritish asiangoalkeeperlondon undergroundfake illnessburn scarindian pakistanisoccer goalburn injuryracist insultwedding invitation360 degree well shotlebanesenubile womanfashion magazinesports bragirls' soccersports announcerlingerie storepenalty kicksarireference to george michaelwomen's soccerbridal showerbandstandfamily traditionsbritish indiansoccer trainingkneehit with a ballrubbing nosessoccer practicesuspected lesbianwater sprinklerbroken marriage engagementanglo indiangoal keeperletter of acceptancewest london (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Fish Tank (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fish Tank (2009)

Mia, an aggressive fifteen-year-old girl, lives on an Essex estate with her tarty mother, Joanne, and precocious little sister Tyler. She has been thrown out of school and is awaiting admission to a referrals unit and spends her days aimlessly. She begins an uneasy friendship with Joanne's slick boy …friend, Connor, who encourages her one interest, dancing. (Read More)

Subgenre:
music videocoming of agefish out of waterteen movie
Themes:
dysfunctional familyfriendshipinfidelitymoneyadulterydrinkingdrunkennessextramarital affairtheftunfaithfulnessabduction
Mood:
rainhip hopambiguous ending
Locations:
kitchencartrainurban settingapartmentlaketrain stationsinging in a car
Characters:
single motherfamily relationshipsteenagermother daughter relationshipboyfriend girlfriend relationshipchildrentattooteenage girlteenage boygirldancersister sister relationshipthieflittle girlolder man younger woman relationship …alcoholic motherdaughter seeing mother have sex (See All)
Period:
2000s
Story:
rottweilerdance contestposteryoutubeworking classhuggingsingle parentdrivingcookingrunningwatching tvunderwearcryingpartysinging …photographdancingdogsexfemale nudityf ratednuditymale nuditybare chested malekissfemale rear nudityfightcigarette smokingpantiestelephone callcell phonetitle directed by femalebeatingsex on couchhorsemirrorurinationface slapslow motion scenedrinkarrestundressingbare buttbeertearssunglassesanimal in titlevoyeurrivertelevisionsubjective camerabedroomflashlightvideo camerainternetfishwhite pantieschild abusespankingvirginscreamingsuburbauditionsleepinggirl in pantiesteen angsthead buttbreaking and enteringwarehouseballoonloss of virginitylistening to musicsexual attractionrecordingstealingstreet lifeapartment buildingbarefoottensionbloody noserap musicthundercouchunderage drinkingconvenience storebalconyswingsocial workerlooking at self in mirrorsunbathingparking lotvodkatriple f ratedgatejunkyardbandagegerman shepherdwalletfencelooking out a windowdouble lifetrailer homeclimbing through a windowponytail15 year oldunconsciousnessteenage daughtercdmailboxactual animal killedwindmillteenage crushgame playingsex with a minorwatching a videorescue from drowningundressing someoneteenage girl in underwearhoodieswingingtrespassingchild abductionpackingsleeping on a couchdiyguard dogoverhearing sexabusive motherbrickhardware storeleaving homeliquor store19 year oldhamsterclothes linealcohol abuseapplying makeupwatching sexplastic bagpadlockhand on crotchdead fishhousing projectteen drinkingstatutory rapevoice maillaundry drying on clothes linelimpinglittle sisterprincess costumehigh risespying on couple having sexteenage rebellionlower classpiggy back rideband aidswing setmother's boyfriendclimbing a fencefish in titleinternet cafelistening to sexmother and daughter have sex with the same manpitbullschool expulsionfoot injurymother daughter estrangementafrican anglopushed into watertoolscouncil estateabandoned apartmenturban violenceshooting a horsehousing estatechild smoking a cigaretteessexsound of sexrunning mascaraunwanted childwant adautomobile junkyardhand cutnagging motherwrecking yardid badgehigh rise apartment buildingtossing rocks at a windowdance auditiondeath of a horsesony video camerahandfishingtaking off someone's shoesfoot woundfoot cutnegligent mothercarrying a girldrinking water from a faucethead slap (See All)

Parenthood (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Parenthood (1989)

The story of the Buckman family and friends, attempting to bring up their children. They suffer/enjoy all the events that occur: estranged relatives, the "black sheep" of the family, the eccentrics, the skeletons in the closet, and the rebellious teenagers.

Subgenre:
black comedy
Themes:
dysfunctional familymemorymarriagepregnancygambling
Mood:
affection
Locations:
kitchencarschoolbaseballoral sex in a car
Characters:
single motherfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipboyfriend girlfriend relationshipchildrenbrother brother relationshipbrother sister relationshipteenage girlteenage boylittle girllittle boy …grandfather grandson relationshipgrandmother grandson relationshippregnant wife (See All)
Story:
hiding placegrandfatherhuggingsingle parentcookingunderwearcryingpartysingingphotographmale nudityone word titlemasturbationsex scenekiss …telephone callhorsepunched in the facecameravomitinglievibratorbirthdaybedcollegebedroomhousedinnerbirthday partyold womanliarcowboychildbirthsadnessreference to william shakespearegrandmotherbirthday cakeeyeglassespornographyteen angstballooncowboy hatblockbusterbirthhomeembarrassmentpower outagesex talkliving roomplaybriefschildhood memoryhorseback ridingjoyteenage pregnancystrugglecar drivingschemeparenthoodschool principalyuppiebaseball gamebunk bedunplanned pregnancyresponsibilitybackyardbiracialwatching a videotalking while drivingschool playtreadmillexpectant mothernude photographsmilingmissouriexpectant fathermental disordercupcakest. louis missourihelium balloonpinatabiracial childmini vancowboy costumelittle leaguedropoutpaper bagmaternity wardnine year oldprincipal's officereference to franz kafkachild psychologistdental retainerusherkioskconsidering abortionchild rearingdiaphragmst. louis cardinalsphotographing sexbaby car seatballoon animalteenage marriagehelium inhalationblack sheep of familysocial adjustment (See All)

The Sisterhood Of The Traveling Pants (2005) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sisterhood Of The Traveling Pants (2005)

The movie is based on the young adult book, The Sisterhood of the Traveling Pants, by Anne Brashares. As four best friends spend their first summer apart from one another, they share a magical pair of jeans. Despite being of various shapes and sizes, each one of them fits perfectly into the pants. T …o keep in touch they pass these pants to each other as well as the adventures they are going through while apart. (Read More)

Subgenre:
coming of ageteen movieteen romancedocumentary filmmakingdocumentary footage
Themes:
friendshipdeathpregnancyweddingfuneralfilmmakingdatingfirst love
Locations:
kitchenhospitalbeachchurchcemeterynightclubairportmexicosinging in a carfishing boat
Characters:
self discoveryfather daughter relationshipfamily relationshipsteenagermother daughter relationshipboyfriend girlfriend relationshipboyteenage girlfemale protagonistgirlpriestlittle girlmaidfilmmakeramerican abroad …childhood friend (See All)
Period:
summer
Story:
soccer playermailmanbabysittinggroup of friendsjoggingsoccerwatching tvcryingpartyphotographdancingf ratedbased on novelcigarette smokingpanties …voice over narrationblondecomputerlettertearscleavagebracandlevideo cameraambulancewhite pantiescoffindrawingjeansvacationpianiststagefirst partloss of motherterminal illnesssupermarketteen angstloss of virginityloss of friendloss of loved onetimetennisbrideremote controlpet doggreeceheadphonesfirst kisslaughingsirenadolescentmusic bandjoygirl in bra and pantiesdonkeywedding ceremonylatinasummer campfriendship between womenfemale friendshiptween girlparamedicfriendship between girlsstretcherballerinaleukemiasummer vacationcruise shipwindmillchick flicksoccer matchstarsbus ridesick childpuerto ricanteenage girl in underweartailorclumsinessfamily feudmortalityvideo cassettemotor scooterwedding gowndocumentary crewairlinersmilingswimming in underwearsouth carolinabedriddenblue hairensemble filmdeath of parentfemale artistgoodbyedeath of a childmediterraneangreen hairbased on young adult noveltrouserssoccer coachsisterhoodsummer jobteenage girl in swimweargreek islandstring quartetpantssleep overgreyhound bussports brayoung filmmakerisland lifeaerobics classdepartment store clerk (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Spanglish (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Spanglish (2004)

John Clasky is a devoted dad whose skills as a chef have offered his family a very upscale life, including a summer home in Malibu and a breathtaking new Mexican housekeeper, named Flor. She and her daughter Cristina have recently emigrated to L.A. from Mexico and are trying to find a better life. W …hen they move in with the Claskys for the summer, Flor has to fight for her daughter's soul as she discovers that life in a new country is perilous! (Read More)

Subgenre:
independent film
Themes:
dysfunctional familymarriageinfidelitymoneyadulterydrinkingdrunkennessextramarital affairguiltunfaithfulness
Locations:
kitchenbuscarbeachrestaurantlos angeles californiamexicoschool bus
Characters:
self esteemfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipsingerboygirlreference to godalcoholicmaidcatholichispanic
Story:
joggingsingle parentrunningwatching tvunderwearcryingsingingdogsexkissshowertelephone callvoice over narrationcell phonesong …fooddrinklettertearscafecollegeprayernewspaperwomaneatingimmigrantimmigrationscreamingstorytellingmanipulationconvertibleautomobileclass differencesflirtingjeepcooknosebleeddysfunctional marriagechefculture clashspanishobesityjob interviewshoppinghousekeeperillegal immigrantpromiscuityvodkainsecuritylanguage barrierprivate schoolcadillacrealtorneuroticemigranttranslationaudimalibu californiamexican immigrantplaying against typedry cleanersreference to george lucasmonopoly the board gamefood criticprinceton universityenglish lessonsummer homenight jobspanglishreference to herbert hooverchild translates for adultcadillac escaladeaudi a4college admissionjeep grand cherokeeunable to speak english (See All)

The Damned United (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Damned United (2009)

Taking over England's top football club Leeds United, previously successful manager Brian Clough's abrasive approach and his clear dislike of the players' dirty style of play make it certain there is going to be friction. Glimpses of his earlier career help explain both his hostility to previous man …ager Don Revie and how much he is missing right-hand man Peter Taylor who has loyally stayed with Brighton & Hove Albion. (Read More)

Subgenre:
sports history
Themes:
friendshiprivalry
Mood:
archive footage
Locations:
hospitalbeachlondon englandsinging in a car
Characters:
family relationshipsbest friend
Period:
1970s1960s
Story:
british soccersoccer starsoccer fansoccer playergoalsoccerwatching tvflashbackbased on novelinterviewbare chested malereporterfootballnonlinear timelineno opening credits …traininglocker roomfired from the jobuniformspeechchampionnewspaper headlineheart attackwhat happened to epiloguehead buttheavy rainpress conferencetv showambitioncelebrationreconciliationnewsreel footagefootball playerdressing roomstadiumtrophyarroganceloss of jobdisciplinepresstv studiosoccer matchfootball teamtv interviewmovie cameracupfootball matchtv broadcastscoutyorkshirenational anthemsports starboard meetingjob offersportsmanmanagementpep talkegotismsoccer stadiumbrightonfootball managermallorcaleeds englandbooingmale rivalryseaside resortletter of resignationeuropean championshipingratitudejob resignationfootball associationwembley arena (See All)

On The Road (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

On The Road (2012)

Shaken by the death of his father and discouraged by his stalled career, writer Sal Paradise goes on a road trip hoping for inspiration. While traveling, he is befriended by charismatic and fearless Dean Moriarty and Moriarty's free-spirited and seductive young wife, Marylou. Traveling across the Am …erican southwest together, they strive to break from conformity and and search the unknown, and their decisions change the very course of their lives. (Read More)

Subgenre:
gay interest
Themes:
drugsfriendshipchristmaspregnancyfuneraldeath of fatherillnesspoetry
Locations:
buscarnew york citybartrainsnowcemeterynightclubroad tripmotelmexicogas stationroad moviebrothelsan francisco california …singing in a carmexico cityoral sex in a carsex in a tentsex in a motel (See All)
Characters:
baby girlex husband ex wife relationshipbabyfriendhusband wife relationshippolicemother son relationshipprostitutepolice officergay sexpolicemanwriterlittle girlgay kisslittle boy …homosexualityfrenchcrying babyfrench canadian (See All)
Period:
1940s1950syear 1947
Story:
friendship between menhuggingdrivingmarijuanamaskcryingsingingphotographdancingflashbackgunfemale nuditybased on novelnudity …male nuditybare breaststhreesomemale rear nuditybare chested malesex scenekisscigarette smokingnipplestitle spoken by characterthree word titlepantiestopless female nudityvoice over narrationsongwoman on topurinationcatletterbookbeerpianoprostitutionriveralcoholmenage a troisbisexualgay slurnew yorkcaliforniatoplessdinerwhite pantiesman with glassesradiosearchjourneyvoice overon the roadmoaningtentrabbitchristmas treehairy chestglassespoettypewriterrecord playergirl in pantiespoemlistening to musicstealingnew year's evehitchhikerhitchhikingmale prostitutestealing a carshopliftingnew jerseynipplearizonalipstickvoice over letterhomoeroticismsnowingmale male kissnotehustlerman cryingpost world war twolouisianapost wartelephone boothlizardloud sexsexual promiscuitycolorado16 year oldlistening to a radiopocket watchtopless girlalabamacactusnorth carolinavirginiafevermale prostitutioncross countryhoboroadtripreference to supermanharlem manhattan new york citypackingoverhearing sexundershirtqueens new york citywoman moaning from pleasurewoman moaningmoaning womancrossing selfnebraskabisexual manmigrantwatching sexwhorehousephoto boothreference to friedrich nietzscheman dancing with mandenver colorado21 year oldspying on couple having sexsuicide thoughtsspeeding vehiclelistening to sex23 year oldsign of the crossnativitycottonyear 1948sexual experimentationspeeding ticketbeat generationyear 1949year 1951year 1950hot wiring a carscrubbing a floortabby catmamboreference to harry s trumanreference to douglas macarthurpig's headreference to rimbaudcotton fielddysenteryreference to duke ellingtonfever dreamreference to helen of troydriving in the nudetrenton new jerseybenzedrinestealing gascotton pickingmigrant camp (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Mysterious Skin (2004) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mysterious Skin (2004)

Brian Lackey is determined to discover what happened during an amnesia blackout when he was eight years old, and then later woke with a bloody nose. He believes he was abducted by aliens, and N. McCormick, a fellow player on Brian's childhood baseball team, may be the key as to exactly what happened … that night. As Brian searches for the truth and tries to track him down, Neil McCormick takes up hustling and moves to New York, in attempts to forget childhood memories that haunt him. Together, the two of them uncover the terrible truth of the scars they share. (Read More)

Subgenre:
independent filmcoming of age
Themes:
dysfunctional familymemorydrugsfriendshipkidnappingrapechristmasmoneydrinkingdrunkennessinvestigationvoyeurismcorruptiontheftobsession …paranoiadrug useguiltgriefhumiliationabuseunrequited lovecrueltychildhoodtraumaregretchildhood traumaalien abductionpsychological trauma (See All)
Mood:
rainnightmare
Locations:
bicyclebusnew york citybarsnowsmall townbathtubbaseballrooftopmotelgay barbus station
Characters:
single motherfriendfamily relationshipshomosexualfather son relationshipmother son relationshiptattooboybrother sister relationshipteenage girlprostituteteenage boygirlalien …studentgay sexphotographerbest friendlittle girlgay kissbullylittle boygay friendhomosexual rapehomosexual kissgay rape (See All)
Period:
1980s1990syear 1991year 1983year 1981year 1987
Story:
confronting the pastpostcardhaunted by the pastsingle parentcollege studentmarijuanarunningwatching tvunderwearcryingsingingphotographdogbloodgun …flashbackbased on novelnuditymale nudityviolencemasturbationmale rear nuditykisscigarette smokingejaculationshowertelephone callvoice over narrationbased on bookbeatingdreamfoodurinationface slapdrinkcondomundressingletterbeertearsbirthdaybedprostitutionsubjective camerahalloweengay slurbedroomflashlightnew yorkcocainehousesubwaynonlinear timelinechild abusechilddrawingbathsearchejaculation into someone's mouthlibrarymicrophonestrippingangelreadingchristmas treefarmerhalloween costumeprankscargiftsadnessunderwaterobscene finger gesturefireworksgraffitiufopizzacoacheyeglassespot smokingrevelationbreaking and enteringheavy rainlistening to musictape recorderfaintingsexual abuseice creamtoywatching a movienosebleedvideotapeteddy bearcrushmovie theatremale prostitutetarget practicebloody nosesufferingchild's point of viewplaygroundunderage drinkingrejectiontaking a picturepost traumatic stress disorderhypnosislostchristmas eveabsent fatherpedophileperversionrainstormmustachesnowingdark pastbruisecellarhustlerchildhood memorypipe smokingphoto albumtracking devicepervertearphonespresentnew jobshynesspedophiliaspit in the facemen's bathroomtrick or treatingsnorting cocainechild molestationjournalcrutchesblackoutmotel roombitternesssexual perversiongay crushtween girlclimbing through a windowboy with glassesdegradationanal rapewhisperingmale rapehanging upside downlsdfallingcrippleplaying a video gamemuggingaudio cassetteseizurestation wagonmale prostitutiondecadencesorrowoverhead camera shotchild molesterkansascruising10 year oldpolaroid cameratraumatic experiencewitch costumebaseball teammolestationfast food restaurantloudspeakerinner title cardchristmas caroldepravityletter writingrocking chairleaving homesoul matechild swearingdisabledboy girl relationshipcerealsweaterborderline personality disorderbody part in titlemistreatmentman boy relationshipsubconsciouscupcakerepressed memorytv show in filmhandballdevil costumeloss of innocencesexually transmitted diseasegomorrahyscaffolddrug snortingmoral corruptionvenereal diseasebed wettingshampooumpiregay hustlereight year oldlittle leagueswing setmother's boyfriendgay man straight woman relationshipmobilemen's toiletuses the word faggotgay kidcommunity collegeporch swinguses the word faghomemade haunted house attractionairplane ticketbaseball coachglbt issuesbreakfast cerealcamaropartner in crimeatariephebophilecrawlspacebroken eyeglassesdead cowbaseball cardeyesightsilent nightmaking facesunwanted sexual advancesblue lightmale male relationshipmale wearing makeupsexual aberrationdrive in theatremale hustlergarglingcrabsrecovered memorysexual ambiguitytagginglittle league baseballmouthwashburied memorieschristmas carollingfalling glassuniversity of california berkeleyemotional shockman boy lovehand in pantsmodesto californiasandwich shopsexual corruptionsordidnesssubway ridebottomless pitgay man straight man relationshipreference to jan vermeerkarposi sarcomaloss of dignitysnack foodupside down imagevermeer paintingbeanbagcrab licenegligent motherpot pipeamc gremlinbrighton beach new yorkloft bed (See All)

Happy-go-lucky (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Happy-Go-Lucky (2008)

Poppy Cross is happy-go-lucky. At 30, she lives in Camden: cheeky, playful, frank while funny, and talkative to strangers. She's a conscientious and exuberant primary-school teacher, flatmates with Zoe, her long-time friend; she's close to one sister, and not so close to another. In this slice of li …fe story, we watch her take driving lessons from Scott, a dour and tightly-wound instructor, take classes in flamenco dance from a fiery Spaniard, encounter a tramp in the night, and sort out a student's aggressive behavior with a social worker's help. Along the way, we wonder if her open attitude puts her at risk of misunderstanding or worse. What is the root of happiness? (Read More)

Themes:
friendshipjealousypregnancydrinkingdanceparanoiamental illnessbullyinghomelessness
Locations:
kitchenbicyclebuscarbarbeachschoollondon englandurban settinglakegas stationschool teacher
Characters:
friendfamily relationshipshusband wife relationshipmother son relationshipboyfriend girlfriend relationshipchildrensingerboyfemale protagonistteacherdancersister sister relationshiplittle girlbullylittle boy …teacher student relationshiphomeless man (See All)
Story:
pubdrivingcookingmarijuanarunningmaskunderwearsingingdancingbare chested malekissfightcigarette smokingnippleschase …pantiestelephone callcell phonesongfoodslow motion scenedrinkundressingbooklieclassroombrawomaneatinginternetchild abusebirddrawingpantyhoseparkargumentsuburbuniformflowerslong takesplit screendatechickenclasshappinesseccentricclubimprovisationstreet lifebootsplaygroundspanishironymiami floridarowboatscissorsschool uniformbookstorenintendothirty somethingbarbecuepiersocial workerowlabandoned buildingyellingteachingbag over headdockfirst dateplaystationfriendship between womenstreet marketshoutingclinicdenialbumravebackyardtrampolinelearningoptimismdance lessonsex on first dateglobedance classflamencofake breastsspaniarddriving lessoncar keyslessonpink braprimary schoolchildren's bookflatmatelearning to drivetouching breastsclappingpiggy back ridepalm readingthree sistersseat beltafrican anglo30 year oldchiropractordriving instructorpaper bagart projectoptimiststolen bicyclereference to pinocchioarts and craftspicture booktoucanback painshadow boxingcheerfulnessrowing boatcamden town londonosteopathreference to kate winsletnorth londontraffic signanglo african (See All)

Nowhere Boy (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Nowhere Boy (2009)

The story of John Lennon's childhood and teenage years from 1944 to 1960, his relationship with his aunt Mimi and his mother Julia -the two dominant women in the first part of his life-, his first meeting with Paul McCartney and George Harrison, their friendship, their love for music and the birth o …f The Beatles. (Read More)

Subgenre:
coming of agetragedy
Themes:
friendshipdeathmoneydrinkingdrunkennessfuneralangertheftdeath of motherdepressiondeath of wifechildhood
Mood:
nightmareaffection
Locations:
bicyclebusrestaurantschoolcemetery
Characters:
babyfriendhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipsingerboyteenage girlteenage boyteachergirlstudentdancermusician …sister sister relationshipthiefbest friendreference to godlittle boycousin cousin relationshipuncle nephew relationshipaunt nephew relationship (See All)
Period:
1960s1940s1950s
Story:
mailmanreference to elvis presleygroup of friendspubrock 'n' rollrunningunderwearcryingpartysingingphotographdancingflashbackbloodsex …f ratedmasturbationtwo word titlekisscigarette smokingfingeringbased on true storytelephone callfondlingbased on booksongtitle directed by femaledreamfoodmirrorurinationpunched in the facedrinksecretletterbookliebeertearsbirthdayrock musiccafecollegepianoguitartelephonebedroombandambulancemontageeatingwidowhouserock banddrawinghit by a carbirthday partygraveyardflash forwardargumentmicrophonereadinguniversitydeath of husbandsadnesscharacter says i love yousleepingrecord playerbirthday caketeateen angstwhat happened to epiloguehead buttdesirelistening to musictape recorderwoman with glassesrecordingtitle based on songrageguitaristaudienceblack humorpassportmovie theatreswitchbladebloody noseshopliftingbackstagedrummertheatre audienceabsent fatherschool uniformsexual humorsongwriterpierattractiondark pastdressing roomrecording studiolaughingdead motherpajamascrowdexhibitionismnew zealandmusic bandfast motion scenedrumsjoypiano playerporn magazinedark secretadolescencejazz musiclooking out a windowguitar playingharmonicaboy with glassesbus stopflasklistening to a radiowrathguitar playerurinalguardianhamburg germanypawnshopwakegravestoneoutdoor oral sexthe beatlesgrudgedoormanabsent motherwaveoverhearing sexmusical instrumentrecord storemusic storebanjomusic groupreference to winston churchillrock groupliverpooloverheard conversationdouble decker busbloody mouthboardwalkcollapsesketchingdeath of uncleabandoned by fatherillegitimacygarden shearshalf brother half sister relationshipabandoned by motherbirth certificatechildhood memoriesboys' bathroomband managerlodgerschool suspensionlawn chairfish and chipsknocking on doortroubled teenage boyblackpool englandabandoned by husbandreference to buddy hollyreference to little richardsleeping on a benchreference to tchaikovskysinging along with a recordbiochemistryseaside resortbanjo playerschool blazerbrain hemorrhagewashboardlistening to classical musicclipping a hedgemerchant navy (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Another Year (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Another Year (2010)

A married couple who have managed to remain blissfully happy into their autumn years, are surrounded over the course of the four seasons of one average year by friends, colleagues, and family who all seem to suffer some degree of unhappiness.

Themes:
memoryfriendshipdeathinfidelitychristmasmoneyjealousyadulterypregnancydrinkingdrunkennessweddingfuneralextramarital affairanger …divorcelonelinessdeath of motherdepressionunfaithfulnessunrequited lovedeath of wifeenvironment (See All)
Mood:
rain
Locations:
bicyclecarrestauranttrainparis francelondon englandtaxiaustralian outback
Characters:
babyfriendfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctorbrother brother relationshiplawyerreference to godsecretaryolder man younger woman relationship …cousin cousin relationshipemployer employee relationshipuncle nephew relationshipolder woman younger man relationshipex boyfriend ex girlfriend relationshipold friend (See All)
Period:
wintersummer
Story:
soccer fanreference to elvis presleypubdrivingcookingmarijuanawatching tvcryingkisscigarette smokingtelephone callfoodmirrorurinationcomputer …drinksecretbeertearscafereference to jesus christprayertelephonewinedeath of friendeatingfootballimmigrantapologycoffincoffeelimousineprologuesuburbwidowerchampagnesuitcasereadingflowerssadnessgardenirelandtherapyholidaygolfpot smokingtealooking at oneself in a mirrorcakehelmethappinessagingtherapistdesperationbald manretirementnostalgiapartnershovelco workermedical examinationensemble castvegetarianswingbarbecuefamily dinnerdivorceemelancholyt shirtchocolateearphonesheartbreakgardeningcremationevictionhangoverreference to the beatlesdigginghinduinsomniaknocking on a doorstethoscopestrokeunhappinessautumnbakerygiving a toastdisappointmenthearserehabilitationgolf coursetomatobackyarddublin irelandnervousnesstreehousecar breakdownsleeplessness10 year oldfinger gunpackingrecyclingtoothbrushred winebaldnessdriver's licensesleeping pilldinner tablewheelbarrowhard hatcounselorgeologistred carblood testseine riverparking ticketcold the temperatureelderly coupleprescriptioncuddlingpiggy back ridesleeping on a sofaestranged songreek islanddeath of auntafrican anglo30 year oldriver thamesmeet cuteblood pressureoverweight manreading in bedbrushing hairfuneral parlorrolling a cigarettecurrymale wearing an earringvegetable gardenisle of wightlighting someone's cigaretterehabilitation centerspurned womanwhite winesmashing a car windowspring the seasonjiltedfour seasonsbackyard barbecuebuying a car35 year olddifficulty breathingmissing someonedrillingout of breath70 year old41 year oldcompostreference to tom and jerry64 year oldallotment gardenauto insurancecorfudonegal irelandslap on the buttthymedeath of sister in lawneck scarfsilent sceneblack angloemployment officelincolnshire englandone year time spancroydon londonoccupational therapistreference to jerry lee lewissurrogate nephew (See All)

Baby Driver (2017) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Baby Driver (2017)

Baby is a young and partially hearing impaired getaway driver who can make any wild move while in motion with the right track playing. It's a critical talent he needs to survive his indentured servitude to the crime boss, Doc, who values his role in his meticulously planned robberies. However, just  …when Baby thinks he is finally free and clear to have his own life with his new girlfriend, Deborah, Doc coerces him back for another job. Now saddled with a crew of thugs too violently unstable to keep to Doc's plans, Baby finds himself and everything he cares for in terrible danger. To survive and escape the coming maelstrom, it will take all of Baby's skill, wits and daring, but even on the best track, can he make it when life is forcing him to face the music? (Read More)

Subgenre:
cult filmcoming of ageblack comedyheistepiccaperheist gone wrong
Themes:
gangstermurderdeathloverevengemoneybetrayalprisonfearescapeartdeceptionrobberyangerpsychopath …death of fatherbrutalitydeath of motherparanoiablackmailsurveillancepanicself sacrificepolice corruptionchildhood trauma (See All)
Mood:
rainneo noircar chase
Locations:
kitchenbicyclecarrestauranthelicoptermotorcycletaxielevatorwheelchairurban settingapartmentpolice cartruckgas stationusa …tunnelsinging in a carcar on firecar thiefcar fireprison buskissing in an elevator (See All)
Characters:
babyhusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshiptattoosingerboypolice officerdancermusiciansister sister relationship …thieftough guywarriorreference to godwaitresslittle boysecurity guardasianalcoholicasian americanolder man younger woman relationshipuncle nephew relationshippolice shootoutpolice chasedriverfrench kisscrying babydeath of girlfriendshooting a police officersuicide by cop (See All)
Period:
1990s2010s20th century21st centuryyear 1998
Story:
car accidenthidden gunhoodlumgang leaderhiding placepost officepostcardposterhaunted by the pastdrivingmarijuanarunningmaskwatching tvsinging …photographdancingcharacter name in titleflashbackgunbloodviolencetwo word titlekisscigarette smokingtitle spoken by characterexplosionchasesurprise endingpistoltelephone callfirecell phonesongshootoutbeatingdreamcorpseshot to deathblood splatterfoodmachine gunshot in the chesturinationshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightfalling from heightlettershowdownlierifleheld at gunpointsunglassescar crashcafebathroomjailhandcuffsreference to jesus christrevolverguitarcriminaltelephoneshot in the backf wordreportersubjective cameracleavagefoot chasegay slurnewspaperorphanflashlightwinegangambushmassacredisguisestabbingmontagebridgeimpalementdinerprisonerweaponmapaccidentdinnerexploding carjudgeapologyman with glassestrialanti herodisarming someonehit by a carpolice officer killedsearchvannews reportshot in the legcoffeeshot in the foreheadlatex glovesracial sluron the rungunshotflash forwardattempted murderorganized crimecharacter repeating someone else's dialoguemicrophonebeaten to deathdangerprologuescreamingkeyfantasy sequencefugitivecharacter's point of view camera shotundercoverproduct placementpassiondebtknocked outopening action scenebankdomestic violencestreet shootoutshot in the shouldercourtlong takemanipulationscarpursuitstalkinggiftautomobileglassesthreatpigloss of fatherbank robberyloss of motherprofanityshot in the armhandgunlove interestreference to william shakespearegraffitinewspaper headlinesubtitled scenecorrupt coppowerblack americanatmrecord playerpizzaak 47pickup truckcrime bosseyeglassesapplauseeavesdroppinguzipot smokinghand grenadebulletwarehouseheavy rainlistening to musictape recordersociopathscene during opening creditsrecordingtitle based on songragecooksecurity camerajail cellwalkie talkieloss of loved onebeardcaucasianblockbusterswat teamwristwatchdesperationfemale singerdriving a carparking garagefollowing someonestreet lifepreacherbossmasked manmexicanwatching televisionthugpump action shotgunreverse footageprison guardnicknamestealing a carshopliftingconstruction sitemobile phonefight to the deathintriguedual wieldmanhuntconvenience storemutebroken glassdeath threatshopping mallheadphonessong in titlepolice officer shotescape attemptblack and white scenedark heroaerial shotwisecrack humorbananasexy womanblood on shirthighwayundercover copcellphonebody landing on a cardark pastlens flarerelease from prisontragic heroethnic slurdeath of loved onejobbenchphonereckless drivingsign languageswearinggeniusflat tireparking lotsinsouthern accentbeing followedshot through a windowhappy endingmarijuana jointstolen carbag of moneymysterious manface maskfinal showdownrobberhit in the facejunkyardconstruction workercar drivingpistol whipglovesscene before opening creditsfirearmfirst dateblack mansuit and tiearms dealername callingtelevision newslooking out a windowarmed robberyyoung version of characterbank robberlaundromatretirement hometraffic jambearded mandepartment storebody in a trunkpursesawed off shotgunstrong languagebaseball capcriminal gangshort skirtaudio cassettechewing gumdomestic abuseatlanta georgiamercedes benzlip synchingsole black character dies clichefilling stationflamecarjackingbroken noseoverturning carpizza deliveryrepeated linesome scenes in black and whitecar radiotragic pastwashing machinedeath of familyoverhead camera shotreference to shakespeare's romeo and julietcrowbarfemale criminaldirty copmotorcycle copintergenerational friendshipbloody violencesurrendervending machineloss of familygang membercar rolloverhip hop musicabandoned warehousevillain not really dead clichegogglespolice sirenstreet musicianthrown from a carcamera focus on female buttrecord storevinylpizza delivery boyred winetoy carone last jobdeaf mutecassette tapeblond manrearview mirrorhidden moneycrushed by a caru.s. marinebritish actor playing american characterhundred dollar billshoot outcriminal mastermindarmored truckautomated teller machinedinner datefall to deathgetawaytraffic lightloss of girlfriendblack and white segues into colorwearing sunglasses insidejumping from a carbubble gumfantasy becomes realityrobbery gone awryipodbloody mouthneon signshoe storebreaking a car windowmohawk haircutaudio tapered carhawaiian shirtprison sentenceshot in the kneeelderly womanfemale thiefbank tellerstate troopercounting moneybare midriffbell 206 jet ranger helicopterpizza parlorcar stuntorphan boy9 11vinyl recorddead body in a car trunklip readingrepeated dialoguereference to coca colaflamesstolen police cartinnitusfoster fathertitle mentioned in songelderly mangetaway cararmored car robberyblowing bubblescriminal underworldreference to barbra streisandyoung romancename tagroller skateautomatic riflelistening to music on headphonesmopping a floorweather reportwine glasslucky charmdriving in reversegetaway driverman with a ponytailscrapyardwoman with tattoodeaf manbaseball cap worn backwardsfraternity housewindshield wiperhalloween masksubaru imprezabubblesreference to las vegas nevadawoman wearing a miniskirtalmost hit by a carhot wiring a carrecord collectionundercover policemanreference to dolly partonhearing impairedromantic dinneratlantacode wordtesticles slurreference to halloweenshort dresstattoo on neckdriving backwardsfoster father foster son relationshipstunt drivingautomobile junkyardchannel surfingcrippled manreference to bonnie and clydewrecking yarddistorted soundfraternity partyb wordflip phonepurposeful car accidentreference to queencamera footagefemale robberreference to jason voorheesrubber maskscrap yardclose up of a woman's buttdoor buzzerdue processfiring guns from both handsjean jacketreference to boston massachusettssexy legsarmored guardlp recordingmixtapeface scarhearing impairmenthoop earringsmarital fightreference to g.i. joereference to looney tunesromantic relationshipsteering wheelsound mixingcar seatdefecation slurlong haired womanlp recordreference to boyz ii menreference to louis vuittonreference to t rexreference to ted turnerreference to wall streetburner phonecrashing into a police cardriving against trafficear examelectronic keyboardmaking a sandwichpolice blockadepolice pursuitreference to fight clubrobbery gone wrongsarcastic clappingshot through a car window (See All)

Across The Universe (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Across The Universe (2007)

Across The Universe is a fictional love story set in the 1960s amid the turbulent years of anti-war protest, the struggle for free speech and civil rights, mind exploration and rock and roll. At once gritty, whimsical and highly theatrical, the story moves from high schools and universities in Massa …chusetts, Princeton and Ohio to the Lower East Side of Manhattan, the Detroit riots, Vietnam and the dockyards of Liverpool. A combination of live action and animation, the film is paired with many songs by 'The Beatles' (qv) that defined the time. (Read More)

Subgenre:
documentary footagerock musical
Themes:
drugsfriendshipmurderdeathsurrealismmarriagejealousypoliticspregnancydrunkennessescapedancefuneralartmilitary …depressiondrug useabuseunrequited lovetheatrepanicfreedomfalling in loverevolutionpolice brutalitynear death experiencecheating death (See All)
Mood:
rainhigh schoolbreaking the fourth wall
Locations:
bushospitalnew york citybarbeachchurchhelicoptersnowcemeterynightclubtaxiwheelchairshiptruckrooftop …taxi driverschool busbus stationfire escapecorpse in water (See All)
Characters:
police arrestsingle motherfriendfather daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipsingerbrother sister relationshipprostituteteacher …soldierpolice officernursealienstudentpolicemandancerpriestlawyersister sister relationshipartistwaitressinterracial relationshipprofessoruncle nephew relationshippimpdeath of boy (See All)
Period:
1960swinter
Story:
television setposterpubrock 'n' rollcollege studentbritishmarijuanarunningwatching tvcryingpartysingingphotographdancinggun …bloodfemale nudityf ratedmale nudityfemale frontal nuditymale rear nuditybare chested malekissfemale rear nudityfightcigarette smokingtitle spoken by characterexplosionchasethree word titletelephone callfiresongtitle directed by femalebeatingcorpsemachine gunurinationblondeslow motion scenepunched in the facebattlearrestundressinglettershootingriflebombjailclassroomguitarmanhattan new york cityalcoholtelevisionswimmingnewspaperbandconcertcaliforniabasketballmontagearmyimmigrantrock bandsubwayno opening creditsassassinationdrawingunderwater sceneroommatejourneypantyhosenews reportlooking at the cameraimmigrationmicrophoneprotestfantasy sequencetentuniversitydomestic violencegymamerican flaginjectioncheerleadercrossdeath of sonsadnesspremarital sexclassgraffitinewspaper headlineheroinrunawayriotcircusfemale stockinged legssyringeflyinghypodermic needleperformancetitle based on songjail cellguitaristdemonstrationbeardamerican footballhammerbuttocksvietnam warphone boothcomposertorchburialhitchhikerstreet lifehitchhikingapplehookerjanitorimaginationbloody noseveteranbreakupu.s. armyfanmourninghippieanimated sequencepool tableshot in the facebroken glassnewsreel footagefootball playertheatre audiencemedical examinationabsent fatherdead childbilliardsdrunksketchblack eyechoirsongwritersnowingdressing roombowlingwar veteranbruisemeetingdeath of loved oneillegal immigrantpatriotismmusic bandthanksgivinglighthouseanti warclosetdockplaying pooldetroit michiganlockergolf clubblack pantyhoseescalatortelevision newsdeportationstrikehangoverbroken windowclimbing through a windowlaundromatmaking outlsdcornfieldelectric guitarlandladymegaphonetoastdance clubbowling alleybreaking a windowamericanabumhearsepromvolunteerjockdomestic abusedeath of boyfriendmoustacheinterracial coupleacoustic guitarcollege campuswashing machinecultural differencepatriotironinginfantrythe beatlestour buscounter culturestatue of libertygururadicalloudspeakersmoking potmarchrock singerestranged fatherguard dogdrug triplootingstrawberryletter writingimperialismprotestormuralpassing outcerealrecord producersearch for fatherdog tagreference to martin luther king jr.barricadefloatingliverpoolgiggreenwich village manhattan new york citybiological fatherhigh school danceprotest marchwelderfootball fieldkeyholesexy nurseshipyardsketchingpolitical unrestpsychedeliarepairmanplatoonriot policeafrobus triplocked in a closetmilitary draftwar woundhare krishnathanksgiving dinnerpatrolslow dancingtrippybasic trainingdropoutnude drawingfootball practicepeace signreference to lyndon johnsonchest hairflying machinethanksgiving daydrafttitle sung by characterblack white relationsgreyhound busbleachersbomb makingdelicatessenphysical examreference to brigitte bardoturine samplegraffiti artgospel choirjukebox musicalrecord contractwall paintingprinceton universitysinging to the cameraoutdoor concertphysical examinationprotest songsocial unrestrecord dealwashington square manhattan new york citycollege boundcollege kidmarch on washingtonpicket signrecord executivetranscendental meditationprotest riotdockworkerhomemade bombstreet theaterfloating bodypsychedelic drugreference to jack kerouacanti war movementbus depotdraft noticeex lovers back togetherlesbian attractionlooking at the audiencestudent movementburning paperdayton ohiopacketriotingsliding down a banisterocean wavesolarisationuncle samarmy inductioncranberry saucedouble negative (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Man Up (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Man Up (2015)

A 34 year old single woman, Nancy, hung-over again, exhausted by the endless fruitless set ups by her friends, traveling up to London to toast another 10 years of her parent's successful happy magical marriage runs in with a 40 year old divorcee, Jack, who mistakes her for his 24 year old blind date …. Nancy, deciding to go with it, happens to hop on the most chaotic yet hilarious journey of her life which neither of them will ever forget. There is drinking, truths, an old stalker class mate with a long standing crush, lost divorce papers, lost hopes, competitive indoor sports and yeah Jack finding out the truth that Nancy isn't his blind date. 'Man Up' a romantic comedy about taking chances, finding about being yourself, making decisions and rolling with the consequences. (Read More)

Subgenre:
black comedy
Themes:
friendshipmarriagedrinkingdanceseductiontravelangerfalling in love
Mood:
night
Locations:
bicyclecarbartrainlondon englandtaxienglandtrain station
Characters:
self esteemex husband ex wife relationshipfriendfather daughter relationshiphusband wife relationshipmother daughter relationshipsister sister relationshipself image
Story:
solidarityhuggingpubjokerunningcryingpartysingingdancingsexkisstelephone callcell phonesongfood …mirrordrinksecretbookvomitingliebeertelephonef wordeatingtoilethousesearchjourneypantyhoseconfessionargumentmistaken identityspeechdatesadnesssleepingapplauseidentityrevelationdesirestreetfarceragehappinessstrangerclockembarrassmentmisunderstandingironylove at first sightfrustrationsurpriselipstickone daybowlingliving roomlaughingmeetingtripreckless drivingcrowdshamejoyfire extinguishernotebookinsecurityreference to facebookcar drivingblind datejournalsarcasmbitternessbicyclinghugman in underwearconversationbowling alleyquarrelimmaturitycoincidencewalkingreading a bookawkwardnessmistakescarfgropingclumsinessgrudgewedding anniversarysingle womansidewalksmilingsoul matecapstarting overempathypartyingchanceconfidencemasqueradebeer bottlebowling ballcaressingsupportcaretightscantinasmart phonetroubled pastanniversary partycharmopportunitypatiencedivorce paperseveningmen's roomtight pantsafternooncomplicityself help bookex classmatesingladies roomcheerfulnessfeelingcompatibilitycuddlemr. right (See All)

Boy A (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Boy A (2007)

A young man is released from prison after many years and given a new identity in a new town. Aided by a supervisor who becomes like a father to him he finds a job and friends and hesitantly starts a relationship with a compassionate girl. But the secret of the heinous crime he committed as a boy wei …ghs down on him, and he learns that it is not so easy to escape your past. (Read More)

Subgenre:
coming of age
Themes:
dysfunctional familydrugsfriendshipmurderdeathlovesuiciderapejealousyprisondrinkingfeardrunkennessescapedance …heroincestparanoiadepressiondrug usecancerredemptionguiltdatingillnessabusebullyingchildhooddyingforgivenessregretdying mother (See All)
Mood:
nightmare
Locations:
busbarbeachrestauranttrainschoolcemeterybathtubnightclubwatertaxicourtroomrooftopcar theftsex in a bathtub
Characters:
friendfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipbrother brother relationshipboyteachergirlstudentpolicemandancerphotographerlawyerlittle girl …bullywaitresssecretaryuncle nephew relationship (See All)
Story:
car accidentmanchesterhaunted by the pastfriendship between menhuggingpubwatching tvunderwearcryingpartyphotographdancingflashbackbloodfemale nudity …based on novelmale nudityviolencebare chested malesex scenekissfightknifebased on true storytelephone callcell phonebeatingmirrorface slaprescuepunched in the facecameradrinkcondomundressingbare buttsecretletterliebeertearsbirthdaybedcar crashcafejailhallucinationvoyeurclassroomrivercriminalreporternewspaperbraambulancefishchild abuseapologytrialdream sequencedrawingfishingbirthday partyvangraveyardold womanconfessionprologuescreamingfired from the jobliarscreamhangingcourtgiftthreatdatewitnesslaptopmurdererex convictclasssleepingnewspaper headlinehateapplausetv newsidentitykilling an animalhead buttwarehouseloss of virginitysexual abusevandalismmale bondingclubfalse identitysocial commentaryembarrassmentpromiseremote controlnicknameshopliftinginnocenceshoessurveillance camerakickingtaking a pictureco workerfather figurefirst kissamusement parkschool uniformpridefriendship between boysmurder of a childbounty hunterpierpublic humiliationrelease from prisonmoral dilemmaadolescentsaving a lifenew jobporn magazinegatebirthday presentsneakersmen's bathroomfirst datefake identitytowerdvdestatewalletbully comeuppanceroller coasterdiggingmale rapelandladywormecstasytrain trackstrain ridebreast cancerrehabilitationsecond chancefather son estrangementparolegravestonecarouselestrangementtabloidreference to the virgin maryshared bathhoodiemerry go rounddelivery manexposechild rapedressingtrespassingfleeingleg injurymcdonald's restaurantsurrogate fatherhappy birthdayhooded figurerascaltrain conductorsaying goodbyemedia frenzynew identitychild's drawingchild murdererfollowingparole officerboardwalkchild murders a childeellimpingname changecuttingsocial realismbountycuddlingsneaking outwatching a movie on tvwatching news on tvdishonestynewsstandsecret revealedsurrogate sonfootbridgebox cutterused condomearthwormdangerous friendamusement park ridedancing alonebirmingham englandlagerfirst day at worknottingham englandalecrying during sexsaying i love younew shoesrape of girlthrowing a bottletrain ticketviolent youthbrother brother incestreference to steven seagalreference to jean claude van dammebeach chairreference to don juanthank you note (See All)

Brokeback Mountain (2005) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brokeback Mountain (2005)

Two young men, Ennis Del Mar and Jack Twist, meet when they get a job as sheep herders on Brokeback Mountain. They are at first strangers, then they become friends. Throughout the weeks, they grow closer as they learn more about each other. One night, after some heavy drinking, they find a deeper co …nnection. They then indulge in a blissful romance for the rest of the summer. Unable to deal with their feelings for each other, they part ways at the end of the summer. Four years go by, and they each settle down, Ennis in Wyoming with his wife and two girls, and Jack in Texas with his wife and son. Still longing for each other, they meet back up, and are faced with the fact that they need each other. They undeniably need each other, and unsure of what to do, they start a series of "fishing trips", in order to spend time together. The relationship struggles on for years until tragedy strikes. (Read More)

Subgenre:
tragedy
Themes:
memoryfriendshipmurdermarriagejealousypregnancydrinkingdrunkennessweddingdivorcewrestlinghumiliationhuntingcampingregret
Mood:
rainbreaking the fourth wall
Locations:
hospitalnew york citybarrestauranttrainchurchforestsnowsmall townwoodsrural settingcourtroomlakemotelmexico …campfiretexasstormsex in a tent (See All)
Characters:
baby girlbabyfather daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerboyteenage girlgirl …gay sexdancersister sister relationshiplittle girlgay kissbullywaitresslittle boyhomosexualitygay relationshipgay fathercrying babytalking to oneself in a mirrorbaby boy (See All)
Period:
1980s1970s1960ssummeryear 1963
Story:
post officemailpostcardbulletproof vestfriendship between mencookingmarijuanawatching tvcryingsingingphotographdancingdoggunblood …flashbackfemale nuditymale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditytwo word titlesex scenekissfightcigarette smokingtitle spoken by charactertelephone callsongbeatingfistfightfoodhorsemirrorface slapdrinkshootinglierifletearssunglassesplace name in titlecaferivertelephoneswimmingcleavagebisexualcandleaxemountaineatingwidowdinerhousejudgechildfishingcoffeeskinny dippingbinocularsbeaten to deathbased on short storyliarcowboypay phoneproduct placementtentlightningfarmercourtcrosshorse ridingsadnesssuspicionbearfireworksarsonpickup truckcloseted homosexualnerdeavesdroppingropeshavingpot smokingwolfwarehouseloss of virginityred dresscowboy hatassaultnosebleedgossipgay parentsheephitchhikingcelebrationcamera shot of feetpromisemovie theatrewhiskeymale prostitutegrocery storethunderpastkickingchaospool tablecigarette lighterfrustrationblood on shirtwedding dressranchpajamaschildhood memorythanksgivingjoyspittingbisexualityhandshakeunhappy marriagesidekickfarmingcremationplaying poolcafeteriameatjukeboxmotel roombully comeuppancetrailer homecattlelaundromatharmonicahuntparamedicgay romancebowling alleyhead injurymailboxpiebullrodeosawshirtfirst gay sexual experiencebeltjumping into waterrighteous ragefourth of julyshepherdneo westernclothescowgirlu.s. mexico borderblanketfirecrackerremarriageburning buildingrich mannightgownchopping woodchild swearingsledlamblassoturkey the birdwyomingrearview mirrorcoyotebisexual manclothes linejumping off a cliffmoosepocket knifebatonsaddlewood carvingequestriangay husbandlooking for a jobfiddlefalling through a windowwashing clothesbare midriffmulecuddlingsplit lipfalling off horsefiddlerbelief in hellsemi truckindependence daysleeping outsidebull ridingfootbridgefishing rodcampsitecattle prodroughneckhailstormbad newsblood spurtingrodeo cowboywestern u.s.horseplaypaper bagfishing tripranch handthrown from a horsecorralchild supportgay cowboykeroseneoil fieldhailbeansroad constructionanticipationcowboy bootdead sheepmethodistshiveringwater canteendrive in movie theatrepentecostalharmonica playerelectric knifehangerhorse trailerhorse riding accidentgrocery store clerkrodeo clownsharpening knifetrick ridingbronc ridingfarm equipmentsnow sleddingparkarolling downhillwashboardgmc truckovernight sensationsecret romancespit as lubricantwashing clothes in rivereating piefoot rubpeeling a potatoswings (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Tsotsi (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tsotsi (2005)

In Johannesburg, a small time criminal, Tsotsi, is a teenager without feelings, hardened by his tough life. After a series of violent gang hits, Tsotsi hijacks a car. However, whilst driving, Tsotsi finds that there is a baby on the back seat. He brings the baby to his house in the slum. The next si …x days bring about a change in him that couldn't be foreseen. (Read More)

Themes:
gangsterfriendshipmurderdeathkidnappingmoneydrinkingdrunkennessrobberytheftdeath of motherredemptionguiltyouthgambling …illnessdyingfalling in love (See All)
Mood:
rain
Locations:
carhospitalbartrainnightclubwheelchairpolice carsewerslumcar theftshed
Characters:
babyfriendfather son relationshippolicemother son relationshipteenage boyteacherpolicemandancerthiefartistbullywaitress
Story:
gang leaderdrivingrunningunderwearcryingphotographdancingcharacter name in titledoggunbloodflashbackfemale nuditybased on novelmale nudity …one word titlemale frontal nudityfightcigarette smokingknifebeatingblood splatterfoodpunched in the facedrinkshootingvomitingbeertearscar crashreference to jesus christcriminalsubjective cameranewspaperwineold manstabbingsubwayapologyradiobartenderpainlightningdeath of husbandsadnesschickenobscene finger gesturegraffititeabreaking and enteringhappinessrailway stationsouth africafollowing someonecompassionstreet lifethugthunderbroken glassinsectsafeinfectionfriendship between boysreckless drivingcoinspittingminingparalysisgatebreast feedingdefecationbeggarwalletgun held to headbugwetting pantslistening to radioanttrain trackscripplepipeexammercedes benzsewing machinesorrowbmwinformerdicefleeingintercomdriver's licensebucketkeysmirror balldiapertownshipchange of heartcaught in the rainfingerprintscar alarmeye injuryburglar alarmchop shophandsfootpaperboygrand theft autosurrogate familyice pickmobileshantytownbaby bottlechicken coopjohannesburg south africapaper bagurban violencebead curtainfaucetunderpasschange of mindshiveringmining accidentbaby nurseryfeeding a babykicking a dogpost apartheidsafety beltchained doorcondensed milkcutting armgarbage can lidrolling dicebaby snatcherhands held over head (See All)

The Perks Of Being A Wallflower (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Perks Of Being A Wallflower (2012)

Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr …overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)

Subgenre:
coming of ageteen movieperiod film
Themes:
memorydrugsfriendshipsuicidechristmasjealousydrinkingfeardanceincestseductionlonelinessdepressiondrug usecancer …guiltdatingmental illnesspoetryabusebullyingunrequited lovehomophobiabreak updyingwritingcheatingfirst lovedying from cancerdeath of best friendsuicide of friend (See All)
Mood:
high school
Locations:
hospitalrestaurantchurchsnowtrucktunnelcatholic churchpennsylvaniaschool dancekitchen knife
Characters:
friendfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipdoctorsingerbrother brother relationshipboybrother sister relationshipteenage girl …teenage boyteachergirlpolicemandancerphotographerwriterpriestbest friendreference to godgay kissbullylittle boyteacher student relationshippsychiatristcatholicgay teenagergay relationshipaunt nephew relationshipcatholic priestboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All)
Period:
1990syear 1991
Story:
car accidentreference to frank sinatrahuggingrock 'n' rollcollege studentdrivingmarijuanarunningwatching tvcryingpartysingingphotographdancingflashback …based on novelkissfightknifetelephone callvoice over narrationbeatingfoodmirrorface slapslow motion scenepunched in the facecamerawritten by directordrinkcondomsecretlettershootingbooktearsbirthdaycafebathroomcollegehallucinationreference to jesus christclassroomprayertelephonef wordsubjective cameragay slurbedroomwinecandledeath of friendeatingfootballsuicide attemptdinnerchild abuseapologyracial slurpainflash forwardlibraryvirginreadingchristmas treeprankhigh school studentcheerleaderglassessadnesssix word titleclassreference to william shakespearetypewritertrustteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualfireplacelooking at oneself in a mirrorlistening to musicsexual abuseice creamred dresshappinessamerican footballmovie theaterimpersonationnew year's evecrushvirginityclockpromisebuddhistmovie theatrenicknameinnocencepillssufferingmobile phonebackstagepunched in the stomachsexismkaraoketaking a picturemental hospitalfootball playertheatre audiencefirst kisschristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingothgraduation12 year oldshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingteenage lovefirst dateadolescencechild molestationblackoutlooking out a windowharmonicaponytailschool principallsd16 year old15 year oldstonedkiss on the lipsunhappinessgiving a toastveganhazingtutoreasterpromaudio cassettehouse partylip synchingcar radioteenage crushdance scene11 year oldwriting a letterabusive boyfriendwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausaspiring writerenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actcrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school dancehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glasseslast day of schoolenglish classfacial injuryprincipal's officeacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailmix tapewriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All)

Pretty In Pink (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pretty In Pink (1986)

Teenager Andie is one of the not-so-popular girls in high school. She usually hangs out with her friends Iona or Duckie. Duckie has always had a crush on her, but now she has met a new guy at school, Blane. He's one of the rich and popular guys but can the two worlds meet?

Subgenre:
independent filmcult filmcoming of ageteen movieteen romanceteen comedy
Themes:
dysfunctional familyfriendshipdrinkingdrunkennessdanceangerpovertydatingunrequited lovefashionwealthfirst love
Mood:
high school
Locations:
trainschoolnightclubschool teacherschool dance
Characters:
single fatherfather daughter relationshipteenagerboyfriend girlfriend relationshipsingerteenage girlteenage boystudentmusicianlustteacher student relationshipchinese
Period:
1980s
Story:
dance contestpostermarijuanawatching tvunderwearcryingsingingphotographdancingkissthree word titlepantiesfistfightblondecomputer …tearscolor in titlecleavagebrarock bandwhite pantieslibraryargumentmicrophoneconvertiblegymhigh school studentclass differencesredheadrecord playergirl in pantieseyeglassesnerdtraditionanswering machineteen angstdresstitle based on songcrushforbidden lovepet dogshoppingplaying cardscartoon on tvteenage lovelockeralarmbicyclingmaking outvolleyballlistening to radiogeneration gapteenage daughterpromaudio cassettehouse partysewing machinedesignerhigh school girlopposites attracthomeworkreference to madonnasuitorrecord storemusic storesnobphonograph recorddevotionreference to karl marxhigh school danceslumber partyyearbookhigh school boynylonsrich snobwashroomteenage romancehalljuvenilehigh school promteen lovereference to franklin d. rooseveltunderageparty dressbrat packwrong side of the tracksrich man poor womanshy girlschool yearbookrailroad tracksreference to david lettermanmusic albumhigh school sweetheartsprom dressbreasts growingsocial consciousnessreference to tina turnertwo suitorspreppiesingle dadreference to lionel richieshermer illinois (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Goal! The Dream Begins (2005) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Goal! The Dream Begins (2005)

Santiago's father, Hernan Munez, smuggled his penniless Mexican family over the US border to seek a better, albeit modest future in L.A. Eldest son Santiago dreams of more, like native Angelinos, then joining Hernan's gardening firm. His change arrives when a British ex-pro spots him as an exception …al soccer natural and promises he can arrange a real British talent scout to check him out. Although that falls trough and dad forbids it, Santiago accepts grandma's savings to try out with English premier league club Newcastle. Despite his asthma, he gets in and befriends the freshly transferred, desperately undisciplined bad boy star scorer, party animal Gavin Harris, who becomes his bothersome house-mate, a recipe for trouble and yet each's salvation. (Read More)

Subgenre:
medicalsoccer movie
Themes:
deathmoneydrinkingtheftdeath of fathercancerdeath of wife
Mood:
rain
Locations:
kitchenhospitalbarbeachrestauranttrainchurchswimming poolairplanelos angeles californiaboatnightclublondon englandtaxiairport …englandtruckmexicostormtrain stationchinese restaurant (See All)
Characters:
single fatherbabyfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshiptattoobrother brother relationshipboyteenage boynursedancerphotographer …latinocatholicgrandmother grandson relationshipamerican dreamchinese americanthe family (See All)
Period:
1990s
Story:
pubsoccerrunningunderwearcryingpartyphotographdancingflashbacksexkissfighttitle spoken by charactershowertelephone call …punctuation in titlecell phonedreamslow motion scenecameradrinkbeertearscafereportergangmontageimmigrantroommatelatex glovesflash forwardprologuelocker roomfired from the jobumbrellaexclamation point in titleprankgyminjectioncheerleaderloss of fatherfirst partsubtitled scenegarageheart attackcoachathletediscohypodermic needleinjurymale bondingpress conferenceclubinterracial romancemobile phonespanishmedical examinationbilliardsone dayborderstadiumflat tiremudmexican americanlatinaplaying poolgardenernurse uniformasthmashoedisciplinenurse outfitillegal immigrationu.s. mexico borderborder patrolscrapbookcustomscrossing selfhospital gowndining hallblood samplemexican american borderaround the worldknee injuryinhalersportsbusboycomputer gameathletic trainingsports agentcardboardsports announcerborder fencescalebarrionewcastle upon tyneairplane toilet (See All)

Hesher (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hesher (2010)

T.J., a high school freshman, lost his mother two months before in a car accident: his father pops pills and sits on the couch; his grandmother holds things together, chatting and cooking. T.J. wants the car back from the salvage yard where the owner's son is a bully. By happenstance, Hesher, a foul …-mouthed squatter, moves in with T.J's family. T.J. also meets Nicole, a grocery clerk near poverty who helps him once. Hesher involves T.J. in crime, the bully is omnipresent, mom's car is slipping away, dad has checked out, T.J. watches Nicole at work, and his grandma invites him to join her morning walk: the odds are long that T.J. can assemble a family to help him thrive. (Read More)

Themes:
memoryfriendshipmurderdeathrevengerapemoneyjealousydrinkingfuneraldeath of motherdepressiondrug usegriefbullying …home invasiondeath of wifehomelessnessdeath of daughtermurder of daughter (See All)
Mood:
raincar chase
Locations:
bicyclecarschoolswimming poolbathtubsinging in a carcar firebicycle accident
Characters:
friendfather daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipdoctortattoosingerteenage boyteacherpolicemanbullyuncle nephew relationship …older woman younger man relationshipgrandmother grandson relationshipfuneral director (See All)
Story:
car accidentcookingmarijuanarunningwatching tvunderwearcryingsingingphotographcharacter name in titleflashbackbloodviolenceone word title …masturbationbare chested malesex scenefightcigarette smokingfingeringexplosionchasetelephone callfiresongbeatingtesticlesfoodurinationrescueslow motion scenepunched in the facedrinkarrestundressingfalling from heightvomitingliebeertearsjailreference to jesus christclassroomguitarf wordswimminggangstrangulationeatingsnakeapologycoffinbathvanold womanpainprologuesuburbliarstorytellingflowerspursuitstalkingdirectorial debutloss of motherclasssleepingobscene finger gesturetherapyarsonpizzatwenty somethingeyeglassesanswering machineshavingpot smokingbreaking and enteringlistening to musicwoman with glassesmousevandalismguitaristhidingloss of wifefollowing someonemilkremote controlgrocery storebloody nosepillssufferingboxer shortsconstruction sitekicked in the crotchscissorscigarette lighterfrustrationraised middle fingerbriefssports carreckless drivingparking lotbeing followedbongjunkyardmetaphorwalletlooking out a windowabandoned houseclimbing through a windowgroup therapymisfitbreaking a windowurinalwalkingsurrogate mothertow truckdeath of grandmothermugshotteenage crushwashing machinehoodiesquattermentor protege relationshipice cream conesing alongthreat to killcaught in the actautomated teller machinejoke tellinglooking in a windowbloody mouthbreaking a car windowstained glass windowransackingcounselingarsonistbrokewashing clothesmalnutritionspitting on someonediving boardarm castbelchingmale with long hairdestruction of propertyclimbing a fenceboys' bathroomheadbangerwatching a porn videojumping into a swimming poolderelictfelonyface woundheavy metal musicpushed into a swimming poolanti social behaviorkilled in a car accidentreference to metallicafingerprintinglawn chairlistening to a car radioarm in a castgas canbad influencebrushing one's teethhit by a vanpeanuthouse for salechoking someonethrowing a stone at a windowsetting a car on firetraffic ticketrear ending a carthrowing a chairlead pipemagic markerpabst blue ribbon beerreading a porn magazineself medicationselling a carautomobile graveyardbicycle lockgrocery store clerktin snipsauto insurancedamaged carreference to r2d2reference to motorheadwatching a porn video on tvclimbing a polegrief therapyobscene drawingkicking a carsitting in the darkwitness to sex (See All)

Open Your Eyes (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Open Your Eyes (1997)

A once handsome playboy, Cesar finds himself in a mental facility and he can't remember why. All he can remember is meeting the love of his life for one day, and then getting into a car accident which left his face horribly disfigured. But the pain of becoming physically undesirable may help him to  …find the truth. (Read More)

Subgenre:
cyberpunk
Themes:
memoryfriendshipmurderdeathlovesurrealismsuicidejealousyprisondrinkingdrunkennessmonsterangerdeath of fatherdeath of mother …paranoiaabusewealthamnesia (See All)
Mood:
nightmare
Locations:
carchurchnightclubrooftop
Characters:
self pityfriendfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipdoctorchildrenpolicemandancerlawyerlove triangleactressbest friendreference to god …security guardpsychiatristsecretaryhispanic (See All)
Story:
car accidentrunningmaskwatching tvphotographdancingbloodgunflashbackfemale nuditynudityfemale frontal nudityinterviewsex scenekiss …nipplesthree word titleshowervoice over narrationbeatingdreamcomputercatdrinkkissingshootingvomitingbirthdaycar crashsubjective cameratoiletaccidentdream sequencedrawingflash forwardparkcharacter's point of view camera shotactinghandgunsurgerysyringecomapsychologistvirtual realitywomanizerdrug overdoseremote controlpillssufferingresurrectionmental hospitalimmortalitymakeupinfectiondisfigurementprison cellsurgeonpajamasswearingsymbolismatheistcontractsuffocationcartoon on tvimperative in titleplastic surgerymen's bathroommetaphorcoca colainsane asylumaccidental shootingvanitydisfigured facetv interviewmimeanorexiaarm wrestlingfrenchmandreamingtalking while drivingfamous lineeyessurgical operationsubconsciousreference to walt disneyreligion versus sciencedeus ex machinalynchiantranquilizerdream worldvertigosmotheringcaterercautionary talesense of sightcryonicsvanishingdream sequence within a dream sequencepsychiatricreference to jules verneprosthesismental problemracket ballatheism versus christianityreference to the phantom of the operafrench giallolife extensionspanish giallocryogenic technologyrhinoplasty (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Single Man (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Single Man (2009)

It's November 30, 1962. Native Brit George Falconer, an English professor at a Los Angeles area college, is finding it difficult to cope with life. Jim, his personal partner of sixteen years, died in a car accident eight months earlier when he was visiting with family. Jim's family were not going to … tell George of the death or accident, let alone allow him to attend the funeral. This day, George has decided to get his affairs in order before he will commit suicide that evening. As he routinely and fastidiously prepares for the suicide and post suicide, George reminisces about his life with Jim. But George spends this day with various people, who see a man sadder than usual and who affect his own thoughts about what he is going to do. Those people include Carlos, a Spanish immigrant/aspiring actor/gigolo recently arrived in Los Angeles; Charley, his best friend who he knew from England, she who is a drama queen of a woman who romantically desires her best friend despite his sexual orientation; and Kenny Potter, one of his students, who seems to be curious about his professor beyond English class. (Read More)

Themes:
memoryfriendshipdeathsuicidemoneypoliticsdrinkingfeardrunkennesslonelinessobsessiondepressiondrug useredemptiongrief …unrequited lovehomophobiafalling in lovegay love (See All)
Mood:
rainnightmare
Locations:
buscarbarbeachsnowmotorcyclelos angeles californialondon englandofficeocean
Characters:
ex husband ex wife relationshipfriendfather daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipmother daughter relationshipboybrother sister relationshipteachergirlstudent …dancerjewishgay kisshomosexualityteacher student relationshipmaidprofessorjewsecretarycousin cousin relationshipgay relationshipneighbor neighbor relationshipold friendolder man younger man relationship (See All)
Period:
1960s1940syear 1962
Story:
car accidentsuicide contemplationreference to elvis presleywatching tvunderwearcryingpartyphotographdancingflashbackdogbloodgunbased on novelnudity …male nuditymale rear nuditybare chested malekisscigarette smokingpistolshowertelephone callvoice over narrationdreamfoodmirrorurinationdrinkundressingbare buttbookriflebeertearsdead bodybathroomcollegeneighborclassroomswimmingcaliforniaeatingaccidentdinnerman with glassesunderwater scenedrowningtransformationbartenderskinny dippingpublic nudityfantasy sequencepay phoneangelreadingbankgiftisolationflowerclasssubtitled sceneheart attackrecord playertwenty somethingeyeglassescloseted homosexualshavingfireplacebulletheavy rainslow motionlistening to musicscene during opening creditsrecordingagingarchitectphone boothtennistowelcamera shot of feetmale prostitutedivinganti semitismpillsmourningblack and white sceneblack bracigarette lighterrosedaydreamrefrigeratorsnowingmale male kisshousekeeperlooking at self in mirrorbriefcasebriefsdeath of loved onemidlife crisisowlparking lotdead dognude swimmingnarrated by characterinvisibilitygun in mouthhead woundlecturescorpionlistening to radiohead injurygigoloswimming underwatercollege professorbroken heartmercedes benzbereavementmadrid spainmetal detectorpersecutionlighting a cigarettesitting on a toiletcollege campusdeskcar radioradio newssuicide noteclose up of eyedressingbroken bottlefinger gunnude photographsleeping on a couchoverhead shotenvelopeliquor storedrinking from a bottlepassing outsleeping bagkneelingbank vaultspaniardmale full back nuditytennis playernext door neighborsafe deposit boxman undressinginkcollisiondeath of partnerdeath of dogreference to james deanclose up of mouthdenver coloradobank teller21 year oldcuban missile crisisband aidaspiringinsaviorepiphanyrecurring dreamscotch whiskeyoverturned carshower curtainwaving goodbyecardiac arrestsanta monica californiabad newsbritish in americainsurance policylecture hallthe color redtwist the danceu.s. sailorburning a lettergun shopterrierlong term relationshipdog urinationpants around anklesmale sitting on a toiletspanish accentthe color blueburning a documentmescalinepencil sharpenerreference to charlton hestonkiss of deathmale hustlerforebodingeye linergin and tonicglass houseeye makeupfaculty loungelighting cigarette for womanloaf of breadeyebrowreference to aldous huxleylying on the floorreference to stanford universitykissing a dogreference to janet leighchest painsfox terrierknocking on a car windowwoman laughingbroken watchplanning a suicidered moon (See All)

No Reservations (2007) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

No Reservations (2007)

A master chef, Kate, lives her life like she runs the kitchen at upscale 22 Bleecker Restaurant in Manhattan--with a no-nonsense intensity that both captivates and intimidates everyone around her. With breathtaking precision, she powers through each hectic shift, coordinating hundreds of meals, prep …aring delicate sauces, seasoning and simmering each dish to absolute perfection. (Read More)

Themes:
deathpregnancydrinkingdeath of motherdepressiongrief
Mood:
rain
Locations:
kitchenhospitalnew york cityrestaurantschoolsnowcemetery
Characters:
single motherfamily relationshipsmother daughter relationshipdoctorsingerboygirlstudentdancersister sister relationshipartistactresswaitressgrandmother grandson relationshipaunt niece relationship
Story:
car accidentcookingsoccerwatching tvcryingsingingphotographdancingsexkisscigarette smokingtelephone callfirevoice over narrationcell phone …songfoodremakeslow motion scenedrinklettertearscafeneighbormanhattan new york cityorphanoperawinecandlemontageeatingaccidentfishsearchgraveyardparkgravedollblindfoldloss of mothertherapypizzarunawaypickup truckwaiteranswering machinebabysittercooktoytherapisteccentricchefhome moviebirthgrocery storejob interviewshoppingabsent fatherdeath of sistervoice over lettersnowingwishalarm clockphoto albumcartoon on tvrunning awayschool principalquitting a jobguardianloss of sisterscarfhiding under a bedgame playingopposites attracttai chilobstergoth girlspaghettiprecocious childpillow fightrecipepancakecrossword puzzlefatal accidentcuisinemealsteaksidewalk cafefish marketstuffed animal toyapronchinatown manhattan new york cityitalian foodcookbookmonopoly the board gamerefusing to eatwatching a cartoon on tvfemale chefbistrotruffleculinary artssense of tastefoie grasquailsous chefrestaurant criticsecret ingredientreference to puccinirestaurant reviewpeacock featherpulling tablecloth from under dishes (See All)

Before The Devil Knows You're Dead (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Before The Devil Knows You're Dead (2007)

Needing extra cash, two brothers conspire to pull off the perfect, victimless crime. No guns, no violence, no problem. But when an accomplice ignores the rules and crosses the line, his actions trigger a series of events in which no one is left unscathed.

Subgenre:
suspensemelodramaheistheist gone wrong
Themes:
dysfunctional familydrugsmurderdeathrevengeinfidelitymoneybetrayaladulteryfuneralrobberyextramarital affairdivorcedeath of motherparanoia …blackmaildrug useunfaithfulnessdeath of wifepanicmurder of husband (See All)
Mood:
neo noir
Locations:
hospitalnew york citybarrestaurantcemeterytaxipolice stationofficebrazil
Characters:
single motherbabyfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshippolicedoctorbrother brother relationshipbrother sister relationshippolice officernursethieflove trianglepolice detective …grandfather granddaughter relationshipbrother in law sister in law relationshipcrying baby (See All)
Story:
car accidenthidden gunsuicide contemplationpillowmaskunderweargunflashbackfemale nuditynuditymale nudityviolencefemale frontal nuditymale rear nuditybare chested male …sex scenecigarette smokingleg spreadingsurprise endingpantiespistoltelephone callcell phonebeatingshot to deathblood splattermirrorshot in the chestface slapshot in the headcomputerundressingsex in bedbare buttbirthdaylingerierock musicmanhattan new york cityshot in the backgay slurdisguiseambulancedrug dealercocainenonlinear timelinescantily clad femalecoffingraveyardgunshotflash forwardblack pantiessuburbfired from the jobwidowerliarpay phonesuitcasedebtshot in the shoulderfemale removes her clotheshairy chestwigdeath of husbandloss of mothercheating wifeheroinpizzagirl in pantieshypodermic needlelistening to musicsexual attractionbuttocksdysfunctional marriagefraudmasked manrear entry sexdiamondunfaithful wifeshopping mallsibling rivalrymarital separationextortionloss of husbandkilling spreesirenreckless drivingparking lotpillimpotenceadulterous wifesuffocationunhappy marriagecafeteriamental breakdownfemale removes her dresssnorting cocainephysicianeuthanasiaarmed robberymallhot dogcredit cardmercy killingbusiness cardscene of the crimecdrio de janeiro brazilski maskgurneycar radiofilm starts with sexlack of moneyhipsterfake moustacheschool playbaseball fieldscrabbleex wifejewelry storecity parkdriver's licensetrophy wifewife leaves husbandfilicidebreaking glasssoftballdeath metallife supportbusiness executiveinner titlestrystdumb criminalcar rentalgetaway carservice stationdeath by suffocationperspectivechild supportjewel robberydriving testembezzlerauditbotched robberyman slaps mandepartment of motor vehiclesbrain deadcartoon on televisionfather murders sonshot through a pillowheart monitorjewellerdestroying a roomwestchester new yorkfade to whiteripping a telephone from the walldrug theftreal estate officesoftball gamecritical conditionyouth sportsfalling through a glass doorwiping off fingerprintscaftancriminal fence (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Chocolat (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Chocolat (2000)

When a single mother and her six-year-old daughter move to rural France and open a chocolate shop - with Sunday hours - across the street from the local church, they are met with some skepticism. But as soon as they coax the townspeople into enjoying their delicious products, they are warmly welcome …d. (Read More)

Themes:
friendshipdeathmarriagereligionpoliticscorruptiontheftprejudice
Locations:
bicyclebarschoolchurchsnowcemeterysmall townboatvillagerural settingfrancecatholic churchboat on fire
Characters:
single motherfriendfather daughter relationshiphusband wife relationshipmother son relationshipmother daughter relationshipboyfemale protagonistgirldancermusicianwriterpriestthiefchristian …catholicmayorgrandmother grandson relationshipgrandmother granddaughter relationshipgrandfather granddaughter relationshipself righteousness (See All)
Period:
1950s
Story:
imaginary friendreference to elvis presleysingle parentcookingcryingpartyphotographdancingdogflashbacksexf ratedbased on novelnudityviolence …one word titlekissfightknifefirevoice over narrationfoodletterlietearscafeclassroomprayerguitarold manwomanmontageeatingwidowapologybirddrawingbirthday partyritualgraveyardold womanconfessiondrug addictpassionstorytellingsuitcasestatueflowersdomestic violenceinjectioncountrysidemagical realismclassarsontraditionpiratedestinybreaking and enteringslow motioncrucifixstealinggossipirishfestivalburialfood in titlemoralitygypsybloody nosewindreference to satancard playingabsent fatherabusive husbandatheistshowsermonchocolatedriftercremationtemptationconfessionaloutsidertween girlrumorwormeasterguitar playernursing homeashesfablehistorianhair salonpleasurekangarooaphrodisiacbouquetrebirthchurch bellwife leaves husbandcentral americafeastportrait paintingrepentancepagancountesshair dryerdiabeticjugglersmall businesswife abusehouseboatcountinsulingluttonyfertilityabstinenceold people's homeillegitimate daughtervowfastingcremated remainsriverboatfire eatergourmetbattered womancandy storered capehot chocolatenightshirtseventy somethingchiligypsy campprovincial settingpublic moralityletter openercocoapastry shopyearningrighteousnesscafe ownerapothecaryriverbanklentpenitenceremedybook of poetrycontritiondowagerfictional villagehit with a skilletthrowing cremated ashes to the windhit on the head with a skillet (See All)

I Am Sam (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Am Sam (2001)

Sam Dawson has the mental capacity of a 7-year-old. He works at a Starbucks and is obsessed with the Beatles. He has a daughter with a homeless woman; she abandons them as soon as they leave the hospital. He names his daughter Lucy Diamond (after the Beatles song), and raises her. But as she reaches … age 7 herself, Sam's limitations start to become a problem at school; she's intentionally holding back to avoid looking smarter than him. The authorities take her away, and Sam shames high-priced lawyer Rita Harrison into taking his case pro bono. In the process, he teaches her a great deal about love, and whether it's really all you need. (Read More)

Themes:
friendshiplovekidnappingfearangerdivorceobsessioneducationadoptiondisabilityautismfather love
Locations:
hospitalrestaurantschoolswimming poollos angeles californiacourtroomtunnel
Characters:
single fathersingle motherbabyfriendfather daughter relationshipfamily relationshipshusband wife relationshippolicemother son relationshipchildrenprostituteteachergirllawyerreference to god …little girlnew babyself deprecation (See All)
Story:
huggingsingle parentsoccerrunningwatching tvcryingdancingcharacter name in titledogf ratedkisstitle directed by femalearrestpaintingbook …tearsbirthdayneighborpianoclassroomhalloweencaliforniamontagejudgebirthday partycoffeepainparkreadingu.s. presidenthalloween costumecourtsadnessobscene finger gesturehatefreeze framerunawayanswering machineballoonslow motiontape recorderrecordingpsychologistcheating husbandbirthcompassionstupidityattorneysufferingshoesanxietylosthandheld cameraswingsocial workerhalloween partycoffee shopcartoon on tvparenthoodmental retardationscooterfemale lawyercostume partyrhyme in titleunhappinessfatherhoodlocked doorchild custodyhandicapporschedown syndromesoccer matchwatching a videolearningthe beatlesclimbing out a windowoverhead shotpillow fightbedtime storyreference to john lennonfoster childcustodyfoster carefoster homeshoe storecustody battleorigamipaper airplanefoster parentchildren's bookcheckersfoster motheranxiety attacksitting in a treesocial servicesdog walkerboy dog relationshipreference to paul mccartneypatienceseven year oldgirl scoutgirls' soccerbarred windowpro bono7 elevenabusive childhoodchild endangermentcustody hearingpizza hutstarbucks coffeetoy pianomaking coffeedog walkingmentally handicapped manchanging a baby's diaperdr seussmentally challenged maleschool recessyellow pagessoccer refereestuffed rabbitabbey road album cover recreationcrossing fingersgirl scout cookiessecond job (See All)

The Science Of Sleep (2006) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Science Of Sleep (2006)

Following the death of his father in Mexico, Stephane Miroux, a shy insecure young man, agrees to come to Paris to draw closer to his widowed mother Christine. He lands a boring job at a calendar-making firm and falls in love with his charming neighbor Stephanie. But conquering her is no bed of rose …s for the young man and the only solution he finds to put up with the difficulties he is going through is escape into a dream world... (Read More)

Subgenre:
independent filmabsurdismvideostop motion animation
Themes:
memoryfriendshiplovesurrealismsuicidejealousydrinkingdrunkennessescapeartmagictraveldeath of fathertime traveldating
Mood:
nightmaremoving
Locations:
barparis franceboatbathtubtaxiapartmentpolice carfrancerooftopmexicomexico city
Characters:
single fatherfriendfamily relationshipshomosexualfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipsingerboypolicemandancermusicianwriter …artistinterracial relationshipfrenchemployer employee relationshipneighbor neighbor relationship (See All)
Story:
daydreamingtelevision setpillowjokecookingrunningwatching tvunderwearpartysingingphotographdancingbloodflashbacksex …female nuditymale nudityfemale frontal nuditymale frontal nuditykisscigarette smokingmale full frontal nuditypantiestelephone callfirevoice over narrationsongdreamhorsemirrordrinkletterpaintingbookliebedcar crashlow budget filmneighborpianohallucinationmale pubic hairguitarrivertelevisiontelephoneswimminggay slurbedroombandconcertold mandrug dealerbridgewidowdinnerapologydream sequencedrawingbathold womanmarriage proposalparkspermcharacter's point of view camera shothalloween costumelong takepianistdatesleepingtypewritersubtitled scenemoonbirthday cakeeyeglassesdisasterpornographyanswering machineshavingflyingbreaking and enteringslow motiontape recorderhelmethatmagicianbuttockseccentriccomposerflatulencevirtual realityhome moviepart animationschizophreniarealityearthquakecelebrationremote controlreverse footageimaginationtrappedshoesconstruction siteinventorbackstagerejectiondrummerairplane crashvolcanoalternate realityskiingturtlevoice over letterbalconybriefcasefieldbenchlandlordbraintelepathydrumshorseback ridingcoffee shopreflectionearphonesconfusionnew jobmagic trickbandagerepeated scenetime machinestairwayfenceinventiontrashbroken windowskyscraperclimbingteasinglanguage barriercloudlandladyhead injurysense of smellmoving incowarddarkroomacoustic guitarsushipark benchfeetgrassknittingcircular staircasedrillfart jokecollectionman on fireschizophrenicunwanted kissdreamingorganspaghettishopping cartcalendarpeep holeclimbing out a windowsleepwalkingfootprintmodern artcutmuraljumping out a windowtalking to selftv hostbasssweatervoice over inner thoughtsfreezerdinner tablebody imagehand injurymirror ballsubconscioustv setfloatinghead bandagecat costumedoor bellfalling out a windowgirl next doorpaper airplanereference to aristotlepitylive televisionsinkcross culturalfree loveillustratorfigurinemulticulturalismchalkdream worldphotocopierstuffed animal toymother's boyfriendopening nightreference to mozartlesbian slurart collectionbear costumeanimal costumereference to wolfgang amadeus mozartmake believesideburnsthermometerframeski liftstocking capbicycle helmetfeng shuihole in the wallparallel worldssleepwalker3d glasseslandlord tenant relationshipthe color redpraying mantiswoman as objectcardboardelectric razormonorailparallel timebackwardstelevision broadcastingarmpitreference to martin scorsesedreamscapeelectric drillvolcano eruptionmultiple languagesgraphic artistportfolioupright pianographic designerarmsclothes hangercopying machinereference to duke ellingtonsoaking feetfrench womanhandednessinner childbig bosschairliftgiant handsmall carbackground singerdrum rollnude imagepointy earscellophanedream machineno smoking signloft bedmechanical horsesubconsciousness (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Blood In, Blood Out (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blood In, Blood Out (1993)

Based on the true life experiences of poet Jimmy Santiago Baca, the film focuses on step-brothers Paco and Cruz, and their bi-racial cousin Miklo. It opens in 1972, as the three are members of an East L.A. gang known as the "Vatos Locos", and the story focuses on how a violent crime and the influenc …e of narcotics alter their lives. Miklo is incarcerated and sent to San Quentin, where he makes a "home" for himself. Cruz becomes an exceptional artist, but a heroin addiction overcomes him with tragic results. Paco becomes a cop and an enemy to his "carnal", Miklo. (Read More)

Subgenre:
tragedyheistepicdisney
Themes:
friendshipmurderdeathrevengerapemoneybetrayalprisonfuneralrobberyracismtheftdrug useprejudicedrug addiction
Mood:
car chase
Locations:
kitchenbushospitalchurchcemeterylos angeles californiawheelchairpolice carprison rapepainting a car
Characters:
stepfather stepson relationshipfriendfather daughter relationshipfamily relationshipshomosexualfather son relationshippolicemother son relationshipafrican americantattoobrother brother relationshipboynursedetectivepoliceman …dancerlawyerthiefartistlatinobiblecatholichispaniccousin cousin relationshipuncle nephew relationshippolice shootoutgrandfather grandson relationshipaunt nephew relationshipdeath of boy (See All)
Period:
1980s1970s
Story:
car accidentcookingmarijuanarunningwatching tvunderwearpartyphotographdancingflashbackbloodgunsexfemale nuditymale nudity …violencekissfightcigarette smokingexplosionknifechasesurprise endingshowerbased on true storyshootoutbeatingfoodface slapcamerabare buttshootingpaintingriflesunglassesbirthdayshot in the backgangcaliforniastrangulationstabbingeatingcocaineprisonerboxingbirdpaintercoffinvangraveyardracial slurlibrarydrug addictorganized crimestatueinjectiontragic eventcrossratlas vegas nevadaobscene finger gestureclass differencesgraffitiheroingaragehatepowerriotmachismodestinydrag queenhypodermic needleslow motionlawcrucifixdrug abuseboxerart galleryhonorburialtowelstreet lifemexicandrug overdoseprison guardbribecard playingundercover copcanemale male kissgrowing upjuvenile delinquentethnic slurlandlordreckless drivingmexican americanserial murderlatinaface maskgang warspit in the faceaccordionstreet marketmegalomaniacweightliftingstakeoutcripplecolombialoan sharkrehabilitationscholarshipcrotch grabroosterparolereference to ronald reagantequilabiracialmorphineu.s. marine corpsgrudgespray paintstudyingcity hallknife held to throatbandanagloveknife in the chestmuralprison riotbeverly hills californiacrossing selfguatemalarole modelostracismprobationel salvadorshooting upecuadorfoosballprotegebroken backprofessional hitblow torchlowriderpanamahalf brother half brother relationshipprison gangpain killerchicanoartificial legparoleestepbrother stepbrother relationshipdeath by overdosenarceast los angeles californiapcpwhite powerhair netaryan brotherhoodbarrioparole boardyucatanboxing clubgedsucking on fingerpaycheckreference to the los angeles lakersblack militantcholocutting one's handsan quentin penitentiarymurdered in a churchart competitionrecidivismreference to pancho villamexican gangu turncinco de mayoslamming a car door on someone's handlaw librarylos angeles river channelreference to little bo peep (See All)

Billy Elliot (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Billy Elliot (2000)

County Durham, during the endless, violent 1984 strike against the Thatcher closure of British coal mines. Widower Jackie Elliot and his firstborn, fellow miner Tony, take a dim view of 11 year-old second son Billy's poor record in boxing class, which worsens when they discover he sneakily transferr …ed to the neighboring, otherwise girls-only-attended ballet class. Only one schoolmate, closet-gay Michael Caffrey, encourages Billy's desire, aroused by the teacher, who judged him talented enough for private lesson, to train and try out for the world-renowned Royal Ballet audition. Only the prospect of a fancy career unimagined in the pauper quarter may twist pa and big brother's opposition to indispensable support. (Read More)

Subgenre:
independent filmmartial artscoming of age
Themes:
friendshipdeathinfidelitychristmasmoneyadulteryfeardrunkennessdanceextramarital affairdeath of motherpovertyunfaithfulnesssexualityhomophobia …death of wifechildhood (See All)
Mood:
affection
Locations:
busschoolcemeterybathtublondon englandelevatordance school
Characters:
self discoveryfriendfather daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshippolicemother son relationshipmother daughter relationshipdoctorbrother brother relationshipbrother sister relationshipteacher …policemandancerbest friendbullyteacher student relationshipgrandmother grandson relationshipgay frienddance teacherself expression (See All)
Period:
1980s1990syear 1984
Story:
pillowpostmanmailworking classhuggingrunningunderwearcryingphotographdancingcharacter name in titlebloodsexnuditymale nudity …violencekisscigarette smokingchasetelephone callbeatingurinationface slappunched in the facebare buttletterbooklietearsbathroompianoclassroomgay slurmontagetoiletboxingjudgebathgraveyardgravelibrarycoming outwidowerauditiongympianisttragic eventsadnessloss of motherballetclasscross dressingsacrificetrustrecord playerriottransvestiteshavingdresseggslow motionlistening to musicrecordingdemonstrationcommunisthammerboxerloss of wifecrushcompassionmilkembarrassmentchild's point of viewsexismtheatre audiencemakeupschool uniformlipstickfriendship between boyssnowingdead motherferryjoypiano playerearphonesjewelryelectricitystage performanceteachingapparitiongay bashinginspirationfenceescalatorstrikelibrariantombstonegay crushmooningtransvestismpunching bagsurrogate motherminersoccer ballmusic boxlabor uniontalentcircular staircasesnowmankiss on the cheekchristmas lightscoalswantap dancingballet dancerpillow fightdance classboxing gloveschanging roomwashingcoal minenightstickjumping on a bedmerry christmastriumphmale dancerlaborercoal minersledge hammerpolice vanmotivationriot policestickmine shaftdance instructormining townnorthern englandreference to fred astaireboxing traineragainst the oddsgay kidapronfollowing a dreampawnbrokerdancing in the streetpicket linespinningtutuballet schoolballet teacherphysical examreference to ginger rogersbilly clubboy dressed as a girldressing upballet dancingsliding doorimpatiencejewelry boxstuffed toy animalgarglingbreakthroughstanding on a tableminers strikenewcastle upon tynescabswan lakeboxing lessonmobile libraryriot shieldboy wearing lipstickriot gearsoccer shirtboogieboy boy kissboy wearing a dressbreakfast trayletter of acceptancedestroying a pianofalling into a bathtubroyal ballet school (See All)

Disturbia (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Disturbia (2007)

After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu …rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)

Subgenre:
black comedysuspense
Themes:
friendshipmurderdeathrevengekidnappingbetrayaljealousydrinkingescapeinvestigationvoyeurismpsychopathdeath of fatherparanoiaphotography …panicmurder of a police officer (See All)
Mood:
neo noirhigh schoolslasher
Locations:
bicyclecarswimming poolpolice carcourtroomrooftopstormfishing boat
Characters:
friendfather daughter relationshipfather son relationshippolicemother son relationshipteenagermother daughter relationshipboyteenage boyteacherserial killerstudentpolicemandancerwriter …police detectivevillainterrorcousin cousin relationship (See All)
Story:
reference to youtubecar accidentbaseball batrunningwatching tvpartydancingblooddoggunviolenceone word titlekissfighttitle spoken by character …knifechasetelephone callcell phonecorpseblood splatterfoodpunched in the facecomputerdrinkarrestbikinibookplace name in titledead bodybathroomneighborhandcuffsvoyeurclassroomswimmingnewspapervideo camerawomaneatingimpalementstabbed to deathstabbed in the chestjudgesevered headtrialfishingduelflash forwardbinocularssuburbmissing personevil manreadingrabbitlightningskeletonpranklong takescarwighigh school studentstalkingwitnessbasementneck breakinggardenclassobscene finger gesturesubtitled scenegaragemaniacflirtingtv newsteen angstbreaking and enteringlistening to musicsociopathcaptiveassaultpsychoskullparking garagebroken legrampagebarefootwoman in jeopardywindtelescopethunderspanishbroken glassshovelscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreereckless drivingchocolatexboxpsychopathic killerbad guyearphonesmadmanboredomclosetlaundryhuman monsterhomicidal maniaccoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostlawn mowerchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Eternal Sunshine Of The Spotless Mind (2004) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Eternal Sunshine Of The Spotless Mind (2004)

A man, Joel Barish, heartbroken that his girlfriend Clementine underwent a procedure to erase him from her memory, decides to do the same. However, as he watches his memories of her fade away, he realizes that he still loves her, and may be too late to correct his mistake.

Subgenre:
independent filmcult filmblack comedystoner comedytragicomedy
Themes:
memorysurrealisminfidelitybetrayaljealousyadulterydrinkingfearextramarital affairlonelinessunfaithfulnesspoetrybreak upamnesia
Mood:
rainnightmare
Locations:
beachtrainsnow
Characters:
self helpbabyhusband wife relationshipboyfriend girlfriend relationshipdoctorchildrenboylove triangleolder man younger woman relationshipex boyfriend ex girlfriend relationshipchinese food
Story:
car accidentpillowmarijuanarunningwatching tvunderwearcryingpartyflashbackdogmasturbationbare chested malefighttitle spoken by characterpanties …telephone callfoodblondecomputerdrinkpaintingbeertearsbedcleavagewomaneatingsubwaynonlinear timelineman with glassesdrawingdrowningtransformationpainflash forwardlibraryblack pantiescharacter repeating someone else's dialogueprologuedollamerican flagdisappearancefemale removes her clothesredheadtherapybralessgirl in pantiesicesyringenipples visible through clothingbreaking and enteringtold in flashbackelephanthammerwatching a moviecrushparadereverse footagenostalgialove at first sightbookstoredark pastnervous breakdownbriefstank topmelancholychildhood memorytelepathysuffocationheartbreakrepeated scenemental breakdownpink pantiesmini dressthong pantiespartial female nudityinfatuationstonedbeach houseaudio cassettewoman in lingerieexperiment gone wrongvalentine's dayparallel universedrug humorbrain damagesecret pastmcdonald's restaurantmultiple perspectivesdeja vuwagonblue haircrotch shotsleeping pillborderline personality disorderdyed hairchopsticksbritish actor playing american characterfrozen lakeloss of girlfriendhidden truthgreen hairreference to friedrich nietzschemotivationalstartledstar gazingprintersinkplaying against typewanting to have childrenwatching someone sleepwoman wearing a thongcovered female frontal nudityerased memoryinside the mindnew beginningbrain scantitle based on poemwanting a babyconstellationimpulsivenessindian musiclifting up dressreverse chronologyprogramminglift skirtdown blouseman wearing tidy whitieschinese takeoutsecond thoughtsforced perspectivemultiple rolesdrive in movie theatremanic pixie dream girlfebruaryriding a trainremote control airplaneretrograde narrativesnow globeangry ex girlfriendfrozen rivergift wrapped presentred haired womansliding on icelost in thoughthypothetical flashbackmontauk long island new york (See All)

Children Of Heaven (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Children Of Heaven (1997)

Zahra's shoes are gone; her older brother Ali lost them. They are poor, there are no shoes for Zahra until they come up with an idea: they will share one pair of shoes, Ali's. School awaits. Will the plan succeed?

Themes:
friendshiplovereligionpovertyillness
Mood:
rain
Locations:
bicycleschoolwaterurban settinglakestormbicycle accident
Characters:
babyfriendfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipchildrenboybrother sister relationshipgirlstudentphotographerlittle girl …little boyteacher student relationship (See All)
Story:
pair of shoesjumpingsoccerrunningwatching tvcryingdogcamerasecretlietearslow budget filmneighborclassroomriver …competitionvideo camerabridgeunderwater scenesearchliarlightningbrotherclassracingtrusttearaceslow motionhonorstreet lifeiranpromiseshoeschild's point of viewintriguelostblind mantrophylandlordceremonygardeninglaundrysneakerssubtitlesbicyclinggardenerprizegoldfishprincipalshoeiranianblackboardbakerymosqueschoolteachersaltvictorypotatocommitmentpencilwinnersugarhijabtehran iranbubblesocksschoolyardperseverancesibling relationshipbullhornneorealismgarbage collectorrugolder brotherfoot racegrocerblisterlistening to the radioshoemakerlatenesscouponfingernailrelay racebrake failurelong distance runnerballpoint penlate for schoollost shoeslippersoaking feetguttertime watchkoi pondholiday campcobbler the shoemakerschool recessdistance runninglong distance race (See All)

The Rules Of Attraction (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Rules Of Attraction (2002)

Camden College. Sean Bateman is the younger brother of depraved Wall Street broker Patrick Bateman. He's also a drug dealer who owes a lot of money to "fellow" dealer Rupert Guest, as well as a well-known womanizer, for he sleeps with nearly half of the female population on campus. Lauren Hynde is,  …technically, a virgin. She's saving herself for her shallow boyfriend, Victor Johnson, who's left the States to backpack across Europe. Her slutty roommate, Lara, has the hots for Victor as well. Paul Denton, who used to date Lauren, is openly bisexual and attracted to Mitchell Allen, who's dating Candice to prove to Paul that he's not gay. Sean loves Lauren. Paul loves Sean. And Lauren may love Sean. (Read More)

Subgenre:
independent filmcult film
Themes:
drugsdeathsuiciderapemoneydrinkingdrunkennessvoyeurismseductiondrug usedatingunrequited lovecheating
Mood:
satire
Locations:
buscarhospitalrestauranthotelsnowmotorcycleparis francebathtublondon englandbathtub suicide
Characters:
homosexualmother son relationshipdoctorsingerstudentdancerlove trianglegay kissprofessorlove lettersuicide by slashing one's wrists
Story:
mailrock 'n' rollbaseball batmarijuanamaskwatching tvunderwearcryingpartysingingdancingdoggunbloodflashback …sexfemale nuditybased on novelnuditymale nuditybare breastsfemale frontal nuditymale frontal nuditymasturbationmale rear nuditykissfemale rear nudityfemale full frontal nuditycigarette smokingnipplesknifepantiestelephone calltopless female nudityvoice over narrationsongbeatingmirrorurinationblondepunched in the facecomputerdrinkcondomundressingthongbare buttvomitingbeertearssunglasseslingeriecafebathroomcollegevoyeurmale pubic hairguitarsubjective cameracleavagebisexualgay slurbracandletoplessvideo cameraambulancedrug dealermontagecocainesuicide attemptnonlinear timelinescantily clad femaleroommatespankingpublic nuditycharacter repeating someone else's dialoguevirginprologuekaratefantasy sequencecharacter's point of view camera shotsplit screeneuropefreeze framegirl in pantiessexual fantasyno pantiesloss of virginitymacheterome italydrug abuseskateboardblack humorvirginityend of the worlddead womantoweldrug dealingdrug overdosereverse footagebloody nosepillsboxer shortshit in the crotchnippleblack bratime lapse photographyraised middle fingerlens flareswitzerlandbrushing teethpromiscuitywoman in bathtubdesert eagledormitorymultiple storylinebongplaying pooldefecationcafeteriaeiffel tower parisnudeanal rapepush upsnude girlamsterdam netherlandswetting pantsvenice italywrist slittingmailboxpipetopless girlnaked dead womandublin irelandcollege campusfootball teamrepeated linebarcelona spainreference to michael jacksonteen suicidedate rapejack o'lanternburning manmultiple perspectivesfilm studentflorence italyclarinetlaundry drying on clothes lineshooting uplawn sprinklerwoman in a bathtubabstinencevenereal diseasewhitespitting on someonemultiple narratorsecstasy the drugfag hagcollege girlcollege freshmandead body in a bathtubstream of consciousnessbleachersrewinddead woman in bath tubdead body in bathtubpurplereference to johnny deppsoft focuskegbelly buttoncredits rolling downinner monologuekleenexfreebasingbloody bathtubreference to clara bowreference to gabriel garcia marqueztheme partytowel on headcommitting suicide while nakeddead woman in bathtubdartmouth collegekegger (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Before I Go To Sleep (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Before I Go To Sleep (2014)

Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen …ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)

Subgenre:
independent filmsuspensetragedypsychological thrillerfamily tragedy
Themes:
memoryfriendshiplovemarriageinfidelitybetrayaladulterypregnancyfearescapeinvestigationdeceptionextramarital affairangerdivorce …brutalityparanoiaguiltgriefunfaithfulnessillnessmental illnesspanictraumaamnesiaforgiveness (See All)
Mood:
neo noirnightmare
Locations:
kitchencarhospitalschoolhotelairplanelondon englandairportelevatorpolice carenglandfire truck
Characters:
self discoveryex husband ex wife relationshipbabyfriendhusband wife relationshipfather son relationshipmother son relationshipdoctorboyteenage boyfemale protagonistteacherbest friendlittle boypsychiatrist …pregnant womandoctor patient relationship (See All)
Period:
1990s2000s2010syear 1999year 2013year 2007
Story:
car accidenthiding placebritishrunningcryingpartyphotographflashbackbloodsexfemale nuditybased on novelnudityviolencesex scene …kissfemale rear nudityfightcigarette smokingchasesurprise endingshowertelephone callcell phonebeatingdreamblood splatterfoodmirrorface slapslow motion scenepunched in the facecamerawritten by directorarrestbare buttsecretletterliebedsex standing upbathroomhallucinationtelephonef wordsubjective camerafoot chasebedroomstrangulationambulancemontageeatingaccidentfalse accusationapologyno opening creditsdream sequencedrawingdouble crosssearchon the runflash forwardparkattempted murderargumenthotel roomdangerscreamingkeyattackliarcharacter's point of view camera shotknocked outdiarydomestic violencescarinjectiondeath of sonreunionsleepingtrusttherapygaragefreeze framesyringerevelationwarehousehypodermic needleheavy rainlooking at oneself in a mirrorlistening to musicsociopathcrying womantherapistnosebleedbarefoot malepsychologistparking garagefalse identitypresumed deadreverse footagetensionbloody nosemobile phoneblood on faceintrigueloss of sonimpostorbroken glasshousewifeescape attempthit on the headevidencesurprisewedding ringvoice over letternotepierbruisebenchnewspaper clippingholding handsmannequinphoto albumfast motion sceneclose up of eyesfiremanmemory lossanniversarymental patient12 year oldclosetnotebookmedical maskviolence against womenrepeated sceneschemeassumed identitydoubtfake identitytwist endingfriendship between womenhospital roomhospital bedwhisperinghearing voicesnewspaper articlehead injuryscene of the crimelocked doordomestic abuseseizurecamcorderrepeated linefacial scarmanipulative behaviorfirst person titlehitchcockiandistrustfully clothed sexwaking upwet clothesflashback within a flashbackbrain damageclose up of eyefade to blackman hits a womanwedding anniversaryman slaps a womanwrapped in a towelred herringman slaps womanloss of memorycityscapevideo diaryconcussionfire alarmlearning the truthdigital camerapretending to be someone elseman hits womanpsychological manipulationrepeated eventman fights a womanrepressed memorywine bottlehysterical outburstleft for deadbloody mouthhidden truthman punches a womanvideo recordingobservatoryreconstructionsedativefemale star appears nudepenis slurkiss on the foreheadhummingmanipulative mandead sonoutburstpeepholeprivate investigationbirth certificatedisbeliefrepeated dialoguemysterious event40 year old8 year oldmentally unstablename tagfacial bruisechloroformedmale female fightwindshield wiperamnesiacmristanding in the rainviolent manmentally unstable womanbrushing one's teethclose up of handmentally unstable protagonistwoman wrapped in a towelhusband hits wifehusband slaps wifelocking a doorwrapped in a bedsheetbreaking a glassshort term memory losswedding photographlost memorymeningitiswaking up nakedgaslightingmistaken belief that someone is deadshoeboxill wifeshort term memorycamera shot of eyessick wifeanterograde amnesiareunited with familysearching for the truthskiing accidentage regressionhit with a lampchemistry teachermedical reportsick womanlooking through a peepholetalking to a camerasinging along to music (See All)

The Lovely Bones (2009) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lovely Bones (2009)

A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.

Subgenre:
suspense
Themes:
memorymurderdeathsurrealismrapedrinkingfuneralinvestigationvoyeurismobsessionredemptionpoetryhome invasionhopemurder investigation …death of daughterafterlifemissing child (See All)
Mood:
rain
Locations:
bicyclehospitalschoolsnowcemeterybathtubtaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water
Characters:
father daughter relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipdoctorbrother sister relationshipteenage girlteenage boyserial killerdetectivepolicemandancer …photographersister sister relationshiplittle girllittle boygrandmother granddaughter relationship (See All)
Period:
1970syear 1973
Story:
lost lovejoggingbaseball batsoccerrunningwatching tvcryingphotographdancingdogbloodflashbackf ratedbased on novelkiss …cigarette smokingtitle spoken by characterknifechasethree word titletelephone callfirevoice over narrationbeatingdreamcorpseblood splatterfoodcameradrinkfalling from heightpaintingbooktearsbirthdaydead bodyneighborvoyeursubjective cameraflashlightcandleaxemontageeatingno opening creditspainterunderwater scenesearchflash forwardtreestalkersuburbfantasy sequencesuitcaseevil manreadinglightningflowerspursuitsuspicionhatestrong female characterrecord playereyeglassespoembreaking and enteringhathammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesshopping mallfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwreckvacuum cleanerbroken windowdigging14 year oldfalling into watercornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousetoy storechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All)

Mr. & Mrs. Smith (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mr. & Mrs. Smith (2005)

John and Jane Smith are a normal married couple, living a normal life in a normal suburb, working normal jobs...well, if you can call secretly being assassins "normal". But neither Jane nor John knows about their spouse's secret, until they are surprised to find each other as targets! But on their q …uest to kill each other, they learn a lot more about each other than they ever did in five (or six) years of marriage. (Read More)

Subgenre:
martial artscult filmblack comedy
Themes:
memoryfriendshipmurderdeathmarriagechristmasmoneydrinkingdrunkennessescapedanceweddingdivorcegamblingexecution …panictechnology (See All)
Mood:
raincar chase
Locations:
kitchenbicyclenew york citybarrestauranthotelhelicoptermotorcycleairplanenightclubdeserttaxielevatorstormsinging in a car …yachtsuv (See All)
Characters:
friendfather daughter relationshiphusband wife relationshipmother son relationshipsingerboydanceractorhostagetough guyjewishbest friendwaitressjewchinese …sniper rifleengineer (See All)
Story:
car accidentmailmanbulletproof vestcookingrunningwatching tvunderwearpartysingingphotographdancingcharacter name in titledogbloodgun …sexf ratedinterviewkissfightexplosionknifechasesurprise endingpistoltelephone callfirecell phonesongshootoutfistfightfoodmachine gunmirrorshot in the chesturinationface slapshotgunrescuepunched in the facecomputerdrinksecretfalling from heightshootinglieriflebeerhand to hand combatsunglassesbomblingeriebedcafebathroomneighborhandcuffsreference to jesus christmanhattan new york cityshot in the backspynewspaperbraassassinwinecandleambushmassacrebasketballwomaneatingmixed martial artsboxingweapondinnerexploding carapologychilddisarming someoneassassinationhit by a carsearchmarriage proposalbinocularssuburbfbichampagnepassionsuitcasedollreadingkicked in the facetough girllightningsensualitygymcrosswitnessneck breakingtrapdie hard scenariotied upsemiautomatic pistolshot in the armsecret agentsilencerkissing while having sexciasubtitled scenetrusttherapygaragestrong female characterak 47eyeglassesmissiletv newsuzihand grenadegrenadehead buttassassination attemptwoundmass murdertouristhelmetboxerexploding buildingdysfunctional marriageblockbusterwristwatchsharkteddy bearbrooklyn new york citystrong female leadfollowing someonerocket launchers&mgun fupassportpump action shotgunremote controltarget practicesurveillance camerabootsconstruction sitedual wieldwhipbroken glassevacuationm 16amusement parkcard playingassault riflewedding ringknife throwingtangosecret identityreckless drivingsign languagedaggergatling gunmannequinlaptop computerfemale assassindesert eaglebazookaearphonesdark secretcar racegolf clubarms dealerquick drawstandoffgardenerskyscraperflaskdepartment storecredit cardstakeoutveganbaseball capmailboxlocked doormeat cleaverbreaking a windowatlanta georgiamurderessexploding housedistrustsleeplessnessbutcher knifeman on firetoy gunsaltwhite brareference to the virgin marydeath of parentstargetdicemountain climbingelevator shaftgoggleswedding anniversaryu.s. mexico borderovenmartinitime bombart historywall street manhattan new york cityarsenalconvoypenthousesecret lifebody armorshooting galleryroom serviceconey island brooklyn new york citywelderhk 5 machine gunblack leatherneonpliersslip the undergarmenthit with a golf clubdune buggywoman murders a manmarriage counselingsecret compartmentslothbogota colombiafictional government agencyautomatic pistolwedding videomorning afterreading in bedd box motion codepvcreconnaissancefrench rivierathumbcurtainsbuilding constructionnewspaper boybuilding contractorchristmas morningmassachusetts institute of technologytool shedhusband hits wifepeace corpsknife in the thighseductive dancewoman breaks man's neckdatabasedriving in the wrong directionpicket fencecomputer technologyhusband and wifepurposeful car accidentfirst meetinghusband wife teamhusband wife fightsoccer on tvabandoned airfieldliving with one's mothergift cardmuzakpower grid (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Biutiful (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Biutiful (2010)

Uxbal, single father of two children, finds his life in chaos as he is forced to deal with his life in order to escape the heat of crime in underground Barcelona, to break with the love for the divorced, manic depressive, abusive mother of his children and to regain spiritual insight in his life as  …he is diagnosed with terminal cancer. (Read More)

Themes:
memorydrugsmurderdeathmarriagereligionmoneybetrayaldrinkingfeardrunkennessdrug usecancerredemptionguilt …griefillnessphotographyexploitationdyingpolice corruptionafterlifedying fatherdying from cancer (See All)
Mood:
rain
Locations:
hospitalbarbeachrestaurantschoolchurchforestsnowcemeterynightclubwoodspolice carstrip clubmexicotrain station …slumsex in a closet (See All)
Characters:
single fatherbabyfather daughter relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshippolicemother son relationshipmother daughter relationshipdoctorchildrenbrother brother relationshipboy …brother sister relationshipprostitutegirlnursepolicemandancerlittle girlgay kisslittle boychinesegay relationshipgay fathercrying babychinese foodgay asianbaby boypolice violencereligious iconsex with brother in lawasking for forgiveness (See All)
Period:
2000s
Story:
huggingsingle parentcookingrunningwatching tvunderwearcryingsingingphotographdancingbloodfemale nudityviolenceone word title …bare chested malekissfightcigarette smokingtitle spoken by characterchaseshowertelephone callcell phonedreamcorpsefoodmirrorurinationface slapdrinkarrestundressingthongvomitingtearsbirthdaydead bodycafebathroomjailhallucinationtelephonesubjective cameraorphanwinecandlestrangulationdrug dealermontageeatingcocainetoiletimmigrantsubwayaccidentfishdinnerchild abuseapologycoffinmarriage proposalpaingravemicrophoneprologuemassageringflowerspursuithairy chesttragic eventcrossdeath of soncharacter says i love yougay coupletrustterminal illnessafricanbirthday cakecloseted homosexualtv newssyringemedicinebreaking and enteringwarehousehypodermic needlelooking at oneself in a mirrorcakebabysitterice creamcrucifixmorguespiderdesperationgay parentstreet lifemale underwearpillssufferingboxer shortsconstruction sitemourningbackpackmedical examinationmarital separationmale male kisspolice raiddead boybriefsinjusticedead motherillegal immigrantowldormitorysuffocationg stringcremationconstruction workerbreast feedingrepeated sceneevictionsnorting cocainedead fathertv reporterblack marketconstructionclimbing through a windowdenialdying mansense of smellbreaking a windowmarriage problemsmediumsewing machinesitting on a toiletintentionally misspelled titledistrustbarcelona spainsleeplessness10 year oldpole dancerhappy birthday to youillegal immigrationspaghettimortuarywrapped in a towelstreet vendorchemotherapyasphyxiationbailbipolar disorderforkcrematoriumchild's drawingpneumoniadead parentsnoseblowing out candleheartbeatsparklerestranged couplemedical clinicwashing clothesatonementblood sampledead sonmass deathbed wettingdiamond ringout of body experiencetouching someone's breastsreference to mother teresaterminal cancerbelief in the afterlifeestranged wifesenegalsweatshopfastingwetting oneselffootbridgeodorreference to disneylandwraithbad newsdeath by suffocationviolence against a childembalmingcarbon monoxide poisoningface woundnude dancingprostate cancerseven year oldupside down viewwaiting in lineincontinencechinese immigrantmale wearing an earringsense of soundtalking with the deadhuman exploitationabandoned childadult diaperbeginning morphed with endingsenegalesemagnetic resonance imagingpounding on a doorreference to the united nationsbarred windowpyreneesreference to the dalai lamacommunicating with the deaddeath from cancerillegal workerkid artstrip club ownerboogerheaterdeath by asphyxiationmale ponytailreference to francisco francopierced eartalkativenessboy smoking a cigarettedead body on beachprostate exammisspelled worddead body floating in waterreference to jack danielsappliance storebody washed up on beachhitting a childsilent sceneblack marketeersurrealism sequenceurinating bloodmultiple tv screenssent to one's room (See All)

Shaolin Soccer (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Shaolin Soccer (2001)

After a fateful mistake costing his career, an ex-soccer player bum meets a shaolin kung fu student trying to spread the word of kung fu. The ex-soccer player helps reconcile with his five brothers, and teaches them soccer, adding shaolin kung fu as a twist.

Subgenre:
martial artscult filmabsurdismslapstick comedycult comedykung fu comedy
Themes:
friendshipmurderloverevengesuicidemoneydrinkingdrunkennessdanceartdeceptionbrutalitydrug useredemptionhumiliation …greedcrueltyself sacrifice (See All)
Mood:
spoof
Locations:
bicyclebusbarswimming poolnightclubrooftop
Characters:
friendchildrentattoosingerbrother brother relationshipdancerphotographertough guybest friendhomeless manself respect
Story:
soccer playersoccerwatching tvunderwearcryingsingingphotographdancingflashbackbloodnuditymale nudityviolencebare chested malefight …cigarette smokingtelephone callfirecell phonesongbeatingdreamfoodmachine gunurinationface slapslow motion scenepunched in the facecameradrinkswordbare buttfalling from heightvomitingbeertearssunglassesguitarkung fureporterswimminggood versus evilbanddeath of friendeatingfootballtoiletapologyunderwater scenecigar smokingflash forwardspiritualityfired from the jobwritten and directed by cast memberumbrellacharacter's point of view camera shotproduct placementknocked outinjectiontrapchampioncross dressingnewspaper headlinefreeze framecoacheyeglassesgolffalling down stairsgamesupermarketathletehead buttlifting someone into the airwalkie talkiekicked in the stomachcgihonortournamentcompassionmonkstreet lifebossbroken legjanitorgrocery storetarget practiceshoesteamanimated sequenceobesitym 16drummerballbribemedicationblack and white scenecigarette lightertime lapse photographystadiumtrophyrefereehit with a baseball batdrumsunderdogneedlesneakerssports teamlong hairinspirationremorsebreadmakeovermallwhistlecheering crowdtornadohanging upside downdepartment storeflycripplemasterkindnessteamworktolerancefootball teambeauty salonmartial artlimptai chisurrenderfemale athletegymnasticsfake moustacheheadachespray painttoilet paperrecyclingleg injurytear on cheekbaldnessangry mobdefeatchanging roomfootball coachsteel helmetwashing dishesanimated opening creditssong and dancemob of reportersshaolindouble decker bussoccer teamwoman dressed as mandrink thrown into someone's facebeer bottlemagazine coverbamboohand woundsteroidscoin tossripping clotheswuxia fictionmalletcleaversecret weapongoalkeepermentally challenged personscuba diversoccer stadiumbruce leebeer canline dancingbald womanyin and yangslamming a doorsportsbowingbrick wallgolfinghit in the stomachathletic trainingbanana peeltime magazinewhite flagbroken bonechipswatching soccer on tvhit by a doorsoccer fieldstepladderstop actionbalding mansoccer practiceupward camera shotknee woundpolice whistleslipping on a banana peelwater thrown into someone's faceclothes blown offeating raw eggkick the cansplitsgarment on one's headwearing underwear on headbottle smashed on headinjection gun (See All)

Waitress (2007) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Waitress (2007)

Jenna is unhappily married, squirreling away money, and hoping to win a pie-baking contest so, with the prize money, she'll have enough cash to leave her husband Earl. She finds herself pregnant, which throws her plans awry. She bakes phenomenal pies at Joe's diner, listens to old Joe's wisdom, tole …rates her sour boss Cal, is friends with Dawn and Becky (her fellow waitresses), and finds a mutual attraction with the new doctor in town. As the pregnancy advances, life with Earl seems less tolerable, a way out less clear, and the affair with the doctor complicated by his marriage. What options does a waitress have? (Read More)

Themes:
friendshipmarriageinfidelitymoneybetrayaladulterypregnancyweddingextramarital affairunfaithfulnesscheating
Locations:
kitchenbushospitalrestaurantsmall townwheelchair
Characters:
baby girlsingle motherbabyfriendhusband wife relationshipmother son relationshipmother daughter relationshipdoctorsingerfemale protagonistnursedancerwaitressdoctor patient relationshipnew baby
Story:
huggingcookingcryingsingingdancingsexf ratedone word titlekisscigarette smokingtelephone callsongtitle directed by femalefood …mirrorface slappunched in the facesecretletterlietearscafetelephonenewspaperold manvideo cameramontageeatingdinerdinnerdrawingpantyhosepay phoneflowersdomestic violencechildbirthcontestfemale stockinged legswoman with glassesdysfunctional marriageministerlipstickwedding ringvoice over lettermarital problemlandlordabusive husbandwedding receptionsouthern accentunhappy marriagesouthernerpregnancy testbus stoppieunplanned pregnancyunwanted pregnancywriting a letterbegginggynecologistbakinghidden moneywaiting roomdoctor's officeman hits womanultrasoundwife abuseorange juicecribwoman in labordessertstar died before releasehoroscopecontrol freakdirected by co starsonogrambigger dreamscheesecakemorning sicknessgreeting cardobstetriciancar horndeath of cast memberpregnant woman's water breaksunhappily married womanbad poetrysaving moneymeat piewaitress uniformtarthonking a hornfood pornsearching for happinesspumpkin piequicheleaving husbandchocolate pie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Me And Earl And The Dying Girl (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Me And Earl And The Dying Girl (2015)

Seventeen-year-old Greg has managed to become part of every social group at his Pittsburgh high school without having any friends, but his life changes when his mother forces him to befriend Rachel, a girl he once knew in Hebrew school who has leukemia.

Subgenre:
independent filmcoming of ageblack comedyteen moviefilm parody
Themes:
memoryfriendshipdeathsurrealismdrinkingtortureangerdeath of fatherdrug usecancergriefdatinghumiliationillnessdying …regret (See All)
Mood:
high school
Locations:
bushospitalelevatorschool bus
Characters:
single motherfriendfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshiptattooboyteenage girlteenage boyjewish …reference to godself referentialself hatetheatre student (See All)
Story:
reference to gandhipanic attackpillowmarijuanawatching tvcryingsingingphotographflashbackdogbased on novelinterviewmasturbationfighttelephone call …voice over narrationsongfoodmirrorslow motion scenecomputercatdrinkbare buttsecretlettervomitingliecollegehallucinationreference to jesus christclassroomprayertelephonesurvivalbedroomambulancedrug dealermontageeatingapologytalking to the cameraflash forwardlimousineprologuestorytellingflowerswighigh school studentclasstrustblack americanterminal illnessnerdpot smokinglooking at oneself in a mirrorcomaice creammousetoyspiderclassical musicinterracial friendshippromisenicknamerap musicanimated sequenceheadphonesdespairco workerscissorssurprisee mailhologramcellphonetuxedogeeknarrated by charactercremationcafeteriastairwaysarcasmname callinglooking out a window17 year oldpopcornstonerclimbing through a windowsquirrelhearing voices15 year oldstonedunhappinesscookiesoupleukemiatestepilogueawkwardnessreference to googlehonestywakepolar bearhoodiekiss on the cheekreference to richard nixonhip hop musicgogglespittsburgh pennsylvaniahebrewoverhead shotchemotherapydoombaldnessbirthmarkhigh school seniortarantulathreat to killapple computerpretending to be deaddoorbellkindergartenharpjoke tellinglooking in a windowrappinglimousine driverpenis slurinner titlespityreference to andy warholgerman accentfilm fanchased by a dogschool expulsionunreliable narratorhistory teacherboys' bathroomhit in the stomachteenage drinkingreference to orson wellesstocking caphumilityschool cafeteriaaspiring filmmakertulipgroup hugreference to salvador dalicollege applicationfist bumpmotherly lovereference to francois truffautreference to akira kurosawatattoo on neckhigh school cliquecrawling on the floorreference to texashornetreference to indiareference to luis bunuelsociology professorcorsagecrying teenage girlreference to lebron jamesreference to wolverinebreasts slurcrying teenage boycuttlefishget well cardpig costumereference to julian assangereference to klaus kinskicartoon chipmunkpassive resistancereference to cat stevenscremated ashesreference to princeton universityreference to werner herzogwalking down the middle of a streetdestroying a bookreference to afghanistanreference to hugh jackmansenior prom (See All)

A Man Called Ove (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Man Called Ove (2015)

59 year old Ove is the block's grumpy man who several years earlier was deposed as president of the condominium association, but he could not give a damn about being deposed and therefore keeps looking over the neighborhood with an iron fist. When pregnant Parvaneh and her family moves into the terr …aced house opposite and accidentally backs into Ove's mailbox it turns out to be an unexpected friendship. A drama comedy about unexpected friendship, love and the importance of surrounding yourself with the proper tools. (Read More)

Subgenre:
dark comedy
Themes:
memoryfriendshipdeathmoneybetrayalpregnancydrinkingweddingfuneralinvestigationtravelangertheftdeath of fatherdeath of mother …cancergriefpoetrydeath of wifedeath of unborn child (See All)
Mood:
rain
Locations:
kitchenbicyclebushospitalrestauranttrainchurchswimming poolhotelsnowcemeterywheelchairtrain stationspainsinging in a car …fire truckbus accidentsinging on a bus (See All)
Characters:
self pitybabyfriendfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipdoctorboyteenage girlteenage boyteachergirl …nursepolicemandancerphotographersister sister relationshipreference to godlittle girlteacher student relationshipfrenchpregnant womanpregnantengineerneighbor neighbor relationshipsuicide by hangingsuicide by gunshotsuicide by asphyxiation (See All)
Period:
year 2014
Story:
joggingrunningcryingphotographdancingcharacter name in titleflashbackdogbloodbased on novelbare chested malekisschasetelephone callfire …voice over narrationfoodmirrorrescueslow motion scenecatcameradrinkletterbooklieriflecafeneighborreference to jesus christcompetitiontelephonef wordnewspaperorphanjournalistwinecandleold manambulancesuicide attempthousenonlinear timelineapologycoffinvoice overold womanmarriage proposalcoffeegunshotflash forwardgraveprologueclowncoming outwidowervacationflowershangingpresidentpursuitcrossthreatloss of fatherloss of mothersleepinggarageheart attackeyeglassesapplauseropelooking at oneself in a mirrorslow motionlistening to musicscene during opening creditstoyloss of loved onehammerloss of wifewristwatchladderblack humorfatebreakfastchokingmale underwearretirementpromiseredneckseriesattempted suicidebackpackhungershovellaughterfrustrationswedenvoice over letterbalconysnowingcanebroken armbriefspajamascoinholding handssaving a lifebarking dogloss of jobhit in the facehead woundwalletname callinglooking out a windowbitternessyoung version of characterhospital bedman in underwearsuicidaltrain tracksunsubtitled foreign languagereading a booknoosewheelchair boundwhite briefscar radiocar breakdownoverhead camera shotdead wifeeastern europenon linearhouse on firebride and groomnewspaper reporterhookburning buildingmotor scooterhit by a traintoy cardriver's licensebloody facewater hoserearview mirrorwashing dishestrain conductordriving lessonbouquet of flowersburning houseoxygen maskreference to mickey mousevolvowoman in a wheelchairhospital visitbuilding on fireparking ticketheavy breathinghonking a car hornsuicide thoughtsauto repairseat beltfeeding someonetrain compartmentred shoeselderly manmeet cutepast and presentleg in a castspoken inner thoughtselderly protagonistfalling off a ladderbus crashcar horncigarette buttdog urinationcradlegrumpy old mantrain yardreport cardbotched suicidedeath from cancersaabreference to christmasstepping on someone's footsuicidal thoughtvisiting wife's graveforced retirementreciting a poemreference to homerloss of homecat foodfalling to the floorrescue from firetwo daughtersfire rescuefalling onto train tracksrescued from a firebus falling off a cliffeating in a carburned out housedefecation slurgrumpy neighborparalyzed manreference to iranalmost hit by a trainlooking into a windowwomen's clothing (See All)

Tell No One (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tell No One (2006)

The pediatrician Alexandre Beck misses his beloved wife Margot Beck, who was brutally murdered eight years ago when he was the prime suspect. When two bodies are found near where the corpse of Margot was dumped, the police reopen the case and Alex becomes suspect again. The mystery increases when Al …ex receives an e-mail showing Margot older and alive. (Read More)

Themes:
memoryfriendshipmurderdeathlovesuicidekidnappinginfidelityrapepoliticsadulterydrinkingtortureescapewedding …investigationvoyeurismextramarital affaircorruptiondeath of fatherobsessionblackmaildrug useguiltgriefunfaithfulnesssurveillancedeath of wifeforgivenesspolice brutalitymurder investigationpolice corruptionmysterious deathmurder of father (See All)
Mood:
night
Locations:
bushospitalbarrestaurantforestparis franceairportelevatorwoodspolice stationpolice carfrancelakerooftop
Characters:
babyfriendfather daughter relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipdoctorboybrother sister relationshipgirlpolice officerserial killer …nursedetectivepolicemanphotographerlawyerwaitresskillerfrenchamericanpolice chasechildhood friendcoronerfather in law son in law relationshipmother in law son in law relationshipboy girl kiss (See All)
Story:
car accidentmailhaunted by the pastbaseball batrunningwatching tvunderwearcryingphotographflashbackdoggunbloodfemale nuditybased on novel …nuditymale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditybare chested malefemale rear nudityfightfemale full frontal nuditycigarette smokingmale full frontal nuditylesbian kisschaseshowertelephone callcell phonebeatingcorpseshot to deathfoodhorsemirrorface slapshotgunslow motion scenepunched in the facecomputercameradrinkarrestundressingbare buttsecretshootinglierifletearsdead bodycafejailvoyeurmale pubic hairrevolvertelephoneshot in the backsubjective cameraswimmingcleavagegay slurnewspapervideo cameramansioneatingfemale pubic hairinternetnonlinear timelinefalse accusationapologyman with glassesscantily clad femalecoffinassassinationforeign language adaptationsearchvanlatex glovesflash forwardconfessionparkskinny dippingsmokingbinocularsprologuekeymissing personcover upfemale full rear nuditylong takegymdisappearancepursuitcountrysidedeath of sonthreathorse ridingsadnessratsuspicionmurderertied upflowerhandguntypewritergraffitiheroinapplausetv newsbow and arrowrevelationinjuryred dresswalkie talkieloss of loved onedrug abusehidingloss of wifedesperationdriving a carfaked deathstreet lifeclockhomicidepresumed deadpassportretirementcamera shot of feetdivingphoto shoottensioninnocencesurveillance cameraplaygroundmourningburglarylesbian coupleautopsye maildeerhighwaycellphonesuspectpolice raidduckbruisenude woman murderedbenchsports cartan linechildhood memoryframed for murderdead dognude swimminganniversaryhandshakedark secretcremationstreet gangrepeated sceneabuse of powerstairwaystreet marketbitternessgun held to headframedtraffic jamfemale lawyermale rapehired killernude girlcigarettefallingscene of the crimeplaying a video gamednastableemergency roominsurancebody bagnaked dead womandocumentmurder of wifemultiple murderhitchcockiancircular staircasedead catanguishwoman undressingchild rapecriminal investigationtreadmillclimbing out a windowfinding a dead bodysurveillance footageintercomtelephone numbertrophy wifecrotch shotapple computerfemale in a showerstun gunhand kissingpocket knifealibistreet kidwife abusesafe deposit boxman undressingpokiesperjurydoor bellwood carvingequestrianransackinghitting a womanphoto studiosidewalk cafeaudio recordingbroken windshieldblood sample911 callwalking a dogwall safeinternet cafewiretapdead body in a car trunki.d.pediatricianbox cutterchildhood lovearm injuryprime suspectinsurance policyhemophiliahorse jumpingplanted evidencewatching a video on a computergarbage dumpsterbreaking a glassbluffingslipping and fallingwife beatingbandstandhorse stableidentifying a dead bodybody in a car trunkhunting accidentparisian outskirtsballisticsstreet riotoff screen suicidecar pileupcomputer storehiding in a dumpsterstate senatorcomputer searchhunting trophymounted deer headautopsy reportflower deliverymidnight swimdna sampledragged by hairheroin userinternal bleedingparc monceau paris (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Almost Famous (2000) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Almost Famous (2000)

William Miller is a 15-year-old kid hired by Rolling Stone magazine to tour with and write about Stillwater, an up and coming rock band. This wonderfully witty coming-of-age film follows William as he falls face first to confront life, love, and lingo.

Subgenre:
coming of ageteen moviesemi autobiographicalcoming of age film
Themes:
drugsfriendshipinfidelitymoneybetrayaladulterydrinkingdrunkennessdancetravelangerdeath of fatherdrug useguiltunfaithfulness …humiliationpoetrycheating (See All)
Mood:
high school
Locations:
buscarnew york citybarswimming poolhotelairplanelos angeles californiaelevatorroad tripsan francisco california
Characters:
friendfamily relationshipshomosexualmother son relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipsingerboybrother sister relationshipteenage girlteenage boyteachermusicianlove triangle …older man younger woman relationshipolder man younger man relationshipalcoholic drinkboy in underwear (See All)
Period:
1970s
Story:
single parentrock 'n' rollmarijuanarunningwatching tvunderwearcryingpartysingingphotographdancingsexfemale nudityfemale frontal nudityinterview …bare chested malekisscigarette smokinglesbian kisspantiesbased on true storytelephone callsongfistfightfoodurinationblondecameradrinkundressingsecretbookvomitingbeerbirthdayrock musicbathroomvoyeurguitaralcoholtelephonef wordswimmingcleavagejournalistbandconcertcaliforniaeatingsuicide attemptrock bandwhite pantiesscantily clad femaleconfessionlegendhotel roommicrophonevirginprologuecoming outelectrocutionpay phoneon the roadreadinglightningfemale removes her clothesloss of fatherpremarital sexstagecharacter says i love youpoetobscene finger gesturecheating wiferecord playerbirthday cakepot smokingloss of virginitylistening to musicfamesexual attractionrecordingguitaristoverallsmagazineeccentricjournalismcheating husbandvirginityrock starembarrassmentambitiondrug overdosebarefootrock concertpillsreconciliationboston massachusettstitle appears in writingdrummerthunderstormraised middle fingerred pantiesgrowing uptourbriefspromiscuityparking lotmale virgint shirtdrumsgraduationstage performancebongbandageadolescencepiano playingacidreference to the beatlesguitar playingstewardessdomineering mothertape recordinglsdkiss on the lipsmusic industrywhistlingteenage sexualityguitar playerunderage sexromantic rivalrysan diego californiateenage crushdrug humorironingrock musicianteenage girl in underwearroadtripgroupietour buswet clothessmoking marijuanaegocleveland ohiorock singersexual pleasureleaving homefalling off a rooffemale sitting on a toiletmusic businessaspiring writermusic concertmusic grouprock groupmusereference to led zeppelinreference to the rolling stonesphoenix arizonafalse nameillegal drugsreference to bob dylanfictional bandprogressive rockreference to david bowieinnocence lostbus tripegotismsurrogate familypill poppingvolkswagen bushallucinogenfollowing a dreamreference to elton johnteen sexualityjumping into a swimming pooltitle appears in textreference to pink floydclassic rock musicreference to jim morrisonteen drug useband memberreference to george orwellstudent mentor relationshipsunset stripcharacter appears on magazine coverreference to goetherecording artistclothes irondrumsticksjumping into a pool with clothes onreference to george orwell's 1984rolling stone magazinereference to the doorsbell bottomsdo not disturb signreference to iggy popreference to neil youngmanic pixie dream girlquaaludereference to lou reedpill bottlemusic journalismpill boxbackstage passdancing in one's underwearreference to alice cooperreference to the whoreference to black sabbathmending friendshipflying through a stormpill abusetopeka kansascharacter lies about agereference to deep purpletempe arizonareference to the allman brothers (See All)

The Kid With A Bike (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Kid With A Bike (2011)

At about 11, the stubborn and impulsive Cyril seems on his way to delinquency: he has no mother, his father wants a new life without him, so he's in a foster institution. He searches for his father, wanting him and his bike. Through the intersession of Samantha, a hairdresser Cyril happens upon, he  …gets his bike back, and she offers to take him into her home on weekends. He remains aloof from her and gets involved with a young crook. Is Cyril intent on driving Samantha away - and what then? (Read More)

Themes:
dysfunctional familydrugsfriendshiprevengemoneydeceptionrobberyangerlonelinesstheftdrug useredemption
Locations:
bicyclebusbarrestaurantforestelevatorwoodsgas stationrestaurant kitchenbicycle thief
Characters:
friendfamily relationshipsfather son relationshipmother son relationshipboyfriend girlfriend relationshipboynursethiefcousin cousin relationshipfathergrandmother grandson relationshipself respect
Story:
baseball batdrivingcookingsoccerrunningunderwearcryingbare chested malekissfightcigarette smokingchasecell phonefoodlie …tearssunglassescafetelephonef wordorphandrug dealereatingapologyparkliarpursuitsleepinggraffititrustsupermarketlistening to musicassaultpsychologistpromiseremote controlnicknamebreakupbackpackfairyabsent fatherboarding schooltrailerbriefsjuvenile delinquentriding a bicyclehit with a baseball bathandshakealleysandwichstreet gangrunning awaystolen moneynaivetyknocking on a doorknocked unconsciousunconsciousnessbare chested boybelgiumacceptancehead injurybikeplaying a video gamelocked doormuggingguardianclimbing a treesurrogate motherhair salonwashing machine11 year oldfather son reunioncircular staircaseclimbing out a windowmissing fatheryoung boythreat to killsearch for fatherwaiting roomfoster homehand kissingwatching someonebeing watchedcounselordoor bellentrapmentfalling from a treebrokeconciergeabandoned by fatherfoster mothereurotwo directorssurrogate sonseat beltgetaway carpardonhair dresserarm injurychance encounterfacial injuryfaucetcharcoalknocking on a windowhiding under the coverslocking a doorbackyard barbecuelarcenystone throwingfacial scratchstealing a bicycleboys' homekicking a doorknocked off a bicycleknocked to the groundempty apartmentliege belgium (See All)

The Brothers Grimsby (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brothers Grimsby (2016)

MI6's top assassin (Mark Strong) has a brother. Unfortunately for him, he's a football hooligan (Sacha Baron Cohen) from the town of Grimsby. Nobby has everything a man from the poor English fishing town of Grimsby could want - 9 children and the most attractive girlfriend in northern England (Rebel … Wilson). There's only one thing missing in his life: his little brother, Sebastian. After they were adopted by different families as children, Nobby spent 28 years searching for him. Upon hearing of his location, Nobby sets off to reunite with his brother, unaware that not only is his brother an MI6 agent, but he's just uncovered a plot that puts the world in danger. On the run and wrongfully accused, Sebastian realizes that if he is going to save the world, he will need the help of its biggest idiot. (Read More)

Subgenre:
martial artsblack comedyconspiracyabsurdismslapstick comedyfish out of waterbuddy comedygross out comedyspy spoof
Themes:
dysfunctional familydrugsfriendshipmurderdeathrevengekidnappingbetrayaltorturedrunkennessescapedeceptionseductiontheftbrutality …terrorismredemptionsurveillanceadoptionpanicunemploymentaids (See All)
Mood:
goresatirecar chasejames bond spoof
Locations:
bicyclebushospitalbartrainhotelhelicoptermotorcyclesmall townairplaneboatbathtublondon englandwheelchairpolice car …englandshipmuseumtrain stationsex in publiccar in watertwo in a bathtubboy in wheelchairboy in a wheelchairfishing town (See All)
Characters:
father daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshippolice officerpolicemanhostagetough guyactress …warrioraction herohitmansecurity guardalcoholicmaidsnipersniper riflepolice chase (See All)
Period:
2010szip line
Story:
car accidenthidden gunbulletproof vesthaunted by the pastworking classpubsoccerbritishwatching tvphotographcharacter name in titledoggunbloodflashback …violenceone word titlebare breastsmale rear nuditybare chested malefightcigarette smokingejaculationtitle spoken by characterexplosionknifechasesurprise endingerectionpantiespistoltopless female nuditycell phoneshootoutbeatingcorpseshot to deathblood splatterfistfighttesticlesmachine gunshot in the chesturinationshot in the headshotgunrescueslow motion scenepunched in the facecameracondomarrestgunfightbrawlbare buttfalling from heightshowdownheld at gunpointbeerhand to hand combatsunglassesplace name in titlecar crashinterrogationmale pubic hairscientistshot in the backf wordsubjective cameradecapitationspyfoot chasegay slurorphanassassinambushterroriststrangulationvideo cameradisguisedrug dealermontagebridgeimpalementmixed martial artstoiletstabbed in the chestfemale pubic hairmapfishwhite pantiesexploding carfalse accusationsevered headscantily clad femaledisarming someoneone man armychild in perilhit by a cardouble crossunderwater scenefemme fatalenews reportshot in the legshot in the foreheadon the runflash forwardpublic nuditylimousineone against manybinocularscharacter repeating someone else's dialoguebeaten to deathdangerperson on firefugitivepoisoncharacter's point of view camera shotmissionundercovermistaken identityrace against timecover upknocked outkicked in the faceopening action scenescene during end creditsstreet shootoutshot in the shoulderbodyguardinjectionexploding bodyneck breakingmercenaryprofanitysecret agentsilencerfireworksbare chested male bondageclass differencesespionageheroinfreeze framestylized violencehenchmangirl in pantiesriotak 47eavesdroppingmissilefalling down stairsburned aliverevelationhead buttassassination attemptwarehousefarcehypodermic needlescene during opening creditsviruselephantwalkie talkieexploding buildingkicked in the stomachvillainessswat teampress conferencejumping from heightculture clashsouth africaorphanagerocket launchermexican standoffcrushed to deathsocial commentarymasked manstupidityreverse footagefloodstealing a carface paintobesityimpostorchaospool tableevacuationkicked in the crotchescape attemptscene after end creditspunched in the chestjumping through a windowassault rifleinfectionaccidental killingaerial shotwisecrack humorundercover agenttigerbody landing on a carraised middle fingerstadiumgadgetlasersightterrorist plotburned to deathcrude humorwritten by stargrenade launchersurprise after end creditsfast motion scenebullet timerockettracking deviceenglishman abroadsatellitedesert eagleshot through a windowmale objectificationabandoned buildingbazookaterrorist groupalleycartoon on tvfinal showdownpromiscuous womantasershot in the neckdrug smugglingdefecationpistol whipassumed identityarmored carfake identityparkourarms dealertwo man armydronevulgaritymegalomaniacyoung version of characterbunkercommandercheering crowdflarehired killerexploding truckreference to donald trumpmooningman kills a womanhiv aidssaving the worldnymphomaniactop secretfilmed killingshot in the throatmetal detectorsoccer ballsoccer matchspaexploding housefart jokecamera phonescatological humorfundraiserimprovised weaponshot in the crotchwrongful arrestassassination plotbreaking a bottle over someone's headsocial decayvillain arrestedfake accentinnocent person killedfirecrackerticketthrown from a cartoilet humorchild swearinggross out humorantidotegadgetryreference to harry pottersexual innuendopenis jokedouble entendrehooligansurprise during end creditswater hosegadget carbiological weaponugandaodd couplezebrathick accentchambermaidsantiago chileanimal sexblack opsfirst personshipping containerbritish secret servicegay jokebritish intelligenceover the topthrown from heightcontact lensukrainiansibling relationshipsouth africanbleeped dialoguecoastal townnorthern englandsex jokecontroversialbroken anklediving suitpoison dartpool ballsideburnsmi6drug smugglerestranged brotherphilanthropistchavgreen dresscriminal organizationjakarta indonesiaman in bathtubhit squadbioterrorismreference to ben affleckbrother brother incestbiochemistjumping from a bridgereference to sharon stoneblood sprayreference to vin dieselsuperspyvulgarblood streamlow brow humorsoccer hooligantwo males in bathtub (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

An Unfinished Life (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

An Unfinished Life (2005)

To escape an abusive boyfriend, without announcing her plans in advance, Jean Gilkyson takes her young daughter Griff to the Wyoming ranch of her father-in-law, Einar. Jean and Einar are disaffected, as he blames her for the death of his son in a car accident. Einar is taking care of his friend Mitc …h, who was attacked by a bear, and Einar does not know that he has a granddaughter. While Mitch heals and forgives the bear, Einar also changes his feelings regarding Jean, finally understanding that accidents happen and accepting her and loving Griff. (Read More)

Themes:
memoryfriendshiplovejealousydrinkingdrunkennessrobberytheftdeath of fatherredemptiongriefvengeanceforgivenesscamping
Mood:
rain
Locations:
bicyclebuscarhospitalbarrestaurantsmall townrural settingfarmmotellog cabinshooting a car
Characters:
friendfamily relationshipshusband wife relationshiphomosexualpoliceteenagermother daughter relationshipboyfriend girlfriend relationshipdoctorboyteenage girlfemale protagonistgirlpolice officer …policemanthiefbullywaitresssheriffgrandfather granddaughter relationshipdysfunctional relationship (See All)
Story:
car accidentgranddaughterunderwearphotographgunsexf ratedviolencefightcigarette smokingbeatingdreamhorsemirror …computercatdrinksecretlieriflecafewomanbinocularsliarcowboyscarinjectiondeath of sondeath of husbandhorse ridingbasementflowerbearcowrunawaypickup truckropeshavingpokerhypodermic needlebarnloss of wifepool tablezoocaneranchtrophychainplaying cardstombdonkeysandwichplaying poolmeatcrutchesloss of daughterabandoned houseloss of childrodeodomestic abusegravestonetreehousecar breakdownmorphineabusive boyfriendiowasnailraccoonfootprintfather in law daughter in law relationshiplassowyominghoneypadlockbreaking a car windowmilking a cowanimal cagetalking to the deadprinterlearning to drivedry cleanersmaulingreference to mcdonald's restaurantlong underwearwichita kansascalgary alberta canadacigarette buttbroken ribemotional healingbroken platereference to winnie the poohcamera focus on a female butttin snipsescargotinterstate highwaycheyenne wyomingbutte montana (See All)

I Love You Phillip Morris (2009) is one of the best movies like Looking For Eric (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Love You Phillip Morris (2009)

Steven Russell is happily married to Debbie, and a member of the local police force when a car accident provokes a dramatic reassessment of his life. Steven becomes open about his homosexuality and decides to live life to the fullest - even if it means breaking the law. Steven's new, extravagant lif …estyle involves cons and fraud and, eventually, a stay in the State Penitentiary where he meets sensitive, soft-spoken Phillip Morris. His devotion to freeing Phillip from jail and building the perfect life together prompts Steven to attempt and often succeed at one impossible con after another. (Read More)

Themes:
memoryfriendshipdeathchristmasreligionmoneyprisondeceptiontheftadoptiondyingaidsprison escapegay loveescape from prison …homosexual love (See All)
Locations:
carhospitalrestaurantchurchboattaxielevatorwheelchaircourtroomtaxi drivertexasgay barsex on boatprison sexprison shower
Characters:
ex husband ex wife relationshipfriendfather daughter relationshipfamily relationshipshusband wife relationshiphomosexualpolicemother daughter relationshipafrican americanboygirlpolice officergay sexpoliceman …dancerlawyerthiefchristianreference to godgay kisshomosexualitygay relationshipgay fatherboyfriend boyfriend relationshipbrother in law sister in law relationshiphomosexual kisshomosexual sexex policemanhomosexual fatherhomosexual seduction (See All)
Period:
year 2006year 1998
Story:
car accidenthuggingrunningunderwearcryingsingingdancingcharacter name in titledogbloodflashbacksexnuditymale nudity …masturbationmale rear nuditybare chested malekisstitle spoken by charactershowerbased on true storytelephone callvoice over narrationbeatingfoodmirrorurinationface slappunched in the facecomputerarrestbare buttsecretletterbookvomitinglietearsbirthdaycar crashcafejailhandcuffsreference to jesus christprayersubjective cameragay slurambulanceeatingsuicide attemptprisonerjudgechildbirthday partyracial sluron the runflash forwardlibrarybusinessmancoming outliarsuitcasedebtreadingflowerscharacter says i love youdirectorial debutgay coupletrusteyeglassescloseted homosexualidentityclaim in titledestinygolfshavingsupermarketwhat happened to epiloguelooking at oneself in a mirrorstealingwatching a moviefraudwristwatchfloridagay parentjumping from heightfaked deathcrying manmilkscammale underweardrug overdoserole playingpromiserear entry sexgrocery storeprison guardpillsjob interviewmiami floridabible quotecon artistsurprisedeceitcapturevoice over lettertuxedobarbecuebriefcasegay stereotypebriefssports carchildhood memorymale in showercon manchocolatechristmas presentmen's bathroomcloudgay romancecookiebunk bedgay clubman in swimsuiturinaln wordchewing gumkarmagurneyprison breakembezzlementfirst person titlehymnneck bracehappy birthday to youdiabetesreference to george w. bushdeath of loverinsurance fraudshower roomgroup showerdevotiondiabeticstarting overaccomplicecell matereference to ernest hemingwaytelling a jokeadopted childgay husbandfake idinsulinman dancing with manprison sentenceincarcerationbirth mothergay jokeon the lamchurch choirrepressed homosexualbiological motherfoaming at the mouthlife sentencechange in lifestylejumping off a roofcar rentalepiphanyreference to coca colaslow dancingblowing bubblesmopping a floorcredit card fraudgay copfaking illnessgold watchracist jokeresumecloseted gay manjurorlockdownsearch for birth mothergay parenthoodpathological liarconfession of lovesocial engineeringcoming out of a comamanaclesbackyard barbecuereference to people magazinereference to ricky martinback injurykey west floridacloud gazingphallic imageinsulin overdoseprison libraryrolex watchrecidivismfalsified documenthomosexual self discoveryvirginia beachabandoned sonbreach of contractbuying a childracist humorchief financial officerlaw libraryminiature pinscherwelcome mat (See All)

Juno (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Juno (2007)

A tale told over four seasons, starting in autumn when Juno, a 16-year-old high-school junior in Minnesota, discovers she's pregnant after one event in a chair with her best friend, Bleeker. In the waiting room of an abortion clinic, the quirky and whip-sharp Juno decides to give birth and to place  …the child with an adoptive couple. She finds one in the PennySaver personals, contacts them, tells her dad and step-mother, and carries on with school. The chosen parents, upscale yuppies (one of whom is cool and laid back, the other meticulous and uptight), meet Juno, sign papers, and the year unfolds. Will Juno's plan work, can she improvise, and what about Bleeker? (Read More)

Subgenre:
independent filmcult filmdark comedyteen movieteen comedy
Themes:
friendshipmarriagejealousypregnancydivorcedrug usebullyingadoptionabortionmythology
Mood:
high school
Locations:
bicyclehospitalschoolsnowwheelchair
Characters:
single motherbabyfriendfather daughter relationshiphusband wife relationshipmother son relationshipteenagerboyfriend girlfriend relationshipdoctorsingerteenage girlteenage boyfemale protagonistteacherstudent …dancermusicianlawyersister sister relationshipbest friendbullystepmother stepdaughter relationshippregnant teenager (See All)
Period:
wintersummer
Story:
suicide contemplationposterrunningunderwearcryingsingingdancingcharacter name in titleflashbackdogsexf ratedone word titlekisstitle spoken by character …pantiestelephone callvoice over narrationsongurinationslow motion scenecomputercondomvomitingtearsbathroomclassroomguitartelephonenewspaperbandmontagetoiletscantily clad femaleprologueprotestsuburbpay phonehigh school studentchildbirthbasementflowerclassobscene finger gestureteenage sexstrong female characterteen angstloss of virginitylistening to musiccomic bookguitaristdemonstrationcomposerstrong female leadvirginitycommercialattorneyconvenience storeshopping malltitle appears in writingbanananotebenchmarital problemwilhelm screamvideo tapeteenage pregnancyforename as titlebicyclingpregnancy testponytailclinic16 year oldreceptionistautumncdmailboxpipeguitar playerpromcactusnewborn babysewing machineallergybechdel test passedfilm starts with sexunwanted pregnancywatching a videoanimated creditsminnesotaclerkfurnituredressingkeyboardrunnerpanties hit the floorcheerleader uniformduetunwed pregnancypaperdrugstoretrack and fieldultrasoundtruth or daremicrowaveorange juicehigh school athletewoman in laborunwed mothereffeminacyreference to woody allenschool lockerteenage motherabortion clinicfolk songhigh school promconvenience store clerkreference to kurt cobainschool cafeteriafingernailsconsidering abortionpositive pregnancy testspring the seasonreference to diana rossdeodorantfour seasonswoman holding a babydiscovering one is pregnantreference to iggy poptrack meetmoving furniturelounge chairnail salonpregnant schoolgirlfolk singingneedlepointtic tacsinfant in cast creditsanti abortion demonstrationreference to the carpenters (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Looking For Eric?
<< FIND THEM HERE! >>