Please wait - finding best movies...
Matilda Wormwood is an exquisite and intelligent little girl. Unfortunately, Matilda is misunderstood by her family because she is very different from their ways of life. As time passes, Matilda finally starts school that has a kindly teacher, loyal friends and a sadistic principal. As she gets fed …up with the constant cruelty, Matilda begins to realize that she has a gift of telekinetic powers. After some days of practice, Matilda suddenly turns the tables to stand up to her parents and outwit the principal. (Read More)
| Subgenre: | dark comedyblack comedycult film |
| Themes: | crueltyadoptiondysfunctional familysupernatural powerangerfriendship |
| Locations: | waterschool |
| Characters: | baby girlteacher student relationshipaunt niece relationshipvillainsingle motherlittle girlbest friendbabyteacherfemale protagonistbrother sister relationshipafrican americanfamily relationshipsfather daughter relationshipmother daughter relationship |
| Story: | library bookschool principalhair ribbonchild geniusreading aloudfbi agentphone bookfirst grade teacherdedicated teacherfirst day of schoolelementary schoolbased on bookteaching oneself to readreference to ishmaelcharacter calls female sir …adoptive mother adopted daughter relationshipmunich olympicshammer throwbad parentingegg beaterbad parentsshot putnewtroller bladeschocolate cakeprincipal's officethrowing foodsix year oldsupergluedisbelieving adultoverweight childreference to moby dicksiren the alarmsleepmaskadoptive motherspinningchild neglectneglected childpsionic powerhopscotchlifting a female into the airfederal bureau of investigationribbonspellingchalkbraided hairgluehula hoophung upside downcerealprecocious childchild prodigyfat womanwagonpancakeglobefemale athleteadopted daughterswingingcarrotroller skatingfemale heroglassblackboardprincipalcottagelibrarianmathematicssarcasmforename as titleclose up of eyesgeniustelekinesisthrown through a windowtime lapse photographychild protagonistchild's point of viewironymisunderstandingwatching televisiongirl with glassesmilkvillainesslifting someone into the airoverallsstealingwoman with glassesdressflyingsingle parentdirected by starreadingdollfbilibrarychild abusecookingclassroombookcatcryingtitle spoken by charactercharacter name in titleone word titlebased on novelf rated (See All) |
John Kimble is a tough city cop who's been on the trail of drug dealer Cullen Crisp for years. He finally tracks Crisp down but it seems the only person that can testify against him is his ex-wife. The problem is she's disappeared and all Kimble knows is the name of the school in Oregon where her so …n attends. When things don't quite go to plan, Kimble finds he has to go undercover on his toughest assignment yet - Kindergarten teacher! (Read More)
| Subgenre: | black comedycult filmmartial artsfairy talefish out of water |
| Themes: | friendshipmurderdeathloverevengekidnappingbetrayalprisonfearheroinvestigationdeceptionrobberypsychopathparanoia …redemptionpolice brutality (See All) |
| Mood: | rainnightmarenight |
| Locations: | waterschoolhospitalrestaurantforestcarsmall townairplanelos angeles californiawoodskitchenpolice stationcourtroommotelgas station …school busschool teacherfire truckschool fire (See All) |
| Characters: | teacher student relationshipvillainsingle motherlittle girlteacherfamily relationshipsfather son relationshippolicemother son relationshipfrienddoctorpolice officerdetectivehostagelawyer …tough guyaction herowaitresslittle boysecurity guardpolice detectiveex husband ex wife relationshipcrying girlcrying boyairplane stewardessgirl cryingchildren singing (See All) |
| Period: | 1990s20th centuryyear 1990 |
| Story: | school principalreading aloudelementary schoolprincipal's officehula hoopblackboardprincipalmilkvillainesslifting someone into the airsingle parentreadingdolllibrarychild abuse …classroombookbloodviolencetwo word titleguncigarette smokingphotographpartychasesurprise endingpistolshowerfireshootoutdreamcorpseshot to deathblood splatterfoodshot in the chestshotgunrescuepunched in the facedrinkarrestgunfightpaintingvomitingshowdownheld at gunpointsunglassesbirthdaybedinterrogationbathroompianohandcuffsrevolvercriminalgay slurflashlightwineambulancedrug dealermontagebridgedinnerjudgechilddream sequenceanimaldisarming someonechild in perilhit by a cardouble crossshot in the legpainattempted murderdrug addictdangerscreaminglocker roomundercoverrace against timeknocked outtough girlbaseball batscreamdomestic violenceshot in the shoulderlong takegymdeath of sonwitnesspolicewomansuspicionsilencerobscene finger gesturetwingrandmothertrustarsonfreeze framepickup truckapplausefireplacerevelationhead buttheroineheavy rainsociopathscene during opening creditssecurity cameracaught having sextoymorgueblockbustercheffollowing someonecompassionanimal attackfalse identitydrug dealingdrug overdosepump action shotguninnocencecynicismbackpackpartnerpunched in the stomachshopping malljunkiecigarette lighterpunched in the chestwisecrack humorundercover coptough coppierabusive fatherbruisepunchabusive husbandsmokelingerie sliplyingfirefighterhit with a baseball bathairdresseryellinginvestigatorteachingclosetbodyfake identitycrutchestelling someone to shut upstreet marketmotel roomadvicewhistleinformantcastshoutingsleepredheaded womanhospital roomwhisperingpharmacypolice captainstretchermegaphoneone linerbathrobeunsubtitled foreign languagebitten in the neckman punching a womanmacguffinkindnessidentical twinsawkwardnessschoolteachermaverick copmurder witnessoregontwo way mirrorbadgefemale copfather son estrangementhair salonbeauty salongarbage truckreference to abraham lincolnpillowmerry go roundheadachedriving at nightpencilkicking in a doortrenchcoatfake accentman slaps a womanwetred herringpolice partnerlambponyfire alarmfiancefemale vomitingkindergartendinner datewalking stickbouquet of flowerswearing sunglasses insidesnoopingstore clerktoy storepacific northwestmarchingfood poisoningfake beardredhead girlends with freeze frameleg bracechalkboardhandcuffed womanstopwatchfirefightingpastasit upsinfluenzasubstitute teacherbullhornlunchboxchild in dangerinterrogation roomwitness to murderyelling for helpcrying childtoy trainflourpolice lineuprepeated dialoguetwentieth centuryschool librarynapfire departmentnemesisundercover operationantennaferret6 year oldpledge of allegiancesaloncaught kissingdeath by overdoseclumsyfire sprinklerreading to a childworried motherspeaking germanclimbing a ropemilk cartonwhite winebottle of winekindergarten teacherpolice officer shot in the legundercover policemanundercover policewomanbathroom humorklutzseesawundercover missiongelatinman punches womanrag dollelementary school teacherrunning up stairssleeping in classtinfoiltoy truckvice copjelloreading poetryreading a poemreal twins playing twinsrope climbingshot through the chesttripping overhandcuffed to someonemale ponytailjumping jacksschool playgroundcaught snoopingnew partnerpurposely hit by a careating a sandwichgettysburg addressschool gymfirestartergift of flowershagglingkids playingsuspected of being gayassault coursecounty jailfire chieffire drillspoon feedingstuffed toy pandathree legged raceclassroom disciplinefeeling sickhypoglycemiainflatable toymale slaps a femaleman carrying a boysecret hiding placesick womanantihistamineaustrian accentblueberry piedeath by drug overdoseeating in bedkilling a witnesslying to a childmilk moustacheok hand signpony ridescreaming in ragesetting a building on firesleeping childwoman's birthdaywoman using crutchesworking single motherrun down by a car (See All) |
When her father enlists to fight for the British in WWI, young Sara Crewe goes to New York to attend the same boarding school her late mother attended. She soon clashes with the severe headmistress, Miss Minchin, who attempts to stifle Sara's creativity and sense of self-worth. Sara's belief that "e …very girl's a princess" is tested to the limit, however, when word comes that her father was killed in action and his estate has been seized by the British government. (Read More)
| Themes: | crueltyfriendshipfearmagicracismlonelinesspovertyabusebullyingchildhoodamnesia |
| Mood: | rain |
| Locations: | schoolnew york citywheelchairshipindiaschool bully |
| Characters: | teacher student relationshiplittle girlbest friendteacherfemale protagonistafrican americanfather daughter relationshipgirlsoldiersister sister relationshipfrenchsingle fatherfather daughter dance |
| Period: | 1910s20th century |
| Story: | child protagonistchild's point of viewgirl with glasseslifting someone into the airdresssingle parentdollchild abuseclassroomcryingbased on noveldancingthree word titlevoice over narrationunderwear …rescuebirthdaybritishgood versus evilorphanbedroomcandlenew yorkold manchild in perilbirthday partyprincesspainuniformstorytellingstatuereunionschoolgirlworld war oneflowerclass differencesmonkeybattlefieldhatebirthday cakeballoonslow motionrace relationselephantmouseservantinterracial friendshiprealityindianpresumed deadimaginationhatredrejectiondespairthunderstormschool uniformroseatticboarding schoolrainstormhorse and carriagedead motherseparationloss of jobbirthday presentnarratorimaginary friendfriendship between girlskindnessfriends who live togethercruise shiprainingbomberprivate schoolbowwindowclimbing out a windowlockettrenchletter writinglifting female in airnightgownresignationchild laborgirls' schoolmissing fatherfather daughter reunionbilingualbombardmentturbanlonginginkasian indianchimneyheadmistressbratorphan girldeitystarving childbad temperriches to ragsballadeerfantasy lifemilkmanrich poorstory within a storyarmy captainsinger offscreenhot temperjourney shown on mapblowing out a candlegirls' boarding schoolmotherless childshawlchild exploitationdenunciationlosing temperharpistrejectrejectedchimney sweephelping otherspair of shoesaggressiveservant girlcrueldenouncementwood plankman versus beastramayanablind man's bluff gamemilk manserioussocial rejectbad temperedliving in an attic (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget …her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
| Subgenre: | coming of agesupernatural |
| Themes: | dysfunctional familyangerfriendshipdeathartmagicgriefchildhoodboy girl friendshipdeath of best friend |
| Locations: | schoolchurchforestwoodsrural settingfarmpolice carmuseumschool busschool teacherart museumschool bullynew girl in townschool friend |
| Characters: | teacher student relationshiplittle girlbest friendteacherbrother sister relationshipfamily relationshipsmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenagerfriendteenage girlteenage boy …police officerstudentartistbullylittle boychildhood friendlove letterbest friendsblonde girlnew friend (See All) |
| Story: | based on bookneglected childlifting a female into the airblackboardchild's point of viewlifting someone into the airdollclassroombased on noveldogdancingphotographsingingthree word titlepunched in the face …watching tvpaintingtearsplace name in titlerunningbirthdaydeath of friendbridgedrawingkingkeyfantasy sequenceproduct placementstorytellingpianisttragic eventqueenbirthday cakeroperaceloss of friendguitaristcrushcgirealityimaginationpet dogbelief in goddeerswingkingdomatheistdead girlbirthday presentfemale teacheroutsidertween girlcrownsquirrelgreenhousefantasy worldtrollanguishrunnerchurch servicegrievingcreeknext door neighbororganistsocial outcastgirl next doornonconformityschoolyardfalling from a treelittle sisteranimal trapreference to leonardo da vincisketchbookbelief in hellpoor familyfemale bullyclubhousereality vs fantasysinging happy birthdaymake believeschoolboy crushtwo friendsfoot racetree houseanimate treeteacher crushreference to theodore rooseveltoff screen deathswinging on a ropemusic classtree swingsobbing femaleimaginary worldfear of hellrope swingrunning racedog as a giftcatching someone who fallsreference to teddy rooseveltknocked to the groundlost keysmuseum tripreference to pieter bruegelwooden bridgelog bridge (See All) |
In stifling Edwardian London, Wendy Darling mesmerizes her brothers every night with bedtime tales of swordplay, swashbuckling, and the fearsome Captain Hook. But the children become the heroes of an even greater story, when Peter Pan flies into their nursery one night and leads them over moonlit ro …oftops through a galaxy of stars and to the lush jungles of Neverland. Wendy and her brothers join Peter and the Lost Boys in an exhilarating life--free of grown-up rules--while also facing the inevitable showdown with Hook and his bloodthirsty pirates. (Read More)
| Subgenre: | martial artsswashbucklersword and fantasy |
| Themes: | adoptionangerfriendshipmurderdeathbetrayaljealousyfearheromagiclonelinesstheftcouragefirst love |
| Locations: | waterschoolsnowbathtublondon englandshipcastlejunglestormcity of children |
| Characters: | aunt niece relationshipvillainteacherbrother sister relationshipfamily relationshipsmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenagerfriendbrother brother relationshipboygirl …studentthieftough guynative americanaunt nephew relationshipmermaidboy hero (See All) |
| Period: | 1900s |
| Story: | close up of eyeschild protagonistchild's point of viewlifting someone into the airflyingclassroomcryingtitle spoken by charactercharacter name in titlebased on novelviolencedoggunkissfight …voice over narrationrescueslow motion scenebattleswordlettershootingshowdownhand to hand combatbedislandfightingcombatbound and gaggedsword fightgangambushmixed martial artsweaponman with glassesno opening creditschilddisarming someoneone man armydrawingduelattempted murderone against manydangerpoisonstorytellingtough girlskeletonglassestrapunderwaterclassrecord playericepirategoldcaptainbow and arrowhead buttheroinehattreasurehidinggossipteddy bearfemale tied upcannonbarefoottelescopefairyrowboatlostrivalshadowyoung lovegrowing upsword duelparrotwilhelm screamnannyflagswordsmangatecrocodiletween girladventure heroboy with glasseshanging upside downbankerfencingcloudwhistlingfeathersiblingmusketsewingcomettop hathookshot with a bow and arrowflintlock riflenightgownflintlock pistolsolar systemwire fubig ben londonchild heromale tied upreference to cinderellapleadingchild in dangerteepeehook for handplay fightvictrolamake believepirate captainnightshirtwooden swordsaint bernard dogpulling hairflying boygirl in dangerwalking the plankjolly rogerskull and crossbonesboy in dangerfantasy landflying shipblushingmagical dustthimblecrowingfairy dustbarefoot boy (See All) |
God lives in human form as a cynical writer with his young opinionated daughter in present-day Brussels, Belgium. She concludes that her dad is doing a terrible job and decides to rewrite the world, descending to earth in search of her own 6 messengers to write a brand new testament and change the s …tatus quo. (Read More)
| Subgenre: | dark comedyblack comedymartial artsabsurdism |
| Themes: | angerfriendshipmurderdeathinfidelityreligionmoneyadulteryescapememorytheftinsanityunfaithfulnessillnesssadism …homelessnessfalling in lovephilosophy (See All) |
| Mood: | satirerainsurreal |
| Locations: | hospitalbeachchurchairplanebathtubbicycleelevatorapartmentseacampfiretunnelearth |
| Characters: | babybrother sister relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipdoctorboyprostitutepolice officerserial killernursepriestreference to god …christianitybiblesnipercousin cousin relationshipgermandaughterolder woman younger man relationshiphomeless mandancing girlboy girl kiss (See All) |
| Story: | reading aloudsiren the alarmhula hooptelekinesiswatching televisionmilkdressreadingdolllibrarychild abuseclassroomcryingtitle spoken by charactersex …nuditybloodbare breastsfemale frontal nuditybare chested malefightcigarette smokingdancingsingingtelephone calltopless female nudityvoice over narrationcell phonesongbeatingdreamunderwearblood splattercar accidentmirrorwatching tvcomputerbikinikissingbare buttfalling from heightpaintingriflebeerrunningbedneighborreference to jesus christstripperf wordsubjective camerafoot chasecandleaxemontagesuicide attemptfemale pubic hairfishcoffinbathvanlooking at the cameratalking to the camerapublic nudityprologuekeylightningscreamshot in the shoulderinjectionpursuitcrossbasementsadnesschickenshot in the armfreeze framestrong female characterrecord playersurgerycircuseyeglassesapplausetv newsbulletkilling an animallooking at oneself in a mirrorcakelawscene during opening creditshathappinesscowboy hatmousecrucifixwatching a movieswimsuitimprovisationladderstrong female leadhomefatedead womanmovie theatrebarefootmale prostituteadventurerbra and pantiesgrocery storenicknametrappedboxer shortscynicismblood on facebackpackhatredkickingmiracleinsectshovelmakeupthunderstormheavenbutterflyairplane crashbalconytigerrefrigeratorbriefcaserecording studiobriefsinjusticearrowbrushing teethglobal warmingholding handsirreverencelaundryrunning awaydead animalepisodic structurename callingtelevision newsvacuum cleanergorillatrailer homefalling into waterbare chested boylocked doorpark benchapewashing machinechapter headingssick childgodbreaking a mirrorsleeping on a couchoverhead shotgospeljumping out a windowevangelistred light districthair dryerwatching someonebeing watchedmodel airplanehead bandagepeep showdining halldisembodied handbrussels belgiumpenis slurwoman in a bathtubreference to allaharm castslip the undergarmentringing phoneringing telephonefile cabinetsuntan lotionadam and eveelderly manlocked uptext on screengarbage binjumping from a windowhit in the stomachwalking on waterarchitectural modelliving alonesoup kitchenapostledestroying propertyempty swimming poolpregnant manwaiting in linesex maniacreference to franz schubertreference to the titanicreference to johann sebastian bachanimated sceneboy dressed as a girlshopping centerwall clockreference to marcel proustarctic circlecartoon chickentesticles slursleeping on a benchvomiting in a toiletboy dressed as girlmace spraydistorted soundreference to jean claude van dammeview through rifle scopeeye maskfield hockeyreference to baalsmall apartmentcartoon fishtouching handsmissing toothreflection in a windowromance subplotartificial armman in a bathtubmentally challenged malereference to pokemonamputated armapostlesbreaking a dishdefecation slurstolen keylast supper painting (See All) |
Seventh-grade is no fun. Especially for Dawn Weiner when everyone at school calls you 'Dog-Face' or 'Wiener-Dog.' Not to mention if your older brother is 'King of the Nerds' and your younger sister is a cutesy ballerina who gets you in trouble but is your parents' favorite. And that's just the begin …ning--her life seems to be falling apart when she faces rejection from the older guy in her brother's band that she has a crush on, her parents want to tear down her 'Special People's Club' clubhouse, and her sister is abducted.... (Read More)
| Subgenre: | dark comedyblack comedycult filmindependent filmcoming of ageteen movie |
| Themes: | crueltydysfunctional familyfriendshipkidnappinghumiliationabusebullying |
| Mood: | satiresocial satire |
| Locations: | schoolbussinging on bus |
| Characters: | little girlteacherfemale protagonistbrother sister relationshipfamily relationshipsteenage boygirlsister sister relationshipjewishbullyparent child relationshipwriter directorjewish girl |
| Story: | principalchild's point of viewgirl with glassesclassroomsingingtelephone callwatching tvwritten by directorkissingpianogay slurtoiletsuburbattempted rapespeech …cheerleaderglassesballetnerdteen angstclubcrushcynicismfirst kisssibling rivalrysexual harassmentlonerpublic humiliationphysical abuseirreverencesexual awakeningharassmentoutcastcafeterialockermental retardationboy with glassesballerinadown syndrometormentlunchjunior high schoolverbal abusemiddle schooldignitytauntingjewish familysocial outcastsibling relationshipfirst crushdeliberate crueltypsychological tormentlesbian slursardonicgarage bandschool assemblypariahnerdy girlsuspected lesbianfood trayseventh gradespitball (See All) |
Growing up can be a bumpy road, and it's no exception for Riley, who is uprooted from her Midwest life when her father starts a new job in San Francisco. Like all of us, Riley is guided by her emotions - Joy, Fear, Anger, Disgust and Sadness. The emotions live in Headquarters, the control center ins …ide Riley's mind, where they help advise her through everyday life. As Riley and her emotions struggle to adjust to a new life in San Francisco, turmoil ensues in Headquarters. Although Joy, Riley's main and most important emotion, tries to keep things positive, the emotions conflict on how best to navigate a new city, house and school. (Read More)
| Subgenre: | cult filmcoming of agecomputer animationcgi animationdisney |
| Themes: | angerfriendshiplovefearmagicmemorychildhoodforgiveness |
| Mood: | nightmaremoving |
| Locations: | schooltrainbuscityroad moviesan francisco californiaschool teacherbus stationmoving to city |
| Characters: | little girlbabyfemale protagonistafrican americanfamily relationshipsmother daughter relationshipfather daughter relationshippolicechildrenboygirlpolice officerstudentfathercrying baby …chinese foodbaby cryinggirl crying (See All) |
| Period: | 2000s2010s |
| Story: | first day of schoolelementary schoolcerealfemale herostealingclassroomcatcryingf ratedflashbacktwo word titledreamtearscaliforniahouse …apologyclowndragonscene during end creditsglassessadnessratbearsleepingpizzarunawayeyeglassesballooncopcageelephanthammerblockbustergiantdinosauranthropomorphismimaginationface paint3 dimensionalice skatingcartoonice hockeyboyfriendcliffmustachegrowing uptrophychildhood memoryhockeyjoynew jobfire extinguisherrunning awayfemale teachertomboyimaginary friendlavadolphinkidcloudmovie studioafrican american womannewborn babyschoolteacherredhonestygreenbechdel test passed11 year oldiphonedemolitiongolden gate bridgeminnesotakidskangaroobow tiehandbagraccooneyespre teentear on cheekmiddle schoolunicornmindblue hairbluefalling off a cliffnew housenecktielight bulbnewbornsubconsciousfrench friesnosegreen hairhomesicknesspinkmotivationalmoving vaneveryday liferunning away from homechased by a dogsneaking outyellowstudentsblonde childerased memoryapathydisgustschool kidsbreakfast cerealcamera shot from inside human bodyemotionpurplehouse of cardsbig noselazysan franciscotryoutsbroccoliopening creditswaking up from a nightmareemotionsmemory erasurecomputer generated imageryred squarecrybabydizzybig eyesfirst placefrench frypunishedrolling eyes (See All) |
Down and out rock star Dewey Finn gets fired from his band, and he faces a mountain of debts and depression. He takes a job as a 4th grade substitute teacher at an uptight private school where his attitude and hijinx have a powerful effect on his students. He also meets Zack, a 10-year-old guitar pr …odigy, who could help Dewey win a "battle of the bands" competition, which would solve his financial problems and put him back in the spotlight. (Read More)
| Subgenre: | cult film |
| Themes: | angerfriendshipdrinkingdrunkennessdeceptionillnesseducationdyingfashion |
| Mood: | high school |
| Locations: | schoolbarsnowsmall townlos angeles californianightclubschool busschool teacher |
| Characters: | teacher student relationshipbest friendteacherfamily relationshipspolicefriendsingerboygirlstudentmusicianalcoholic |
| Period: | 2000s |
| Story: | school principalblackboardwoman with glassesclassroomtitle spoken by charactersingingtelephone callsongfoodurinationcomputerdrinksecretlierock music …pianoguitarbandnew yorkmontagedinertoiletrock bandapologychildroommatevanfired from the jobliarscene during end creditspianistcheerleadercontestrock 'n' rolldarkschoolgirlclassterminal illnesseyeglassesrockfarcescene during opening creditsguitaristrehearsalimpersonationrebellionembarrassmentrock concertbootsimpostordrummerschool uniformdeceitslackerraised middle fingermusic bandsurprise after end creditsposterdrumsjoyvideo surveillancehangovertween girlidealismboy with glassesdrumschoolboysororitymtvelectric guitarcellomale protagonistprivate schooldeskrock musiciangroupiecommitmentmusic historydiarrheakeyboardrock singermusical instrumentrock groupreference to led zeppelinlazinesspreparatory schoolclarinetweightfield tripsubstitute teacherroadiebass guitarknee socksband managerbattle of the bandsanti authoritysong lyricsrock clubmusic competitioncrowd surfingmusic clubbreaking the rulesbroken rulecymbalmosh pitreference to liza minnellirock guitarfaculty loungereference to stevie nicksreference to aretha franklinreference to puff daddyschool recesscode of conductfreeloading (See All) |
A young girl finds that all the books she chooses in the library have been previously checked out by the same boy. Later she meets a very infuriating fellow... could it be her "friend" from the library? The boy's grandfather has a violin sales and service shop. The boy wants to be a violin maker lik …e his grandfather. (Read More)
| Subgenre: | teen romance |
| Themes: | lovesurrealismunrequited loveeducationfalling in lovewritingfirst love |
| Mood: | rainanimehigh school |
| Locations: | schooltrainbicycleapartmentjapanitalyrooftopcavetwo on a bicycle |
| Characters: | best friendfemale protagonistfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boywritersister sister relationshiplove trianglegrandfather grandson relationship |
| Story: | library booklibrarianreadingdolllibraryclassroombookcatflashbackdogsingingsongdreambased on comicbedroom …based on comic bookold mandream sequencemarriage proposalflash forwardsuburbbased on mangafantasy sequencescene during end creditshigh school studentreunioncharacter says i love youdirectorial debutrockfireplacescene during opening creditscrushviolinfollowing someoneclockambitionimaginationone dayviolinistbarking dogteenage loveinspirationtrue loveteasingbunk bedimmaturitysunriseexamintergenerational friendshipfamily homefemale writerrocking chairaspiring writerantique shoptranslationgemboy meets girlgrandfather clockwood carvingstudyfamous songsleep deprivationlyricselderly manhandwritingbookwormclimbing over a wallcarpe diemlibrary cardluthierviolin makergradesimple lifegeodeinstrument makerbad grades (See All) |
The story of the Buckman family and friends, attempting to bring up their children. They suffer/enjoy all the events that occur: estranged relatives, the "black sheep" of the family, the eccentrics, the skeletons in the closet, and the rebellious teenagers.
| Subgenre: | black comedy |
| Themes: | dysfunctional familymarriagepregnancymemorygambling |
| Mood: | affection |
| Locations: | schoolcarkitchenbaseballoral sex in a car |
| Characters: | single motherlittle girlbrother sister relationshipfamily relationshipsmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipchildrenbrother brother relationshipteenage girlteenage boylittle boy …grandfather grandson relationshipgrandmother grandson relationshippregnant wife (See All) |
| Story: | school principalprincipal's officesingle parentcookingcryingone word titlemale nuditymasturbationsex scenekissphotographsingingpartytelephone call …underwearhorsepunched in the facecameravomitinglievibratorbirthdaybedcollegebedroomhousedinnerbirthday partyold womanliarcowboychildbirthsadnessreference to william shakespearegrandmotherbirthday cakeeyeglassespornographyhuggingteen angstballooncowboy hatblockbusterbirthhomeembarrassmentgrandfatherpower outagesex talkliving roomplaybriefschildhood memoryhorseback ridingjoyteenage pregnancystrugglecar drivingschemeparenthoodyuppiebaseball gamebunk bedunplanned pregnancyresponsibilitybackyardhiding placebiracialwatching a videotalking while drivingschool playtreadmillexpectant mothernude photographsmilingmissouriexpectant fathermental disordercupcakest. louis missourihelium balloonpinatabiracial childmini vancowboy costumelittle leaguedropoutpaper bagmaternity wardnine year oldreference to franz kafkachild psychologistdental retainerusherkioskconsidering abortionchild rearingdiaphragmst. louis cardinalsphotographing sexbaby car seatballoon animalteenage marriagehelium inhalationblack sheep of familysocial adjustment (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
| Subgenre: | conspiracyabsurdism |
| Themes: | crueltysupernatural powerangerkidnappingmoneyfearescapemagicdeath of fatherdeath of motherabductionpanicmissing child |
| Locations: | schoolbeachrestauranthotelsnowsmall townbicycletaxielevatorkitchenpolice carenglandocean |
| Characters: | little girlbabyfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipdoctorgirlpolice officerpolicemanlittle boymaid …witchgrandmother grandson relationship (See All) |
| Story: | based on bookoverweight childlifting a female into the airbraided hairlifting someone into the aircatcryingbased on novelsingingsurprise endingunderwearrescuemaskpaintingtears …runningbirthdaysubjective cameragood versus evilfoot chaseorphanbedroomcandlemountaindisguisesnakechildradiodrawingchild in perilsearchcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationmissing personscreamspeechdisappearancepursuitwiggiftexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeeyeglassesapplauseeavesdroppingtalking animalcakecagefaintingcomic bookhatcookmousehidingwitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleaverhandtreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalyoung boyrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium ballooncuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedotree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All) |
Four high-tech industrial spies, Beaupre, Alice, Jernigan and Unger, steal a top-secret microchip, and, to fool customs, hide it in a remote-control toy car. Through a baggage mix-up at the airport, grumpy old Mrs.Hess gets the toy and gives it to her neighbor, 8-year-old Alex. Spies want to get the … toy back before their clients get angry and decide to burglarize every house at Alex's street to find the chip. But Alex is prepared for their visit... (Read More)
| Subgenre: | slapstick comedy |
| Themes: | friendshipkidnappingmarriagechristmas |
| Mood: | car chase |
| Locations: | swimming poolairplanebicycleairportlakerooftopchicago illinoistaxi driversan francisco californiaschool bus |
| Characters: | villainbrother sister relationshipfamily relationshipspolicemother son relationshipbrother brother relationshiplittle boysecurity guardboy hero |
| Story: | elementary schooldisbelieving adultfederal bureau of investigationchild protagonistchild's point of viewmisunderstandingvillainesslifting someone into the aircookingcatsequeldogphotographknifechase …showerfireunderwearfoodrescueslow motion scenewatching tvcomputerfalling from heightneighborsubjective cameraspybound and gaggedvideo cameradisguisebasketballbridgeweapontied to a chairapologybirdthird partsuburbelectrocutionfactorycharacter's point of view camera shotactor shares first name with characterwigbasementtrapratsilencericeeavesdroppingfalling down stairsfireplacelooking at oneself in a mirrortalking animalbabysitterdrug abuseladderhaircutburglartelescopeburglaryhit in the crotchshovelbribebooby trapatticgadgetparrotweatherpaintblack marketblizzardunsubtitled foreign languagetrampolinevideo footagesiblingillinoisjumping into watertoy gunfake moustachespaghettifirecrackervulturehook555 phone numbersittingrenovationlawn mowergolf cartmicrochipfrozen bodyhome alonedollhousehangargrandfather clockmousetrapbusiness tripbad smellburglar alarmlifting a male into the airweathermanweather reportwreathgetaway driveriglooremote controlled toy carkid outsmarts adultbroken boneweather forecastertalking dollweather forecastingwalking the dogfemale stuck in sticky substancechicken poxdirty clothesdog whistleweather mapswitched luggagethe weather channelmilitary recruiting officebroken toiletfishing hook (See All) |
Ishaan Awasthi is an eight-year-old child whose world is filled with wonders that no one else seems to appreciate; colours, fish, dogs and kites are just not important in the world of adults, who are much more interested in things like homework, marks and neatness. And Ishaan just cannot seem to get … anything right in class. When he gets into far more trouble than his parents can handle, he is packed off to a boarding school to 'be disciplined'. Things are no different at his new school, and Ishaan has to contend with the added trauma of separation from his family. One day a new art teacher bursts onto the scene, Ram Shankar Nikumbh, who infects the students with joy and optimism. He breaks all the rules of 'how things are done' by asking them to think, dream and imagine, and all the children respond with enthusiasm, all except Ishaan. Nikumbh soon realizes that Ishaan is very unhappy, and he sets out to discover why. With time, patience and care, he ultimately helps Ishaan find himself. (Read More)
| Subgenre: | fish out of waterclaymationdocumentary footage |
| Themes: | angerfriendshipjealousydrinkingfeartorturelonelinessdepressionpoetrybullyinghopechildhoodprejudiceautism |
| Mood: | nightmare |
| Locations: | schooltrainhelicopterbusbicycletaxirooftopindiatrain stationschool busnew school |
| Characters: | teacher student relationshipbabyteacherfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendsingerbrother brother relationshipstudentdancermusicianbullylittle boy …fatherparent child relationshiplow self esteemself confidencecrying boyart teacher (See All) |
| Story: | school principalreading aloudprincipal's officeneglected childblackboardchild protagonistchild's point of viewlifting someone into the airdirected by starchild abusecookingclassroomcryingdogkiss …fightdancingphotographsingingshowertelephone callsongdreamfoodmirrorface slappaintinglietearsrunningcompetitionfightingtelephonesubjective cameranewspaperbasketballmontageeatinginternetfishapologychildbirdpainterdrawingprologueliarcharacter's point of view camera shotscene during end creditssadnessdirectorial debutclassfireworksfreeze frameeyeglassesapplauseshavinglooking at oneself in a mirrorlawhappinesstoycrying womanhome movietennisfestivalfollowing someonecompassionstreet lifesocial commentaryimaginationsufferingbackpackanimated sequencedespairaquariumhit on the headschool uniformlaughtercartoonboarding schoolbrushing teethalarm clockpigeonpostershamejoybeing followedunderdogdormitoryearphonespresentshynessgardeningapparitionsuccessflutecrutchesstairwayname callingstreet marketintolerancecomic reliefsolitudeprizeknocking on a doorgoldfishmisfitteasingconservativedisciplineunhappinesswhistlingcreativitycricket the gamehead injurybunk bedcripplekitereference to albert einsteintutorbare feetplaying a video gameilliteracyreading a bookpondfailurereference to googlemumbai indiareading a newspaperestrangementwaking upanguishironingsnailhopelessnessheadmastergurupencildressingfirecrackeroptimismstory tellingdomineering fatherhomeworkoverhead shotexpressionismmentor protege relationshipstrawberrytennis courtkneelingcuriositydoorbellreference to pablo picassorubik's cubelongingapplying makeupart classbasketball courtchild's drawingmodel airplanereference to mickey mouseanimated title sequencedouble decker busclown costumejigsaw puzzlemarchingcalling someone an idiothomesicknessreference to walt disneyintrovertleg bracedining hallimpressionismimitationmotivationalboys' schooldyslexiahummingwashing handswanderingseparation from familystickskipping schoolneurologyreference to leonardo da vincieight year old9 year oldcheeringclaysketchbookburpingcartoon rabbitagainst the oddsreference to vincent van goghreference to oscar wildevisual metaphorwaving goodbyefishing net8 year oldbowingpuddlelearning disability360 degree well shotyawningalphabetfacial bruisegrammarstop motion scenedrainflowerpotrestlessnessschool yearbookmental abusespecial educationreference to agatha christieflip bookgoogling for informationmaking facesautistic childcrossed eyesexpressionistfalling to the groundreference to the nobel prizeschool bellautisticmoral courageautistic sonreport cardchildhood innocencefish bowlrunning up stairspedagogywalking backwardscombing someone's hairmutismoverachieverplaying hookydiwalifake mustachescaffoldingsplashing watercartoon frogfree thinkingtying shoelacesfinger paintingflute playerpainting comes to lifepicking one's nosepraying handscartoon turtlefaculty loungeneurological disorderoral examreference to the pied piperamphitheatrecartoon elephantcartoon fishlifting a boy into the airplaying fetch with a dogcanvas paintingcombing one's hairhyperactive childreading a poem aloudreference to neil diamondautistic boyfinding own voicereference to new zealandreference to verditoilet stoolcartoon swanhousemasterreference to thomas alva edison (See All) |
High school student Ferris Bueller wants a day off from school and he's developed an incredibly sophisticated plan to pull it off. He talks his friend Cameron into taking his father's prized Ferrari and with his girlfriend Sloane head into Chicago for the day. While they are taking in what the city …has to offer school principal Ed Rooney is convinced that Ferris is, not for the first time, playing hooky for the day and is hell bent to catch him out. Ferris has anticipated that, much to Rooney's chagrin. (Read More)
| Subgenre: | cult filmcoming of ageteen movieteen comedy |
| Themes: | friendshiphome invasion |
| Mood: | high schoolbreaking the fourth wallaffection |
| Locations: | schoolrestaurantswimming poolcarpolice stationofficechicago illinoismuseumschool bussinging in shower |
| Characters: | teacher student relationshipbest friendbrother sister relationshippoliceteenagerfriendboyfriend girlfriend relationshipteenage girlteenage boypolice officerstudentsecretary |
| Period: | 1980s |
| Story: | school principalprincipal's officeprincipalclassroomcharacter name in titledogkissdancingshowertelephone callslow motion scenecomputerpaintingbedapostrophe in title …bathroomtelephonebedroomdrug dealerhouseanti herolooking at the cameratalking to the camerakicked in the facescene during end creditsconvertiblehigh school studentgarageanswering machineteen angststreetimpersonationrebelrebellionparking garageart galleryblack humorparadehomecameoscene after end creditssibling rivalryone dayclassmatelaughingsports carneighborhoodsurprise after end creditsirreverencemudjoyhigh school teachercar drivingschemewalletadvicecameo appearancecoughinggeneration gappopularitymarching bandhallwaybackyardhigh school girldeskferraridog attackspringsmilingswimming in underwearhigh school seniorreference to john lennonhigh school principalhypochondriacteenage angstthe beatles songdowntownclarinetsynthesizerhigh school boyskipping schoolteenage rebelliondiving boardcomputer screentalking to the audiencecatatoniafake illnessanti authoritycar damagetruancyfaking illnesschicago cubsjersey the garmentjoyridemusical sequence in non musical workreference to dirty harryon screen narrationnarrated by title charactertruantpretending to be sickstudent principal relationshipwrigley fieldday offfoot popping kissfake nursegummi bearshermer illinoiscalling someone a heroexpensive carthriller dancevoice sampling (See All) |
The movie is about a boy with a unique aging disorder: one that makes him age 4 times faster than normal. It picks up when Jack (Robin Williams) is 10 years old, but looks 40. He tries to go to public school for the first time, and to become friends with kids his own age. His physical appearance cau …ses him lots of problems, however. (Read More)
| Subgenre: | fish out of water |
| Themes: | dysfunctional familyfriendship |
| Locations: | schoolhospitalbarbicycle |
| Characters: | teacher student relationshiplittle girlteacherfamily relationshipsfather son relationshipmother son relationshipboygirllittle boynew student |
| Story: | first day of schoolforename as titlechild's point of viewclassroomtitle spoken by charactercharacter name in titleone word titlejailhalloweenbedroomcaliforniabasketballnunpantyhosetree …actor shares first name with characterhalloween costumespeechchildbirthheart attackfemale stockinged legsdiseaseflatulencecrushplaygroundbutterflyfriendship between boyshalloween partygraduationtrick or treatingfreaktutoressayhandicaptreehouse10 year oldhigh school graduationwoman in laborcardboard boxfirst crushmaturitypaperboypenthouse magazineblowing bubblesteacher crushwater balloonrapid agingpremature birthclass photographaging disorderpremature agingfifth graderadult actor playing minorgummi bearprogeriacollapsing chair (See All) |
A sixteen-year-old boy insinuates himself into the house of a fellow student from his literature class and writes about it in essays for his French teacher. Faced with this gifted and unusual pupil, the teacher rediscovers his enthusiasm for his work, but the boy's intrusion will unleash a series of … uncontrollable events. (Read More)
| Subgenre: | gay interestsuspensecrime fiction |
| Themes: | friendshipartvoyeurismobsessionhumiliationprejudicewritingcheatingphilosophygreek mythology |
| Mood: | satirehigh schoolparodystylization |
| Locations: | schoolschool teacher |
| Characters: | teacher student relationshipbest friendteacherhusband wife relationshiphomosexualfather son relationshipteenagerboyteenage boystudentwriterartistvampiregay kiss …frenchsuicide by hangingfrench teacher (See All) |
| Story: | blackboardironywatching televisionstealingreadingdollclassroombooktitle spoken by charactermale nuditysequelmale frontal nuditybare chested malekissbased on play …rescuewatching tvpaintingvoyeurnewspaperwinebasketballhousetransformationportraituniformangelmanipulationhigh school studentstalkingcinemaclasspoemlgbtteen angstdestructiondesiretwinsgossipart galleryappleseriesliteraturerivalfriendship between boysalternate realitymale full rear nuditysymbolismintimidationnovelpopcorndisappointmenttutorinterior designhitchcockianfictiontalentintergenerational friendshipsymbolapprenticehomeworkmodern artnarrativereference to sigmund freudcharactergoalcuriosityreference to john lennonreference to charles dickenslessonprivacysecrecyinterventionrealismneglectkeyholetranquilizercaricaturereportconflictinvasion of privacydamnationdecorationreference to anton chekhovreference to leo tolstoycoachingreference to victor hugouglinessreference to franz kafkaarticlemale homosexualitymockingantagonistinner conflictolder woman teenage boy relationshipcontemptmaestrofantasizereference to achillesstory in storyreference to anna kareninabildungsromanreference to madame bovaryreflexiveexploitation of friendshipreference to fyodor dostoyevskyreference to pier paolo pasolinirepulsionsex with an older womanvernissageliterature classmath exammathematics studentreference to gustave flaubertreference to paul kleereference to shakespeareteacher pupil relationshipreference to arthur schopenhauerreference to j.d. salingerreference to odysseustransparency (See All) |
A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village … council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)
| Subgenre: | cult filmmartial artsfairy talesword and sorcerydark fantasysword and fantasychrist allegory |
| Themes: | friendshiprevengesurrealismkidnappingbetrayaladulteryescapemonsterheromagicredemptionsadismcourageforgivenessbook of magic |
| Mood: | rainpoetic justice |
| Locations: | forestsnowboatvillagefarmlakecastlecampfireroad movie |
| Characters: | baby girlvillainlittle girlbest friendbabyfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipfriendchildrensoldierwarriorlittle boy …witchself discoverycrying baby (See All) |
| Story: | braided hairwagonvillainesslifting someone into the airbookcatcryingtitle spoken by charactercharacter name in titleone word titleblooddogkissfightdancing …knifechasehorsepunched in the facebattleswordfalling from heightmaskshowdownhand to hand combatislandrivercombatsubjective cameragood versus evilsword fightmountaindisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualjourneyold womanprincesstransformationcursemissiondragontentkicked in the facelightningskeletonfarmerbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightloss of friendhidinganimal attackgoatapplefemale warrioradventurerdwarfshieldfairywizardprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamsmokedaggercrowhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustioncouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All) |
300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. ….. (Read More)
| Subgenre: | cult film |
| Themes: | supernatural powerangerrevengeghostfearmagichumiliationunrequited lovefalling in lovebook of magic |
| Mood: | high school |
| Locations: | motorcyclecemeterymuseumsewer |
| Characters: | little girlbrother sister relationshipteenage girlteenage boyzombiesister sister relationshipbullywitchevil witch |
| Period: | 1990s17th century1700s |
| Story: | disbelieving adultsiren the alarmlifting a female into the aircottagelifting someone into the aircatcryingtitle spoken by charactertwo word titlecigarette smokingsingingsurprise endingfirebedsubjective camera …decapitationgood versus evilhalloweencandlehousetied to a chairtransformationpainvirginproduct placementdeath of childscreamscene during end creditshanginghalloween costumecabinhaunted houseundeadfalling down stairsburned alivetalking animalhatwitchcraftspidertorchsevered fingerrejectionimmortalityhypnosischairhalloween partyarrogancemale virginspellcandydead animaltrick or treatingdoubtlighterbicyclingtombstoneshoerhyme in titlecabin in the woodssunrisepotionwarningnoosebus rideblack catpillowsaltlobsterwitch costumeliquidhorror for childrenvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumeroadkillcaged humanspit taketalking catchased by a dogevil laughterpet foodblown coverflying broomcursedlightingsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettsmagical broomstickwitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All) |
1972. Vada Sultenfuss (played by Anna Chlumsky) is an intelligent, bubbly, hypochondriacal 11-year old girl. Her father, Harry (Dan Aykroyd), is a mortician and a widower. Her best friend is Thomas J Sennett (Macaulay Culkin). Then her father hires a new receptionist, Shelly (Jamie Lee Curtis), and …life will never be the same again. (Read More)
| Subgenre: | coming of age |
| Themes: | angerfriendshipdeathmarriagefeardancefuneralmemorytheftgriefpoetryphotographypanicchildhoodwriting …death in childbirthfear of death (See All) |
| Locations: | forestsmall townbicyclewoodswheelchairlakeschool teacherpennsylvania |
| Characters: | teacher student relationshiplittle girlbest friendteacherfamily relationshipsfather daughter relationshipdoctorchildrenbrother brother relationshipboygirlpolice officernursestudentmusician …writerlittle boyamericangrandmother granddaughter relationshipsingle fatheruncle niece relationshipchildhood friendboy girl kiss (See All) |
| Period: | 1970ssummeryear 1972 |
| Story: | lifting a female into the airprecocious childblackboardlifting someone into the airoverallssingle parentclassroomcryingbloodtwo word titlekissdancingphotographsingingpanties …corpsewatching tvtearsbeddead bodyneighborrivertelevisionswimmingbasketballdeath of friendfishcoffinfishingtreeargumentmicrophonewidowermini skirtdeath of childscreamringdatebasementfirst partloss of motherfireworkstypewritergaragerecord playergirl in pantiespoemapplausegamesupermarkethattitle based on songloss of friendloss of wifelosstimecrushcarnivalpicnicyogaministerold agemourninghippieinsectsong in titlemedical examinationmakeupfirst kissrosedead childengagementmeditationlipstickbarbecuedivorceeuncleplaying cardspetmenstruationbeebicyclingundertakertween girlponytailtomboyboy with glassesgoldfishteasingreceptionistbikedocumentcrying femalefuneral homeallergy11 year oldfourth of julyreference to richard nixonshopping cartmortuarycasketex wifemortalityrocking chairbingocampermorticianblond boyfunfairphonograph recordoathfairgroundfireworksenilitymakeup artistlongingjumping ropecadaverwaspdead fishbeehivebumper carfirst crushmotor homecrying childmenarchecuckoo clockpuppy lovebee stingpunched in the gutex husbandchocolate barsitting in a treecrypony tailskipping ropejoblessembalmingpledge of allegiancetubaprostate cancerstylistteacher crushmajor child rolehypochondriastashbee attackcarnival gamegender in titlethe star spangled bannerfish bowlreference to the marx brotherstree climbingwant adbell bottomslaneswarm of beescarnyinsect attackleaseproducewriting classreference to walter cronkitedeath noticemixed bloodchild killed by an animalmood ringphrenologyschwinn bicyclecrush on teacherrope skippingcosmetologist (See All) |
Tracy Flick is running unopposed for this year's high school student election. But school civics teacher Jim McAllister has a different plan. Partly to establish a more democratic election, and partly to satisfy some deep personal anger toward Tracy, Jim talks popular varsity football player Paul Me …tzler to run for president as well. Chaos ensues. (Read More)
| Subgenre: | black comedygay interestcoming of ageteen moviepolitical satireteen romanceteen comedy |
| Themes: | crueltyangermarriageinfidelityreligionbetrayaljealousypoliticsadulterylesbianismextramarital affairdivorcecorruptionunfaithfulness |
| Mood: | satirehigh school |
| Locations: | schoolnew york citybicyclecatholic school |
| Characters: | teacher student relationshipteacherfemale protagonistbrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenagerteenage girlteenage boystudentlove triangle …gay teenagerself destructivenessteacher student sexlesbian daughterself absorption (See All) |
| Story: | overallscryingtitle spoken by characterone word titlebased on novelf ratedflashbacksex scenekisspartylesbian kissshowervoice over narration …urinationblondeprayermanhattan new york cityconfessionlimousinefired from the jobelectionkissing while having sexclass differencesteenage sexwashington d.c.freeze framedestinyteen angstathletejoggingbroken legapplemoralityjanitorcynicismhot tubswingposterfemale female kissgraduationteachingethicsteenage loveblonde womanmotel roombeeelection campaignpolitical campaignenvyteenage daughterteenage sexualitystatue of liberty new york cityjointjockpolitical candidatespitteenage crushsex with a minormarital infidelitygirls' schoolnebraska16mmhigh school athletepepsibracesbannerpower plantcampaigningclicheridiculedumped by girlfriendphotocopiermultiple narratorsbee stinglesbian teensprinkler systemteen lovehistory teacherlawn mowingasparaguspinpower lineapple treepower stationlesbian sisternarcissistic personality disorderchemistry classgirl girl relationshipomaha nebraskaoverachieverskiing accidentwipemathematics teacherfaculty loungehigh school electionlincoln memorial washington d.c.student council presidentmuseum guideteenage issuesparochial schoolschool administratorhigh school vice principalwide angle lensstudent governmentvote tampering (See All) |
Zahra's shoes are gone; her older brother Ali lost them. They are poor, there are no shoes for Zahra until they come up with an idea: they will share one pair of shoes, Ali's. School awaits. Will the plan succeed?
| Themes: | friendshiplovereligionpovertyillness |
| Mood: | rain |
| Locations: | waterschoolbicycleurban settinglakestormbicycle accident |
| Characters: | teacher student relationshiplittle girlbabybrother sister relationshipfamily relationshipsmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfriendchildrenboygirlstudent …photographerlittle boy (See All) |
| Story: | blackboardprincipalchild's point of viewclassroomcryingdogwatching tvcamerasecretlietearsrunninglow budget filmneighborriver …competitionsoccervideo camerabridgeunderwater scenesearchliarlightningbrotherclassracingtrusttearaceslow motionhonorstreet lifeiranpromiseshoesintriguelostblind mantrophylandlordceremonygardeninglaundrysneakerssubtitlesbicyclinggardenerprizegoldfishshoeiranianbakerymosqueschoolteacherjumpingsaltvictorypotatocommitmentpencilwinnersugarhijabtehran iranbubblesocksschoolyardperseverancesibling relationshipbullhornneorealismgarbage collectorrugolder brotherfoot racegrocerblisterlistening to the radioshoemakerlatenesscouponfingernailrelay racebrake failurelong distance runnerballpoint penlate for schoollost shoeslippersoaking feetgutterpair of shoestime watchkoi pondholiday campcobbler the shoemakerschool recessdistance runninglong distance race (See All) |
As an idle, good-natured bachelor, Uncle Buck is the last person you would think of to watch the kids. However, during a family crisis, he is suddenly left in charge of his nephew and nieces. Unaccustomed to suburban life, fun-loving Uncle Buck soon charms his younger relatives Miles and Maizy with …his hefty cooking and his new way of doing the laundry. His carefree style does not impress everyone though - especially his rebellious teenage niece, Tia, and his impatient girlfriend, Chanice. With a little bit of luck and a lot of love, Uncle Buck manages to surprise everyone in this heartwarming family comedy. (Read More)
| Subgenre: | fish out of water |
| Themes: | dysfunctional familydrunkennessunemployment |
| Mood: | high schoolnightaffection |
| Locations: | carchicago illinois |
| Characters: | teacher student relationshiplittle girlbrother sister relationshipfamily relationshipsmother daughter relationshipteenagerboyfriend girlfriend relationshipteenage girllittle boyuncle nephew relationshipuncle niece relationshipbrother in law sister in law relationship |
| Period: | 1980s |
| Story: | pancakesarcasmmisunderstandingwatching televisioncookingtitle spoken by charactercharacter name in titledogtwo word titlepunched in the facebirthdayneighborbound and gaggeddinnercigar smoking …clownsuburbproduct placementcharacter says i love youprofanityheart attackgolfteen angstbabysittertwinsfather figurebowlinggamblertelling someone to shut upvacuum cleanertween girlredheaded womanmaking out15 year oldcoughingkiss on the lipsbowling alleyrespecthouse partyman wearing glassesfamily homehatchetracetrackanswering machine messageperson in a car trunkreference to karl marxfear of commitmenttireends with freeze frame40 year olddefiancedressing gown6 year oldattitudemother daughter hugfalling out of bedreference to mikhail gorbachevsharing a bedbreaking a plateelectric drillhit by a doorhit on the head with a balljalopysinging along with radiocaught eavesdroppingeavesdropping at a doorhit with a golf ballbound and gagged with duct tapecrazy uncleparent teacher meeting (See All) |
After a little white lie about losing her virginity gets out, a clean cut high school girl sees her life paralleling Hester Prynne's in "The Scarlet Letter," which she is currently studying in school - until she decides to use the rumor mill to advance her social and financial standing.
| Subgenre: | teen movieteen comedyteen sex comedy |
| Themes: | adoptionfriendshipmarriageinfidelityreligionadulterydrinkingextramarital affairdivorceguiltunfaithfulnessdatinghomophobiadevilreligious intolerance |
| Mood: | satirehigh school |
| Locations: | schoolrestaurantchurchswimming poolkitchensinging in the shower |
| Characters: | teacher student relationshipbest friendteacherfemale protagonistbrother sister relationshipfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshiphomosexualfather son relationshipteenagerfriendboyfriend girlfriend relationship …singerboyteenage girlprostituteteenage boygirlstudentpriestchristianreference to godchristianitybiblecatholicolder man younger woman relationshipgay teenagerolder woman younger man relationshipgay friendreligious fanaticreligious teen (See All) |
| Period: | 2010s |
| Story: | school principalprincipal's officespellingprincipaltime lapse photographyclassroomcryingfemale nuditydogtwo word titlebare chested malesex scenekissphotograph …singingpartypantiesshowertelephone callcell phonesongmirrorface slapslow motion scenewatching tvdrinkcondomliebeertearssunglassesvibratorbirthdaycafemarijuanareference to jesus christprayerguitarstrippercleavagegay slurbedroomcaliforniabasketballdinnerfalse accusationscantily clad femalespankingtalking to the cameraconfessionmicrophonevirginprotestlocker roomliarmini skirtmoaninggymamerican flaghigh school studentcheerleadercrossgardenclassgraffitifreeze framemachismoscandalcloseted homosexualwaiterhuggingpot smokingloss of virginityfaintinghappinessdemonstrationgossipfloridaone night standvirginitypreacherembarrassmentmovie theatrebloody noserap musiccynicismhypocrisyministerpunched in the stomachaquariumhit on the headpanties pulled downbookstorebelief in godcliffred pantiesclassmatelooking at self in mirrorpastorbigotrypromiscuityfast motion scenesouthern accentoutcastreference to facebooksneakerswoman cryingcafeterianame callingconfessionallegsrumorpeer pressurefascistfriendship between girlsacceptanceadopted sonpopularitycdman in swimsuitguitar playertolerancevolkswagenchick flickreference to googleweekendallergytextingsewingborn again christiandetentionunwanted kissinterracial adoptioncloseted gayinner title cardgay pridemotor scootercheerleader uniformvolkswagen beetleimplied nuditypreachingreputationhappy birthdayice cream coneenglish teachermascotcliquejumping on a beddevil costumegeneration yreference to marlon brandoteen drinkingpetitiongazebospin the bottleabstinencereference to tom cruiseinfamyguidance counselorwebcastbelief in the afterlifewater slidewatching a movie on tvinnuendoreference to mark twaingay man straight woman relationshipbelief in hellpunched in the gut22 year oldsleazecommunity collegevespastdreference to disneylandadoptive father adopted son relationshippicture framemopping a floorpuritangreeting cardcomedic sex sceneenglish classnotorietyschool suspensionanagramgirls' bathroompledgereference to huckleberry finnpietyschool bandcouponorange the fruitschool boardchocolate milkmascot costumepep rallybelief in the deviladoptive mother adopted son relationshipcontact lensessatan worshipbumping into someonestudent councilbad reputationprayer groupreference to alfred kinseycarpoolstate flagthrowing a cell phonebirth control pillreference to home depothand signaljesus freakporno theatrereference to ashton kutcherreference to costcoreference to demi mooreearth dayreference to disney worldhigh school gymnasiumreference to john hughesschool mascotchlamydiafake sexkissing gamepeasrumor mongerschool detentionsharpening a penciltowel snappingcleaning a bathroomcommunity gardenreference to google earthreference to sylvia plathreference to the scarlet letterspreading rumorbreaking a picture framegift cardreference to nathaniel hawthorne (See All) |
After a gentle alien becomes stranded on Earth, the being is discovered and befriended by a young boy named Elliott. Bringing the extraterrestrial into his suburban California house, Elliott introduces E.T., as the alien is dubbed, to his brother and his little sister, Gertie, and the children decid …e to keep its existence a secret. Soon, however, E.T. falls ill, resulting in government intervention and a dire situation for both Elliott and the alien. (Read More)
| Subgenre: | cult filmmelodramavideofish out of waterchrist allegory |
| Themes: | friendshipdeathdrunkennessdancelonelinessspace travelmissing child |
| Mood: | car chase |
| Locations: | schoolforestbicyclebaseballouter spaceschool busschool nursecar bicycle chase |
| Characters: | single motherlittle girlbrother sister relationshipfamily relationshipsmother son relationshipdoctorchildrenbrother brother relationshipgirlnursealienlittle boyalien friendship |
| Period: | 1980s |
| Story: | school principalcarrotchild protagonistchild's point of viewlifting someone into the airflyingdollcharacter name in titledogchasebeersunglassesrunningrock musicscientist …halloweengay slurflashlightcaliforniadisguiseradioacronym in titlespaceshiplatex glovescostumesuburbmissionproduct placementrace against timerabbitscreamflowerufopizzaperiod in titleeyeglassesgamenipples visible through clothingelectronic music scoreloss of friendtoybeardspacecraftblockbusterclassical musicfrogfull mooninnocenceplaygroundconstruction siteresurrectionmiracleheadphonesabsent fatherhearthealingrefrigeratorgovernment agentextraterrestrialyellinglevitationcartoon on tvexpeditionneedlehiding in a closetmedical maskstuffed animaltrick or treatingstrandedinventionstethoscoperhyme in titleroadblockmoustachefamous scorequarantinerainboworchestral music scorepizza deliveryalien contactfamous lineraccoonnoisespacesuitsittingchild swearingyoung boypenis jokeauto theftsurgical gownheadbandghost costumeempathyhazmat suitencounterdefibrillationdefibrillatorimitationketchupmultiple cameosmockerydissectioncoors beerburgerchild driving a cara cappellacurly hairmale tearsbalaclavalifting a male into the airbowler hatfake illnesstransmitterdolly zoomstorm drainhooded sweatshirtcardiopulmonary resuscitationfirst contactr&bstar wars referencetool shedcontemporary settingsetisymphonic music scoreelectrocardiogrambicyclistshot in sequencechildhood innocencefriendly alienscally capbaritonefawnleitmotifrollextraterrestrial alienhealing giftinterspecies friendshipalien visitationfamous entrancepez dispenserbass voicealto voiceeegoldies musicvoice impersonationsearch team (See All) |
This is the story of Enid and Rebecca after they finish the high school. Both have problems relating to people and they spend their time hanging around and bothering creeps. When they meet Seymour who is a social outsider who loves to collect old 78 records, Enid's life will change forever.
| Subgenre: | cult filmindependent filmcoming of ageteen moviecoming of age film |
| Themes: | dysfunctional familyfriendshiplovesurrealismjealousyobsession |
| Mood: | high school |
| Locations: | schoollos angeles californiabuswheelchairsummer school |
| Characters: | teacher student relationshipteacherfather daughter relationshipfriendsingerteenage girlteenage boyjewishpsychiatristolder man younger woman relationshipdysfunctional relationshipart teacher |
| Story: | principalsarcasmironygirl with glassessingle parentcryingf ratedsextwo word titlebare chested malegunfightdancingpartypistol …voice over narrationbased on comic bookold mandinerdrawingsuburbmini skirthigh school studentcult directorrecord playerjazzteen angstcakemovie theaterculture clashbosscensorshipcynicismunderage drinkingmay december romancepunk rockalienationadolescentsurprise after end creditsage differencepractical jokecoffee shopreflectionreal estate agentgraduationboredomloss of jobvideo storebus stopclinicmisfitinfatuationbased on graphic novelshort skirtart exhibitionbechdel test passedracial stereotypeblues musicintimacysex shopolder man younger womanidentity crisisforty somethinghigh school graduationhigh school friendolder man young girl relationshipdyed hairart classsocially awkwardpersonal adnunchakucrossroadsmilkshakeuncertaintysketchbookfried chickenyounger woman older man relationshipolder man younger girlprank telephone callreference to laurel and hardyyounger girl older mangraduation partyelitismgarage salefirst jobplasterconcession standmini martdrama queenrecord collectorrude customer (See All) |
Rose Hathaway is a dhampir, half-vampire and half-human, who is training to be a guardian at St Vladimir's Academy along with many others like her. There are good and bad vampires in their world: Moroi, who co-exist peacefully among the humans and only take blood from donors, and also possess the ab …ility to control one of the four elements - water, earth, fire or air; and Strigoi, blood-sucking, evil vampires who drink to kill. Rose and other dhampir guardians are trained to protect Moroi and kill Strigoi throughout their education. Along with her best friend, Princess Vasilisa Dragomir, a Moroi and the last of her line, with whom she has a nigh unbreakable bond, Rose must run away from St Vladimir's, in order to protect Lissa from those who wish to harm the princess and use her for their own means. (Read More)
| Subgenre: | black comedymartial artscoming of ageteen romancevampire comedy |
| Themes: | supernatural powerfriendshipmurderdeathloverevengesurrealismkidnappingbetrayalfeartorturedancedeceptionmagicparanoia …redemptionsurveillancerivalry (See All) |
| Mood: | high schoolnightmarehalf vampire |
| Locations: | waterschoolhospitalchurchhelicoptermotorcyclecemeterybuswoodscaveschool teachersuv |
| Characters: | teacher student relationshipvillainbest friendteacherfemale protagonistfather daughter relationshipteenagerfriendboyfriend girlfriend relationshipteenage girlteenage boypriesttough guylove trianglevampire …warriorbullyolder man younger woman relationshipvampire girl (See All) |
| Period: | 2010s |
| Story: | school principalgirl with glasseslibraryclassroomcattitle spoken by characterbased on novelbloodviolenceflashbacktwo word titlekissfightphotographparty …knifesurprise endingpistolvoice over narrationdreamshot to deathfistfightcar accidentshot in the chestrescueslow motion scenearrestkissingbrawlhand to hand combatcar crashinterrogationhandcuffsgood versus evilstrangulationmountainmansionmontagestabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequencedouble crosscreatureroommatefemme fatalepantyhoseprincessnecklacetransformationon the runtrainingcharacter repeating someone else's dialoguedangerstabbed in the backperson on firecover uptough girlgymdeath of brotherbodyguardbasementlaptopneck breakingqueenpowerstylized violencerunawaysisterundergroundsabotagesyringewolfloyaltyhypodermic needlesecurity camerajail cellmind controlaction heroinefemale warriorbackpackstabbed in the throatshopping mallescape attemptmentorschool uniformlaughterwisecrack humoryoung loveprison cellgeekcrowpractical jokespelldead animalfemale teachertwist endingblack pantyhosefemale friendship17 year oldstabbed in the armfemale vampirebitten in the neckmonitorguardianoregonpsychic poweropen endedcurecelldead cattwistlesbian subtextvampirismblack dressmind readingpet catanti heroineglowing eyesmontanastrengthmagical girlmagical powerblood drinkingwriting in bloodacademyjudo throwhigh fivestakeblood transfusionrepressed memoryhidden doornunchucksexploding motorcycledeath of petstained glass windowbased on young adult novelsedativeheadmistressvampire bitecomputer discadrenalinetightspyrokinesishealing powerreference to jimmy carterrunaway teenfemale narratorhalf humanvampire versus vampirechild vampirepsychic linkwrist bandageblack tightspsychic visionroyalwriting on walltattoo on neckvampire teethlicking bloodstake through the heartvampire stakedcamera footagedrinking fountainanimal on fireteenage vampiredhampirneck bitepsychic girl (See All) |
Poppy Cross is happy-go-lucky. At 30, she lives in Camden: cheeky, playful, frank while funny, and talkative to strangers. She's a conscientious and exuberant primary-school teacher, flatmates with Zoe, her long-time friend; she's close to one sister, and not so close to another. In this slice of li …fe story, we watch her take driving lessons from Scott, a dour and tightly-wound instructor, take classes in flamenco dance from a fiery Spaniard, encounter a tramp in the night, and sort out a student's aggressive behavior with a social worker's help. Along the way, we wonder if her open attitude puts her at risk of misunderstanding or worse. What is the root of happiness? (Read More)
| Themes: | friendshipjealousypregnancydrinkingdanceparanoiamental illnessbullyinghomelessness |
| Locations: | schoolbarbeachcarbuslondon englandbicyclekitchenurban settinglakegas stationschool teacher |
| Characters: | teacher student relationshiplittle girlteacherfemale protagonistfamily relationshipshusband wife relationshipmother son relationshipfriendboyfriend girlfriend relationshipchildrensingerboydancersister sister relationshipbully …little boyhomeless man (See All) |
| Story: | globeironymisunderstandingchild abusecookingclassroombookbare chested malekissfightcigarette smokingdancingnipplessingingchase …pantiestelephone callcell phonesongunderwearfoodslow motion scenedrinkundressingmasklierunningmarijuanabrawomaneatinginternetdrivingbirddrawingpantyhoseparkargumentsuburbuniformflowerslong takesplit screendatechickenclasspubhappinesseccentricclubimprovisationstreet lifebootsplaygroundspanishmiami floridarowboatscissorsschool uniformbookstorenintendothirty somethingbarbecuepiersocial workerowlabandoned buildingyellingteachingbag over headdockfirst dateplaystationfriendship between womenstreet marketshoutingclinicdenialbumravebackyardtrampolinelearningoptimismdance lessonsex on first datedance classflamencofake breastsspaniarddriving lessoncar keyslessonpink braprimary schoolchildren's bookflatmatelearning to drivetouching breastsclappingpiggy back ridepalm readingthree sistersseat beltafrican anglo30 year oldchiropractordriving instructorpaper bagart projectoptimiststolen bicyclereference to pinocchioarts and craftspicture booktoucanback painshadow boxingcheerfulnessrowing boatcamden town londonosteopathreference to kate winsletnorth londontraffic signanglo african (See All) |
Storks deliver babies...or at least they used to. Now they deliver packages for global internet giant Cornerstore.com. Junior, the company's top delivery stork, is about to be promoted when he accidentally activates the Baby Making Machine, producing an adorable and wholly unauthorized baby girl. De …sperate to deliver this bundle of trouble before the boss gets wise, Junior and his friend Tulip, the only human on Stork Mountain, race to make their first-ever baby drop - in a wild and revealing journey that could make more than one family whole and restore the storks' true mission in the world. (Read More)
| Subgenre: | cgi animation |
| Themes: | revengeloneliness |
| Locations: | helicopterboatjapansubmarine |
| Characters: | baby girlvillainbabyfemale protagonistafrican americanfather son relationshippolicemother son relationshipteenage girlpolice officerpolicemanthiefmysterious villainbaby cryingbaby daughter |
| Period: | 2010s |
| Story: | neglected childglassflyingcryingflashbackchasesurprise endingfiresecretgood versus evilnew yorkdisguisebridgeno opening creditstransformation …factorymanipulationglassestied upchickengolfwolftalking animalbossimaginationanthropomorphic animalfalling to deathplanehearttitle at the endsaunanotepigeonflightrocketstoregolf clubpenguinmachineno title at beginninghelicopter crashfallingafrican american womanmale protagonistforgeryrealtorpolar beartieceobaseball stadiumtragic villainworkaholicyoung boyexecutiveafrican american manfiredflamingobaboonfalling downpelicantalking birdbaby bottlesuspension bridgestorkplaying golfpush buttonantagonistangry bossemuhoming pigeonrobinwarner brosanthropomorphic birdanthropomorphic bearanthropomorphic rabbitvillainymale antagonisttalking bearanimal villaintalking monkeytooth falling outcanada gooseview in sideview mirrorbaby powdercorner storeflying wingbabiesdelivery storknothing happenedtalking rabbittalking wolfuvula (See All) |
Bloomington, Minnesota, 1967: Jewish physics lecturer Larry Gopnik is a serious and a very put-upon man. His daughter is stealing from him to save up for a nose job, his pot-head son, who gets stoned at his own bar-mitzvah, only wants him round to fix the TV aerial and his useless brother Arthur is …an unwelcome house guest. But both Arthur and Larry get turfed out into a motel when Larry's wife Judy, who wants a divorce, moves her lover, Sy, into the house and even after Sy's death in a car crash they are still there. With lawyers' bills mounting for his divorce, Arthur's criminal court appearances and a land feud with a neighbour Larry is tempted to take the bribe offered by a student to give him an illegal exam pass mark. And the rabbis he visits for advice only dole out platitudes. Still God moves in mysterious - and not always pleasant - ways, as Larry and his family will find out. (Read More)
| Subgenre: | dark comedyblack comedy |
| Themes: | dysfunctional familyfriendshipdeathsurrealismmarriagedrugsreligionfearfuneralvoyeurismseductiondivorceparanoiagamblingunemployment |
| Mood: | nightmareambiguous ending |
| Locations: | beachrestaurantswimming poolcarsnowsmall townbuslakecanadaofficerooftopmotelcaveusaschool bus |
| Characters: | teacher student relationshipbest friendteacherbrother sister relationshipfamily relationshipsmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshippolicefrienddoctorsingerbrother brother relationshipteenage boy …nursestudentdetectivepolicemanlawyerlove trianglejewishreference to godbullyprofessorjewuncle nephew relationshipuncle niece relationshipneighbor neighbor relationshipbar mitzvahdivorce lawyer (See All) |
| Period: | 1960ssummeryear 1967 |
| Story: | chalkblackboardmathematicsgirl with glassesstealingwoman with glassesclassroomcatcryingtitle spoken by charactersexfemale nuditynuditybloodbare breasts …sex scenefemale full frontal nuditycigarette smokingsingingchasetelephone calltopless female nuditysongwoman on topdreamunderwearhorsecar accidentwatching tvarrestlettershootingrunningcar crashcafemarijuanabathroomneighborhandcuffsswimmingbrawineold mantoiletstabbed in the chesthousefemale pubic hairman with glassesdrawingritualjourneycoffeecurseprologuesuburbwidowerpossessionstorytellinguniversitypursuitfilm within a filmclassobscene finger gesturesubtitled sceneheart attackrecord playereyeglassesgolfshavingpot smokingcard gamelistening to musicrecordinghunteraccidental deathwristwatchculture clashdriving a carladdermoralityredneckdentistattorneyconvenience storerowboatmedical examinationbribeblack brawedding ringpolandmarital separationsnowingclassmatetragic herosodomymidlife crisispipe smokingsunbathingparking lotbriberyearphonesconfusionunhappy marriagenotebookinsecuritymysticismplastic surgerydoubtgolf clubmotel roomx rayboy with glassesrabbitornadostonedsoupunsubtitled foreign languageimmaturityphysicsbleedinguniversity studentstation wagonminnesotaangstdreamingneuroticmortalityinner title cardhebrewsynagogueorthodox jewdutch anglemortgagephonograph recordnude sunbathinguniversity professormarital crisistv setyiddishquantum physicsleg braceparadoxreference to jimi hendrixspoiled childtoilet stallomentalking to the deadloss of faithpicking a lockyarmulkedead deersleeping on a sofasudden deathuncertaintyanonymous letterdeer huntingabrupt endingtoothachetorahenvelope full of moneyamerican midwestlawn mowingboys' bathroomwanting a divorcespying on someonetopless sunbathinggrade schoolkabbalahoverweight manplaying catchhorse and cartdefamationethnic stereotypekilled in a car accidentlawnkrakow polandmathematics classreference to the old testamentshabbatshivajewish humormenorahfalse friendjewish stereotypeneeding moneynose jobtransistor radiogentiletyphusfleeing the countryphysical examinationfirearm pointed at the cameramathematical equationmarital breakuppsychedelic rockrepressed angertv antennabook of jobcotdrug debtschrodinger's catwalking on a rooffemale neighborrear end car accidenttenureice teamazel tovmerkin wigjew gentile relationshipnasty neighborphysics teachershot at the cameraspying on neighbordybbukdental receptionistjacobs ladderman hugging a manreference to jefferson airplanecysthebrew schoolmidrashpushoverself repressionsouth koreangoyheisenberg uncertainty principlephysics studentshtetl (See All) |
Soon after moving in, Beth, a brainy, beautiful writer damaged from a past relationship encounters Adam, the handsome, but odd, fellow in the downstairs apartment whose awkwardness is perplexing. Beth and Adam's ultimate connection leads to a tricky relationship that exemplifies something universal: … truly reaching another person means bravely stretching into uncomfortable territory and the resulting shake-up can be liberating. (Read More)
| Subgenre: | independent film |
| Themes: | adoptioninfidelityjealousyadulterydrinkingfearfuneralextramarital affairdeath of fatherguiltunfaithfulnessautismradiationgay adoption |
| Mood: | moving |
| Locations: | schoolnew york cityrestauranttrainsnowcemeteryapartmentpolice carcourtroomofficeouter spaceschool director |
| Characters: | little girlbabyteacherafrican americanmother daughter relationshipfather daughter relationshiphusband wife relationshippoliceboyfriend girlfriend relationshipchildrenpolice officerstudentpolicemanwriterlawyer …sister sister relationshiplittle boyemployer employee relationshipchineseengineerlesbian mother (See All) |
| Story: | reading aloudwatching televisionreadingdollclassroombookcryingtitle spoken by charactercharacter name in titleone word titlesexkissfightphotographparty …telephone callvoice over narrationcell phoneunderwearfoodmirrorwatching tvcomputerdrinklietearsbedcafeneighbormanhattan new york citysubjective camerabedroomnew yorkcaliforniaeatingfalse accusationjudgeapologytrialvangraveyardflash forwardparktheatergraveauthorargumentfired from the jobchampagnemassageflowerscourtamerican flaglaptopcharacter says i love youflowerloss of motherclassblack americantwenty somethingwaiterhugginganswering machinetealooking at oneself in a mirrorgay parentstrangerclockapartment buildingpromisetelescopestarnew jerseyplaygroundboxer shortsjob interviewanxietyco workertheatre audiencefirst kisslesbian couplerefrigeratorsnowingnotelooking at self in mirrorplaybenchflagaccountantpresentshynessface maskloss of jobclosetlaundrytestimonycentral park manhattan new york citylast will and testamentfencebroken mirrortheatre productionmessageastronomyforeplayquarreluniversereference to albert einsteintour guidepark benchreference to john f. kennedywashing machinegalaxylunchcalendarraccoonbreaking a mirrorinterracial adoptionspacesuitbroomcourthousequeens new york citysexual arousalreference to harry potterfired from a jobsolar systemfreezerasperger's syndromepadlocktelling a jokejoke tellingcartobservatoryastronomerlooking for a jobroutineschoolyardpre schoolchildren's bookcuddlinggrand central station manhattan new york cityreference to thomas jeffersonreference to mozartlaundry roomgrocerieslooking for workreference to wolfgang amadeus mozartbig bangjob applicationplanetariumtoy makerbreakfast cerealbig bang theorycentral parkreference to f. scott fitzgeraldreference to julia robertsreading to a childsaturn the planettv dinnerpicture booklonely man29 year oldcracked mirroroff broadwaychildren's authorsitting on stepsjail sentencesuspected paedophiledestroying a roommen's clothing storesurrogate unclewestchester new yorkreference to samuel beckettwatching a playkicking a canmacaronireference to clarence darrowwashing a windowfrozen foodsweeping a floorvoice recognitionpeople watchingreference to the little princetoy designer (See All) |
The world is astounded when Willy Wonka, for years a recluse in his factory, announces that five lucky people will be given a tour of the factory, shown all the secrets of his amazing candy, and one will win a lifetime supply of Wonka chocolate. Nobody wants the prize more than young Charlie, but as … his family is so poor that buying even one bar of chocolate is a treat, buying enough bars to find one of the five golden tickets is unlikely in the extreme. But in movieland, magic can happen. Charlie, along with four somewhat odious other children, get the chance of a lifetime and a tour of the factory. Along the way, mild disasters befall each of the odious children, but can Charlie beat the odds and grab the brass ring? (Read More)
| Subgenre: | cult filmcoming of age |
| Themes: | surrealismdancepovertyredemptionrivalrygreedwealthinheritance |
| Mood: | poetic justice |
| Locations: | schoolrestaurantboatelevatorurban settinggermanytunnel |
| Characters: | single motherteacherfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipchildrenboygirlgrandfather grandson relationship |
| Story: | fbi agentoverweight childchild protagonistchild's point of viewlifting someone into the airflyingcharacter name in titlebased on novelpunctuation in titleslow motion scenecomputerbirthdayrivertelevisionspy …factorysplit screencontestgiftsix word titleclass differencesampersand in titletv newsfaintingeccentricimpersonationwhite houseransomdwarfimaginationinventorarizonadisfigurementcaneauctioncontractchocolatecandylaundrytv reporterprizechewing gumfriends who live togethertour guideschoolteacherrags to richesluckfamous scoreforgeryhonestypsychotherapytrapdoorreclusemontanaticketgooserecipeindustrialistminiaturizationspoiled bratscreenplay adapted by authorwish fulfillmentlifting male in airinvalidspoiled childgluttonyindustrial espionagecandy barbelchpleadingpaperboygeesegrandparentnewsstandwallpapersteamboatcandy storeused car salesmanchocolate factorymanufacturersudden change in sizecouch potatoused car dealertelevision addictionimaginary creaturelaundresstest of characterpaddlewheel boattinkercompeting businessesconfectionerscanimate (See All) |
It all begins when young Will Stronghold, the son of the two famous superheroes: Steve and Josie, A.K.A. the incredibly strong, seemingly invulnerable Commander and and the high-speed flying Jetstream. However, Will does not actually know if he has any powers of his own, and has not told his parents … this. He and his best friend, Layla are facing their first day of a secret school in the clouds like none on earth: Sky High, the first and only high school for kids with super-human powers going through crime-fighting puberty. But with no apparent superpowers of his own, however, Will seems destined to grow up a mere sidekick. But as he discovers his true strengths, he'll also learn that it takes loyalty and teamwork to truly become a hero! (Read More)
| Subgenre: | coming of ageconspiracysuperhero |
| Themes: | supernatural powerfriendshiprevengejealousydeceptionfirst loveregretsuperhero school |
| Mood: | high school |
| Locations: | schoolschool busbus driverchinese restaurantschool danceschool nurse |
| Characters: | teacher student relationshipbest friendbabyteacherfather son relationshipfriendlove trianglebully |
| Story: | female herogeniusthrown through a windowflyingtitle spoken by characterkissdancingphotographpartyvoice over narrationunderwearrescuefalling from heightrobotgood versus evil …transformationpainconfessionprologuesuburbmissioncheerleaderpizzanerdloyaltyteen angstenemysalivareconciliationbraverykickingrejectionsuper villainbilliardspunchunderdogsidekickhomecomingfake identityfireballacidweightliftingelectric shockbusiness cardsuperhuman strengthshapeshiftingbreaking through a doorcliquefloatingfortunesodavinesuperpowerblueprintteenage superherogolemyearbookwirefortune cookiedisco ballair ventpower suitpyrokinesisguinea pigmeltingreference to wonder womanhead in a toiletsuperhuman speedclimbing a walllaser visioncrashing through a wallelasticityabsorbing powerduplicationantigravityyouth restoredcatching someone who fallspunching one's fist into a wallglowingiceboxslammed against a wallflying busfreeze ray (See All) |
Juli Baker devoutly believes in three things: the sanctity of trees (especially her beloved sycamore), the wholesomeness of the eggs she collects from her backyard flock of chickens, and that someday she will kiss Bryce Loski. Ever since she saw Bryce's dazzling brown eyes back in second grade, Juli … has been smitten. Unfortunately, Bryce has never felt the same. Frankly, he thinks Juli Baker is a little weird--after all, what kind of freak raises chickens and sits in trees for fun? Then, in eighth grade, everything changes. Bryce begins to see that Juli's unusual interests and pride in her family are, well, kind of cool. And Juli starts to think that maybe Bryce's dazzling brown eyes are as empty as the rest of Bryce seems to be. After all, what kind of jerk doesn't care about other people's feelings about chickens and trees? With Flipped, mystery author Wendelin Van Draanen has taken a break from her Sammy Keyes series, and the result is flipping fantastic. Bryce and Juli's rants and raves about each other ring so true that teen readers will quickly identify with at least one of these hilarious feuding egos, if not both. A perfect introduction to the adolescent war between the sexes. (Read More)
| Subgenre: | coming of ageteen romance |
| Themes: | angerloverevengejealousyunrequited lovefalling in lovefirst love |
| Locations: | schoolbusbicycletruckusaschool busnew school |
| Characters: | little girlteacherfamily relationshipsfather daughter relationshipfather son relationshipmother son relationshipteenagerboyteenage girlteenage boygirlstudentgrandfather grandson relationshipyounger version of characterneighbor neighbor relationship …crying girlnew student (See All) |
| Period: | 1960s1950syear 1963 |
| Story: | first day of schoolelementary schoolchild's point of viewwatching televisionoverallslibraryclassroomcryingtitle spoken by characterbased on novelone word titlevoice over narrationface slapwatching tvpainting …lieneighborsnakedinnerapologychildtreesuburbgardenchickenchainsawcrushyoung lovefamily dinnerlyingauctionnarrated by charactershynessrepeated scenemoney problemsteenage lovemental retardationtrue lovetween girl14 year oldtomboynewspaper articlebare chested boypieclimbing a treemiddle classroosteropposites attractpigtailslack of moneyjunior high schoolmiddle schoolmultiple perspectivesyoung girlbased on young adult novelfirst crushnew hometeenage romancemultiple narratorslarge format camerayear 1957teen lovesitting in a treerepeated scene from a different perspectivedisobediencechicken coopfemale narratorfraternal twinsscience fairseven year oldfamily problemstroubled teenagercutting down a treeshy boytroubled teenage girlfamily quarrelplanting a treebiddingtree climbingmentally retarded persontree plantinggirl slaps boyfaux pastree huggerbossy girlteen angerdate auctionterrariumhole in a fenceundeclared love (See All) |
This is the tale of Harry Potter, an ordinary 11-year-old boy serving as a sort of slave for his aunt and uncle who learns that he is actually a wizard and has been invited to attend the Hogwarts School for Witchcraft and Wizardry. Harry is snatched away from his mundane existence by Hagrid, the gro …unds keeper for Hogwarts, and quickly thrown into a world completely foreign to both him and the viewer. Famous for an incident that happened at his birth, Harry makes friends easily at his new school. He soon finds, however, that the wizarding world is far more dangerous for him than he would have imagined, and he quickly learns that not all wizards are ones to be trusted. (Read More)
| Subgenre: | cult filmfairy taleepicdark fantasy |
| Themes: | dysfunctional familysupernatural powerfriendshipchristmasmoneyghostmonsterheromagiccelebrity |
| Mood: | night |
| Locations: | schooltrainforesttrain stationschool of magic |
| Characters: | teacher student relationshiplittle girlbest friendfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendgirlbullyprofessorwitchuncle nephew relationshipaunt nephew relationship |
| Period: | 1990syear 1991year 1992 |
| Story: | bad parentingbad parentslifting someone into the airchild abusetitle spoken by charactercharacter name in titlebased on noveldogsurprise endingmirrorrescueslow motion sceneswordletterbirthday …good versus evilhalloweenorphansnakeno opening creditschild in perilcreaturetransformationkeyuniformfirst of seriesmissiondragontough girlbankscarschoolgirlratfirst partpowerstrong female characterchesseyeglassesoccultdestinygametalking animalhatwitchcraftblockbusterfrogstrong female leadbreakfastdwarfreverse footagebraverycrossbowzoowizardimmortalityboarding schoolstadiumfamily secretowlelfspellinvisibilitylevitationparalysissorcererfantasy worldpotiontrollidentical twinsorchestral music scoresorcerystutteringtrapdoorschool lifeunicornbroomhuman becoming an animalcult figuremagic wandwoman in uniformmysticchild herofemale ghostgiant creaturegrandfather clockbased on young adult novelinfirmarycloaknew homelifting a male into the airmagical mirrorcentaursteam locomotivemirror does not reflect realityevil wizardflying broombrick wallelitismhereditary gift of witchcraftpoetry recitationinvisibility cloakmagical bookattempted child strangulationforced perspectivemagical broomstickfictitious sportbildungsromanescher stairwayhobgoblinpet as giftquidditchportrait comes to lifetrain platformmagical cloak11th birthdayfaerie talehuman chessboardsnowy owltripping while fleeing (See All) |
In the depths of the 1930's, Annie is a fiery young orphan girl who must live in a miserable orphanage run by the tyrannical Miss Hannigan. Her seemingly hopeless situation changes dramatically when she is selected to spend a short time at the residence of the wealthy munitions industrialist, Oliver … Warbucks. Quickly, she charms the hearts of the household staff and even the seemingly cold-hearted Warbucks cannot help but learn to love this wonderful girl. He decides to help Annie find her long lost parents by offering a reward if they would come to him and prove their identity. However, Miss Hannigan, her evil brother, Rooster, and a female accomplice, plan to impersonate those people to get the reward for themselves which put Annie in great danger. (Read More)
| Subgenre: | cult film |
| Themes: | crueltyadoptionpoliticsdrinkingdrunkennessseductionpovertywealth |
| Mood: | nightmare |
| Locations: | new york cityswimming poolbathtub |
| Characters: | little girlfemale protagonistfather daughter relationshipmother daughter relationshippolicechildrensingergirlpolicemandanceralcoholic |
| Period: | 1930s |
| Story: | braided hairforename as titlechild's point of viewlifting someone into the airdresscryingcharacter name in titleone word titledogfightdancingsingingchasepantiessong …underweardrinkbased on comicrunningmanhattan new york cityfoot chaseorphannew yorkmansionradiolimousinemicrophonebusinessmanuniformrunawayred dressorphanagebald manmovie theatrecapitalismpunchchauffeurdormitoryclosetlaundrygardenertween girlwhistlebillionairetomboydemocratredheaded womangreat depressionrepublicancleaning10 year oldlocketchrysler building manhattan new york cityvillain turns goodpillow fightlifting female in airbucketreference to santa claussweaterventriloquistwashing dishesstray dogbased on stage musicalorphan girlreference to greta garbobackflipchild as main charactercurly hairreference to fred astaireliverpool englandradio programfranklin d. rooseveltreference to j. edgar hooverreference to bette davissomersaultcartwheelfrecklesmopping a floordogcatcherhandstandredheaded girlreference to ginger rogerstin cankicked in the shindead mouseradio city music hall manhattan new york cityreference to the buddhamuttlaundry basketradio commercialscrubbing floorreference to william randolph hearstpig latinwashing a windowlittle orphan annieorphaned girlpulled by the earcomic villainesstiffany's (See All) |
In 1986, In Brooklyn, New York, the dysfunctional family of pseudo intellectuals composed by the university professor Bernard and the prominent writer Joan split. Bernard is a selfish, cheap and jealous decadent writer that rationalizes every attitude in his family and life and does not accept "phil …istines" - people that do not read books or watch movies, while the unfaithful Joan is growing as a writer and has no problems with "philistines". Their sons, the teenager Walt and the boy Frank, feel the separation and take side: Walt stays with Bernard, and Frank with Joan, and both are affected with abnormal behaviors. Frank drinks booze and smears with sperm the books in the library and a locker in the dress room of his school. The messed-up and insecure Walt uses Roger Water's song "Hey You" in a festival as if it was of his own, and breaks up with his girlfriend Sophie. Meanwhile Joan has an affair with Frank's tennis teacher Ivan and Bernard with his student Lili. (Read More)
| Subgenre: | independent filmsemi autobiographical |
| Themes: | dysfunctional familyfriendshiplovemarriageinfidelitymoneyadulterypregnancydrinkingdrunkennessextramarital affairdivorceobsessionunfaithfulnessdating …poetrybreak upregret (See All) |
| Mood: | high school |
| Locations: | schoolhospitalnew york cityrestaurantbathtubelevatorbrothelmuseum |
| Characters: | teacher student relationshipteacherbrother sister relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipteenagerfriendboyfriend girlfriend relationshipdoctorsingerbrother brother relationshipboy …teenage girlteenage boygirlnursepolicemanwriterlawyerpsychiatristolder man younger woman relationshipolder woman younger man relationshipfrench kisschinese foodtalking to oneself in a mirror (See All) |
| Period: | 1980s |
| Story: | dressreadinglibrarycookingclassroombookcatcryingsexmasturbationbare chested malekiss …photographsingingpartypantiesshowertelephone callsongunderwearfoodmirrorface slapwatching tvdrinkcondomletterliebeertearsanimal in titlebedcafebathroomguitarbracandleambulanceeatingtoiletboxingsubwaydinnerno opening creditsparkmicrophonevirginliarclassobscene finger gesturetypewritertherapyheart attackrecord playerlistening to musicrecordingguitaristwatching a movietherapistnosebleedpsychologisttennisbrooklyn new york citycelebrationpillsunderage drinkingfeministtheatre audienceturtlemarital separationsongwriterholding handsearphoneswhalecafeteriaguitar playerjunior high schoolping pongplagiarismpassing outcustodyreference to the rolling stonesbrother in law brother in law relationshipreference to charles dickenssquidtennis playertable tennisoxygen maskpneumoniacustody battlepublishingreptilesleeping on a sofaliterary agentfrecklesreference to f. scott fitzgeraldreference to pink floydradiatorreference to errol flynnreference to franz kafkachild supporttennis proreference to jean luc godardamphibiantape deckgalapagos islandspeanutparent teacher conferencecowboy bootreference to jean paul belmondowriting classschool blazertennis coachhugging pillowjoint custodyletter of rejectionprospect park brooklyn new york cityfolding bedobject in nosereference to john mcenroeslapping someone's handtylenol (See All) |
Former CIA spy Bob Ho takes on his toughest assignment to date: looking after his girlfriend's three kids (who haven't exactly warmed to their mom's beau). When one of the youngsters accidentally downloads a top-secret formula, Bob's longtime nemesis, a Russian terrorist, pays a visit to the family.
| Subgenre: | martial artsslapstick comedy |
| Themes: | herodivorcehome invasion |
| Locations: | schoolhospitalrestaurantswimming poolhotelhelicopterdesertbicycletaxikitchenlaboratorychinese restaurantkitchen fire |
| Characters: | single motherlittle girlbrother sister relationshipfamily relationshipsmother daughter relationshipmother son relationshipboyfriend girlfriend relationshipboyteenage girlteenage boygirltough guyartistaction herobully …interracial relationshiplittle boyrussianchinesestepmother stepdaughter relationshipstepbrother stepsister relationship (See All) |
| Story: | school principalvillainessoverallssingle parentcookingcatviolencefightknifepistolfirecell phonebeatingfistfightface slap …punched in the facecomputerarrestbrawlpaintingshowdownheld at gunpointhand to hand combatneighborhandcuffskung fuhalloweenspybedroomassassinterroristmixed martial artstied to a chairdrivingman with glasseschilddisarming someoneone man armynews reportsuburbundercoverknocked outkicked in the facehalloween costumeamerican flagmartial artistpigtied upsecret agentciafreeze framestylized violencehenchmanmartial arts masterassassination attemptbabysitterkicked in the stomachnosebleedswat teamwristwatchladderlaserchop sockybreakfastgash in the facepunched in the stomachshopping mallkicked in the crotchbooby trapaerial shotundercover agentturtlegadgetsecret identityterrorist plotpumpkinwilhelm screamriding a bicyclestick fightnannysatellitecia agentterrorist groupcartoon on tvtrick or treatingparkourwatchkittencookiemacguffinmeat cleaverski maskbackyardinterracial couplerogue agentoverhead camera shotspy herogarbage cantoilet paperkicking in a doorhummerberetsugargadgetryhands tiedapple computerhair dryerhoseipodnanotechnologyred rosehit with a frying panmarriage ceremonyprincess costumebaconhalloween decorationmother's boyfriendouttakes during end creditslaundry roomwhite suitanimal bitechild spypigletplayboy mansionstepsister stepsister relationshipcookieswedgieoil refinerywire cutterasian man white woman relationshipends with weddingoatmealplayhousesitting on a rooftoptrip and fallvialhit by a falling objectknock knock jokecrash through windowcrashing through a doordoor shut in facebicycle bellbioengineeringfour year oldhandsomenessrobinson r44 raven helicopterok hand signruffled shirtextension ladder (See All) |
A tale told over four seasons, starting in autumn when Juno, a 16-year-old high-school junior in Minnesota, discovers she's pregnant after one event in a chair with her best friend, Bleeker. In the waiting room of an abortion clinic, the quirky and whip-sharp Juno decides to give birth and to place …the child with an adoptive couple. She finds one in the PennySaver personals, contacts them, tells her dad and step-mother, and carries on with school. The chosen parents, upscale yuppies (one of whom is cool and laid back, the other meticulous and uptight), meet Juno, sign papers, and the year unfolds. Will Juno's plan work, can she improvise, and what about Bleeker? (Read More)
| Subgenre: | dark comedycult filmindependent filmteen movieteen comedy |
| Themes: | adoptionfriendshipmarriagejealousypregnancydivorcedrug usebullyingabortionmythology |
| Mood: | high school |
| Locations: | schoolhospitalsnowbicyclewheelchair |
| Characters: | single motherbest friendbabyteacherfemale protagonistfather daughter relationshiphusband wife relationshipmother son relationshipteenagerfriendboyfriend girlfriend relationshipdoctorsingerteenage girlteenage boy …studentdancermusicianlawyersister sister relationshipbullystepmother stepdaughter relationshippregnant teenager (See All) |
| Period: | wintersummer |
| Story: | forename as titleclassroomcryingtitle spoken by charactercharacter name in titleone word titlef ratedsexflashbackdogkissdancingsingingpantiestelephone call …voice over narrationsongunderwearurinationslow motion scenecomputercondomvomitingtearsrunningbathroomguitartelephonenewspaperbandmontagetoiletscantily clad femaleprologueprotestsuburbpay phonehigh school studentchildbirthbasementflowerclassobscene finger gestureteenage sexstrong female characterteen angstloss of virginitylistening to musiccomic bookguitaristdemonstrationcomposerstrong female leadvirginitycommercialattorneyconvenience storeshopping malltitle appears in writingbanananotebenchmarital problemwilhelm screampostervideo tapeteenage pregnancybicyclingpregnancy testponytailclinic16 year oldreceptionistautumncdmailboxpipeguitar playerpromcactusnewborn babysewing machineallergybechdel test passedfilm starts with sexunwanted pregnancywatching a videoanimated creditsminnesotaclerkfurnituredressingkeyboardrunnerpanties hit the floorcheerleader uniformduetunwed pregnancypaperdrugstoretrack and fieldultrasoundtruth or daremicrowaveorange juicehigh school athletewoman in laborunwed mothereffeminacyreference to woody allensuicide contemplationschool lockerteenage motherabortion clinicfolk songhigh school promconvenience store clerkreference to kurt cobainschool cafeteriafingernailsconsidering abortionpositive pregnancy testspring the seasonreference to diana rossdeodorantfour seasonswoman holding a babydiscovering one is pregnantreference to iggy poptrack meetmoving furniturelounge chairnail salonpregnant schoolgirlfolk singingneedlepointtic tacsinfant in cast creditsanti abortion demonstrationreference to the carpenters (See All) |
In a castle high on top of a hill lives an inventor's greatest creation - Edward, a near-complete person. The creator died before he could finish Edward's hands; instead, he is left with metal scissors for hands. Since then, he has lived alone, until a kind lady called Peg discovers him and welcomes … him into her home. At first, everyone welcomes him into the community, but soon things begin to take a change for the worse. (Read More)
| Subgenre: | dark comedyblack comedycult filmcoming of agefairy talefish out of waterchrist allegorymodern fairy tale |
| Themes: | dysfunctional familyrevengesurrealismchristmasjealousydrunkennessdeceptionlonelinessguiltcelebrityunrequited love |
| Mood: | satire |
| Locations: | snowcastlelaboratory |
| Characters: | teacher student relationshipbrother sister relationshipfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipteenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerbully …psychiatristself discovery (See All) |
| Period: | christmas party |
| Story: | lifting a female into the airgeniuslifting someone into the airwoman with glassescharacter name in titlebloodflashbackdogfightcigarette smokingphotographchasebeatingcorpseblood splatter …rescueslow motion scenewatching tvarrestheld at gunpointneighborhandcuffsrevolvermontagedinerstabbed in the chestnonlinear timelinedinnerradiodouble crosscreaturetrainingsuburbstorytellingchristmas treebankscarsadnessgardenmagical realismcult directorgothicegglooking at oneself in a mirrortold in flashbackhappinesscrucifixmad scientistgossipcompassionhaircutburglaryinventorscissorsframe upatticsnowingbarbecuedead boyflat tiregothhairold dark housespiral staircasefreakbully comeuppancedrunk drivingself defensemisfitelectric shockcookiecrashing through a windowcreationaltered version of studio logoplumberhandfamous scoreorchestral music scorehair salontreehousemetaltalentcut handwrongful arrestsittingbloody body of a childtalk show hostbank vaultcuriosityprosthetic limblemonadeorganistfictional talk showrock paper scissorswaterbedsaleswomanice sculpturelock pickcosmeticsartificial humanlimericksymphonic music scorenon statutory female on male rape attemptshow and telltopiarymusic score features choir (See All) |
In New York, the simple and naive just-graduated in journalism Andrea Sachs is hired to work as the second assistant of the powerful and sophisticated Miranda Priestly, the ruthless and merciless executive of the Runway fashion magazine. Andrea dreams to become a journalist and faces the opportunity … as a temporary professional challenge. The first assistant Emily advises Andrea about the behavior and preferences of their cruel boss, and the stylist Nigel helps Andrea to dress more adequately for the environment. Andrea changes her attitude and behavior, affecting her private life and the relationship with her boyfriend Nate, her family and friends. In the end, Andrea learns that life is made of choices. (Read More)
| Subgenre: | coming of agefish out of water |
| Themes: | angerfriendshipbetrayaladulterydivorceillnessrivalrybreak upfashion |
| Mood: | satire |
| Locations: | hospitalnew york citybarrestauranttrainhotelparis francetaxielevatorapartmentmuseum |
| Characters: | single motherfemale protagonistfather daughter relationshipmother daughter relationshiphusband wife relationshipfriendboyfriend girlfriend relationshipphotographerwriteremployer employee relationshipex husband ex wife relationshipdrivershe devil |
| Period: | 2000syear 2006 |
| Story: | precocious childwatching televisionwoman with glassesdresscookingbookcryingbased on novelf ratedinterviewflashbackdogsex scenekissphotograph …surprise endingpantiestelephone callcell phoneunderwearfoodcar accidentcomputercameratearsbirthdaycafemanhattan new york citynewspaperjournalistbrawinecandlewomanmontageeatingsubwaydinnermodelapologyman with glassestransformationcoffeelimousineauthormicrophonefired from the jobchampagneactor shares first name with charactermanagertwinstrong female charactereyeglassesclaim in titletold in flashbackmagazineblockbusterchefjournalismart gallerybroken legmoralityphoto shootshoesbootsconfrontationboston massachusettsjob interviewworkmiami floridamakeupcareerbrushing teethjobnew jobface maskfountaincafeteriacentral park manhattan new york citypublisherspiral staircasecrutchesskirteditorhurricanereceptionistpursefashion showfashion modeldiettimes square manhattan new york cityvanitydesignerclothingbechdel test passedpotatohandbagdressingfemale writerglamourhappy birthdaypersonal assistantreference to harry pottercoatcupcakepublishingcareer womansteakindifferenceincompetencemagazine editorfashion industrythinnesscollege graduateleg in a castambitious womanponchohaute couturehuman resourcesfirst jobgowncheating on one's boyfriendradio city music hall manhattan new york cityphysical appearanceeyelinerroman a cleftownhousenorthwestern universitystarbucks coffeephoto gallerywomen in businesscouturieru.s. national guardcold the illnessnew yorker magazinehit by a taxithrowing a phone into waterweight obsessionreception deskreference to j. k. rowling (See All) |
Ten-year-old Sophie is in for the adventure of a lifetime when she meets the Big Friendly Giant. Naturally scared at first, the young girl soon realizes that the 24-foot behemoth is actually quite gentle and charming. As their friendship grows, Sophie's presence attracts the unwanted attention of Bl …oodbottler, Fleshlumpeater and other giants. After traveling to London, Sophie and the BFG must convince Queen Elizabeth to help them get rid of all the bad giants once and for all. (Read More)
| Themes: | friendshipescapeabduction |
| Mood: | nightmare |
| Locations: | helicopterlondon englandengland |
| Characters: | little girlbrother brother relationship |
| Story: | reading aloudbased on bookroller skatingfemale heroclose up of eyesgirl with glassescattitle spoken by characterdogshowerdreamorphanacronym in titleglassesqueen …eyeglasseshidinggiantflatulenceorphanageeaten aliveimaginationhit in the crotchcannibalvegetariandrunken maninsomniafriends who live togethergarbage truckmagnifying glasssecret passagerocking chairfeastogrewheelbarrowwater towergrandfather clockcaught in the raincaught in a netseedorphan girlwalking in the rainbritish flagplaying catchupside downch 47 chinook helicopterclimbing a ladderstewjumping off a balconyauroragirl wearing glassesbutterfly netblackbirdevil brothersleeping in the openspitting out a drinkcrow's nestginger tabby catroald dahlthrown through the airalley catbagpiperhiding in plain sightvalisedoll houseguilty feelingsjumping into a lakenatural bridgedream catcherpalace guard (See All) |
Peter Pan (Williams) has grown up to be a cut-throat merger and acquisitions lawyer, and is married to Wendy's granddaughter. Captain Hook (Hoffman) kidnaps his children, and Peter returns to Never Land with Tinkerbell (Roberts). With the help of her and the Lost Boys, he must remember how to be Pet …er Pan again in order to save his children by battling with Captain Hook once again. (Read More)
| Subgenre: | cult filmswashbuckler |
| Themes: | adoptiondysfunctional familyrevengekidnappingchristmasheromagic |
| Locations: | snowairplaneboatlondon englandenglandbaseballcity of children |
| Characters: | little girlbrother sister relationshipfamily relationshipsmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipchildrenboygirllawyerlittle boyself discoverymermaid |
| Period: | 1990s20th century |
| Story: | child's point of viewlifting someone into the aircryingtitle spoken by charactercharacter name in titleone word titlebased on novelviolencedogbased on playtelephone callcell phonerescuebattlesword …tearsbedislandgood versus evilorphansword fightdeath of friendman with glassesno opening creditschilddrawingfictional warold womanduelcostumeuniformstorytellinghuggingpiratecaptainslow motionblockbusteranthropomorphismreverse footagefairyskateboardingsnowingdead boyplaysword duelvillain played by lead actoryellingbroken windowshoutingadventure herofantasy worldbaseball capbaseball gamechild kidnappingfriends who live togetheracrobatfather son estrangementoutlaw gangvictorychristmas lightsacrobaticshooksurname as titlefood fightlifting female in airstockholm syndromechristmas decorationsminiaturizationbig ben londonchild's drawingdollhouseteenager fighting adultreference to gandhicaught in a netflying manactress playing male rolefear of flyingbaseball glovechild fighting adulthook for handbattle of witstinker bellcaptain hookflying boyturbulencepants falling downgang that lives togethersheepdogslashexposed underwearopen windowexpression taken literallyanthropomorphic flowernever neverlandseashell bikinicrowingflying girlold english sheepdogthrowing a telephone out a window (See All) |
A master chef, Kate, lives her life like she runs the kitchen at upscale 22 Bleecker Restaurant in Manhattan--with a no-nonsense intensity that both captivates and intimidates everyone around her. With breathtaking precision, she powers through each hectic shift, coordinating hundreds of meals, prep …aring delicate sauces, seasoning and simmering each dish to absolute perfection. (Read More)
| Themes: | deathpregnancydrinkingdeath of motherdepressiongrief |
| Mood: | rain |
| Locations: | schoolhospitalnew york cityrestaurantsnowcemeterykitchen |
| Characters: | aunt niece relationshipsingle motherfamily relationshipsmother daughter relationshipdoctorsingerboygirlstudentdancersister sister relationshipartistactresswaitressgrandmother grandson relationship |
| Story: | school principalprecocious childpancakedollcookingcryingsexkisscigarette smokingdancingphotographsingingtelephone callfirevoice over narration …cell phonesongfoodcar accidentremakeslow motion scenewatching tvdrinklettertearscafeneighbormanhattan new york cityorphansocceroperawinecandlemontageeatingaccidentfishsearchgraveyardparkgraveblindfoldloss of mothertherapypizzarunawaypickup truckwaiteranswering machinebabysittercooktoytherapisteccentricchefhome moviebirthgrocery storejob interviewshoppingabsent fatherdeath of sistervoice over lettersnowingwishalarm clockphoto albumcartoon on tvrunning awayquitting a jobguardianloss of sisterscarfhiding under a bedgame playingopposites attracttai chilobstergoth girlspaghettipillow fightrecipecrossword puzzlefatal accidentcuisinemealsteaksidewalk cafefish marketstuffed animal toyapronchinatown manhattan new york cityitalian foodcookbookmonopoly the board gamerefusing to eatwatching a cartoon on tvfemale chefbistrotruffleculinary artssense of tastefoie grasquailsous chefrestaurant criticsecret ingredientreference to puccinirestaurant reviewpeacock featherpulling tablecloth from under dishes (See All) |
Dante Hicks is not having a good day. He works as a clerk in a small convenience store and is told to come into work on his day off. Dante thinks life is a series of down endings and this day is proving to no different. He reads in the newspaper that his ex-girlfriend Caitlin is getting married. His … present girlfriend reveals to have somewhat more experience with sex that he ever imagined. His principal concerns are the hockey game he has that afternoon and the wake for a friend who died. His buddy Randal Graves works as a clerk in the video store next and he hates his job just about as much as Dante hates his. (Read More)
| Subgenre: | black comedycult filmindependent filmvideo |
| Themes: | angerfriendshipdeathmoneyjealousydrinkingfuneralbreak uppsychological trauma |
| Mood: | satirenight |
| Locations: | carrooftop |
| Characters: | friendboyfriend girlfriend relationshipex boyfriend ex girlfriend relationshipself doubt |
| Period: | 1990s |
| Story: | roller bladesprincipalsarcasmironymisunderstandingmilkdressreadingcattitle spoken by characterone word titledogfightcigarette smoking …photographtelephone callpunctuation in titlewritten by directordrinksecretlierunningbedlow budget filmbathroomfightingtelephonef wordgay slurnewspaperbedroomold manhousejokebrunetteman with glassesjeansargumentkeysuburbwritten and directed by cast memberlong takedirectorial debutcult directornewspaper headlinetwenty somethingperiod in titlerevelationdesirestreeteggfriendship between menragewatching a moviemagazineproduced by directorhome moviedriving a carembarrassmentstupidityshopliftingnew jerseyconvenience storesex talkballfat manfrustrationblack eyesurprisedead manfriendship between boysone daysalesmansexual humorinsultcoinhockeysurprise after end creditst shirtjoypractical jokevideo tapepetconfusionporn magazinefire extinguisherpromiscuous womaninsecuritynecrophiliaspit in the facelong hairvideo storedoubtmale friendshipbitternessdisappointmentimmaturitywrathresponsibilityvhsunderage smokingshirtmistakereading a newspaperdisillusionmentsilencereference to star warsdialogue drivenblack catwatching a videoscatological humortalking about sexclumsinessgrudgetoilet paperclerkworkplacedonutvideo cassettequestionemployeesidewalksigncapmorninggeneration xsnowballhostility16mmlazinessbubble gumstore clerkvhs tapesexual jokehockey playeranti socialtrousersamateur filmirresponsibilityguidance counselorscatologyuncertaintydisgruntled workervideo store clerkpornographic videodisrespecthockey gameconvenience store clerkchild smokingenergy drinkeveningfoolishnesssleeping on the jobamateur filmmakerdisgruntled customerreading a magazineafternoonargument between couplecomplainingslurstar wars referenceshop windowamateur filmmakingtirednessawakened by phonelow paid jobemotional shockinsolencepressure at workamateur directorjay and silent bobpersonal responsibilityabsence from workindiscretionlack of responsibilityhating one's jobshoe polish (See All) |
A family. Rose and Norah, in Albuquerque, lost their mother when they were young. Rose is responsible - a housecleaner, raising her seven-year-old son Oscar. She's also having an affair with Mac, a married cop, her high-school sweetheart. Norah can't hold a job. Their dad, Joe, is quirky. When Oscar … is expelled for odd behavior, Rose wants to earn enough to send him to private school. Mac suggests she clean up after crime scenes, suicides, and deaths that go undiscovered for awhile. Rose enlists Norah, and Sunshine Cleaners is born. Norah bonds with the dead, Rose finds out that it's a regulated business, and complications arise. Can a family marked by tragedy sort things out? (Read More)
| Subgenre: | black comedyindependent film |
| Themes: | dysfunctional familymurderdeathsuicideinfidelitymoneyadulterypregnancymemoryextramarital affairdeath of motherdrug useunfaithfulnessbreak uppolice investigation …suicide of mother (See All) |
| Locations: | schoolrestauranttrainswimming poolcarbathtubelevatortruckmotelfire trucknew mexicosea foodsex in a motel |
| Characters: | single motherteacherfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshippolicemother son relationshiptattooboypolice officerpolicemansister sister relationshipreference to godwaitress …police detectivemaidgrandfather grandson relationshipaunt nephew relationshiptruck driversuicide by gunshottalking to oneself in a mirrorbaby shower (See All) |
| Story: | school principalelementary schoolprecocious childmathematicscryingtitle spoken by characterf ratedsexbloodmale nudityflashbackkissphotographparty …pantiespistolshowertelephone callfirelickingcell phonetitle directed by femalecorpseblood splattercar accidentmirrorshotgunslow motion scenewatching tvundressingbare buttshootingvomitinglietearssunglassesbirthdaybeddead bodymarijuanabedroomflashlightbracandleold manwomanmontagedinerdrivingapologybirthday partyvanold womanbartenderlatex glovesgunshotbinocularskeyfired from the jobliaruniformstorytellingbusinessamerican flagautomobiledeath of husbandbirthday caketv newspot smokingsupermarketcakebabysitterworking classfollowing someonescamembarrassmentcrime sceneremote controlgrocery storeshoessevered fingermobile phonegunshot woundmedicationheavenschool uniformsalesmanslackerswingdead motherchildhood memoryfiremanbeing followedreal estate agentcandytriple f ratedfire extinguisherbirthday presentmotel roomvacuum cleaneramputeepopcornblood stainkittenbusiness cardtrailer parktrain trackssense of smellcleaning ladymaggotprivate schoolcadillaccleaninglesbian subtextmattresshouse on firefast food restaurantdressinghousemaidfordillegitimate sonwomen's bathroomcontaminationhigh school frienddecomposing bodychildhood photogun held to one's headsmall businessburning househazmat suitmodel airplaneshelllawn sprinklertoyotaseminarproblem childbiohazardbelief in heavenone armed manshrimpeight year oldmementoalbuquerque new mexicoreference to coca colatrailer housenewspaper adpost mortemreference to disneylandcandy storeloss of parentused car salesmanblood donationcb radiomexican restaurantstuck in an elevatorgun shopcigarette buttsiamese cathigh school sweethearthouse cleanersporting goods storecleaning crewmodel buildersmall business ownerfanny packfinancial problemsrailroad trestleshooting oneself in the headwealthy womantoy helicopterex cheerleaderhorse ridebed framecrime scene cleanupdonating bloodford econolinehazardous materialtemporary tattoo (See All) |
Long ago up North on the Island of Berk, the young Viking, Hiccup, wants to join his town's fight against the dragons that continually raid their town. However, his macho father and village leader, Stoik the Vast, will not allow his small, clumsy, but inventive son to do so. Regardless, Hiccup ventu …res out into battle and downs a mysterious Night Fury dragon with his invention, but can't bring himself to kill it. Instead, Hiccup and the dragon, whom he dubs Toothless, begin a friendship that would open up both their worlds as the observant boy learns that his people have misjudged the species. But even as the two each take flight in their own way, they find that they must fight the destructive ignorance plaguing their world. (Read More)
| Subgenre: | cult filmcoming of agecomputer animationcgi animation |
| Themes: | friendshipjealousyescapeabuseexecution |
| Mood: | night |
| Locations: | schoolforestboatvillagelakeshipcastlecave |
| Characters: | teacher student relationshipbest friendfather son relationshipteenagerteenage girlteenage boytough guywarrioraction herobullygirlfriendsingle fatherengineerhuman animal relationshipboy hero |
| Story: | cottageclose up of eyeslifting someone into the airflyingsingle parentreadingbased on novelkissexplosionsurprise endingfirevoice over narrationrescuebattlesword …brawlfalling from heightshowdownislandcompetitioncombataxemontagefishno opening creditsanimalfictional warunderwater scenefive word titletrainingattackdragontough girllightningexploding bodyfirst partwaterfalltwintrustmoonheavy raincagefaintinghelmethammerexploding buildingblockbustersheepfemale warriorshieldbraverycrossbowinventor3 dimensional3dmedieval timesvolcanorainstormpublic humiliationflightfireballvikingamputeewellno title at beginningtavernacceptancearenacreativityscandinaviaskyhandexploding houseexploding shipparentingblacksmithrescue from drowninghit with a hammerignoranceteenage heroscottish accentstrong manbattle axefire breathingstudio logo segues into filmnestchange of heartgiant creaturecatapultchorescouncilreptileshoreaurora borealisnorthern lightswarrior womanartificial leginstinctdisabilitiesmisadventureflying dragonpeg legarmadanorseimax versionhook for a handdragon featurehuman versus dragonbelief in godsmisunderstooddisownmenthuman dragon relationship (See All) |
The Earth was ravaged by the Formics, an alien race seemingly determined to destroy humanity. Fifty years later, the people of Earth remain banded together to prevent their own annihilation from this technologically superior alien species. Ender Wiggin, a quiet but brilliant boy, may become the savi …or of the human race. He is separated from his beloved sister and his terrifying brother and brought to battle school in orbit around earth. He will be tested and honed into an empathetic killer who begins to despise what he does as he learns to fight in hopes of saving Earth and his family. (Read More)
| Subgenre: | independent filmmartial artscoming of agespace opera |
| Themes: | dysfunctional familyfriendshipdeathrevengedeceptionmilitaryredemptionbullyingself sacrificeregretspace travel |
| Locations: | schoolbaseballouter spacecavelaboratoryspace stationspace battlemilitary school |
| Characters: | teacherbrother sister relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipfather son relationshipmother son relationshipteenagerchildrentattoobrother brother relationshipboyteenage girlteenage boysoldier …alienwarriorbullyfacial tattoo (See All) |
| Period: | future |
| Story: | child geniuschild prodigyclose up of eyeschild protagonistchild's point of viewcharacter name in titlebased on novelviolencetwo word titlebare chested malefightexplosionsurprise endingshowervoice over narration …beatingdreamfistfightshot in the chestwritten by directorbattlebrawlmaskletterhand to hand combathallucinationfightingshot in the backsubjective camerastrangulationmontagearmysnakeno opening creditschild in perilfictional warspaceshipshot in the legtrainingcharacter repeating someone else's dialoguecharacter's point of view camera shotcover upmanipulationstrong female charactericegamedestructioneggpropagandahelmetcomaspacecraftsergeantenemykicked in the stomachplanetfaked deathstrong female leadteenage protagonistgenocidecolonelpresumed deadalien invasioninvasionanimated sequencepunched in the stomachmentorsibling rivalryparachutee mailhologramtitle at the endlens flarelieutenantlaser guntelepathyfemale soldieranti warcafeteriawar heroremorsedronemajorbully comeuppancecommanderpush upsquitting a jobfighter jetmilitary basespace shuttlefighter pilotsimulationmonitoralien planetexploding shipadmiraldogfightmind readingvideo gameclose up of eyeteenage herospacesuitearth viewed from spacecryogenicssimulation gameleadershiphuman versus alienbombardmentzero gravityhuman in outer spacemaoriexploding planestudent teacher relationshipbased on young adult novelreference to napoleoninfirmaryoutpostsleep deprivationfilm starts with quotenew zealanderkamikazewar gamebasic trainingexploding planetreference to julius caesarreflection in eyetwisted anklemilitary academyejection seatbrother against brotherdysfunctional societyspace navyalien egginsectoid alienpre adolescent (See All) |
'Louisa May Alcott' (qv)'s autobiographical account of her life with her three sisters in Concord, Massachusetts in the 1860s. With their father fighting in the American Civil War, sisters Jo, Meg, Amy and Beth are at home with their mother, a very outspoken women for her time. The story tells of ho …w the sisters grow up, find love and find their place in the world. (Read More)
| Subgenre: | coming of age |
| Themes: | dysfunctional familydeathmarriagechristmaspregnancyillnesstheatrehopewritingfirst love |
| Mood: | affection |
| Locations: | new york citysnowparis francerural settingusa |
| Characters: | little girlbabyfemale protagonistfamily relationshipsfather daughter relationshipmother daughter relationshiphusband wife relationshipdoctorsingerteenage girlgirlsoldierwritersister sister relationshipartist …maidprofessorpregnant wife (See All) |
| Period: | winter19th century1860s |
| Story: | reading alouddresschild abusecatbased on novelf rateddancingsingingpartytitle directed by femaleletterpaintingtearsneighborpiano …operacandleold manpaintervoice overmarriage proposalbinocularscostumechristmas treepianistchildbirthreunionstageactingtwinreference to william shakespearecivil warfireplacebirthrealitypet dogfeministchristmas evemay december romanceice skatingyoung loveboarding schoolgrowing upplayhorse and carriageviolinistvictorian eragiving birthtriple f ratedepidemicpublishertween girltomboysicknessenvykittenmailboxtutoramerican civil warbroken heartloss of sistermassachusettsmanuscripttelegramhorse and wagonpet catexpectant motherchristmas carolhomeworkboarding housechristmas decorationsnightgownsheet musicreference to charles dickensgovernessoil lampstorytellerchalkboardfalling through icebuggyboarderu.s. civil warpost civil warfood shortagecurlingcanvasreference to walt whitmanreference to goethepantaloonemotional healingpregnant sisteremotional depressionreference to friedrich schillerscarlet feversnow sleddingbirth of twinsdance ball (See All) |
The Flintstones and the Rubbles are modern stone-age families. Fred and Barney work at Slate and Company, mining rock. Fred gives Barney some money so he and Betty can adopt a baby. When Fred and Barney take a test to determine who should become the new associate vice president, Barney returns the f …avor by switching his test answers for Fred's, whose answers aren't very good. Fred gets the executive position, but little does he know that he's being manipulated by his boss to be the fall guy for an embezzlement scheme. (Read More)
| Subgenre: | fairy talealternate history |
| Themes: | adoptionfriendshipkidnappingdanceheroguiltgreedself sacrifice |
| Locations: | restaurantcarbusnightclubdesertdance restaurant |
| Characters: | villainlittle girlbest friendbabyfamily relationshipsfriendsingerlittle boysecretary |
| Story: | villainesslifting someone into the airreadingbookcharacter name in titlesequelkissdancingsingingpartyshowerfiresongfoodblonde …runninggood versus evilbound and gaggedbasketballhousebirdbased on tv seriesfantasy sequenceproduct placementstorytellingdebtglasseswitnesstied upsacrificetv newshuggingshavinggameheroineeggenemyblockbusterhomedinosaurbarefoothomelessdeath threatballpunchpetjewelryyellingsandwichlaundrymarketpromotionsuitsleepbased on cartoonmother in lawchild kidnappingaltered version of studio logoprehistoric timesapecavemanspoontelevision setanachronismlynchingbitelifting female in airfurbedtime storyquarrystudio logo segues into filmprehistorycatapultfrying panbreaking glassbonesstone agerich snobtailplayinglayoffpleadingwheelplatedrive in theaterevil plotlawn mowingconcreteattempted escapebusboyneanderthaldictaphonedinosaur eggreboot of seriescave womangarbage disposalembezzler1000000 b.c.buyingmodern stone age humorsnow conestudio logo parodykitchen appliancedinosaur and manpay raisedinosaurs humans coexistpet dinosaur (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com