Please wait - finding best movies...
Forty-six year old Diane Despres - "Die" - has been widowed for three years. Considered white trash by many, Die does whatever she needs, including strutting her body in front of male employers who will look, to make an honest living. That bread-winning ability is affected when she makes the decisio …n to remove her only offspring, fifteen year old Steve Despres, from her previously imposed institutionalization, one step below juvenile detention. She institutionalized him shortly following her husband's death due to Steve's attention deficit hyperactivity disorder (ADHD) and his violent outbursts. He was just kicked out of the latest in a long line of facilities for setting fire to the cafeteria, in turn injuring another boy. She made this decision to deinstitutionalize him as she didn't like the alternative, sending him into more restrictive juvenile detention from which he would probably never be rehabilitated. However, with this deinstitutionalization, she has to take care of him which means only being able to do home based work. Despite they always yelling expletives at each other and Steve sometimes demonstrating those violent tendencies toward her, Die and Steve truly do love each other, his emotions which are sometimes manifested as an Oedipus complex especially as he seems to need her complete attention most specifically when it is being directed at possible male suitors. Their lives, both individually and as a family, are affected with the entrance of two of their neig… (Read More)
Themes: | writingfreedomhopebullyinghumiliationgriefdysfunctional familydeath of fatherracismangerescapedrunkennessfeardrinkingjealousy …moneychristmasfriendship (See All) |
Mood: | rain |
Locations: | taxi drivernew carcanadataxibicyclebusbathtubswimming pooltrainrestaurantbeachbarhospital |
Characters: | neighbor neighbor relationshipmother loveuncle niece relationshipolder woman younger man relationshipfrenchsingle motherbullylawyerbabyphotographerdancergirlteacherteenage boysinger …doctorboyfriend girlfriend relationshipfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationshipteenager (See All) |
Period: | year 2015year 1982year 2010near future2010s |
Story: | reading a booktelephone bookmicrowave ovenmontreal quebecapple piehiding in a closetfoot pursuitnecklace yanked offtitle appears in writingrunning mascaraaddress bookputting one's head underwater in a bathtubspitting out a drinkmale in bathtubrearview mirror …surveillance cameralooking at oneself in a mirrorhigh school teacherdrinking from the cartoncrying malevideo camerasubjective cameracrying womansinging out of tunegraduation photographtelephone callmother son kissthreat of violencebudding friendshiptroubled teenagerlighting a cigarette from a cigarettewalking down the middle of a streetholding one's hand over someone's mouthlistening to music on a radiomentally challenged slurdropping out of schoolcomputer programmingfalling to one's kneescleaning a swimming poolson hits mothernational health servicegraduation cap and gowncanadian governmentinvoluntary commitmentimitating fellatiofinancial problemslack of educationscotch tapemoving awayaspect ratiofirst aid kitblack slangprocess serverviolent child46 year oldwedding bouquetjuvenile halljuvenile crimemessage in a bottlemood swingwrist bandagehyperactivitylongboardmaking faceshyperventilatingsticking out one's tonguehouse cleaninginstitutionalizationsummonsvagina slurpetty theft360 degree well shotdetention centergarage salewading in waterhomeschoolingtapestrystocking caplooking through a windowlate for workblack leather jackettutoringsalesclerkchain link fencewaving goodbyemaniawinkingincest subtexttouching someone's breastscopy machineadhdpsychiatric wardgrocery shoppingband aidduffel baggroceriesmiddle aged womanoedipus complexlooking for a joblooking in a windowvoice mailclotheslinekiss on the cheekconfinementbeing watchedwatching someonedictionaryapplying makeupbubble gumoxygen maskwine bottledead husbandaerial photographymicrowavebegins with textblond manmissing fatherdoorbellskepticismpsychiatric hospitalwelfarewedding cakeeggsleg woundbride and groomhomeworkselfieshopping cartpsychosisdressingpencilradio newswashing machinestutteringmailmandisc jockeylip synchingcleaning ladychewing gumfemale friendshipsense of smelln wordawkwardnesswrist slittingstrait jacketbaseball caprespectgiving a toastcdhamburgerwhistling15 year oldcoughingstonedvacuum cleanerlooking out a windowlawsuitname callingshoutingloserdead fatherhead woundhit in the facequebectaserlaundryclosethandshaketranslatorparking lotjuvenile delinquentrefrigeratorcellphoneblood on faceracistsurprisepridecigarette lightercard playinglaughterenglishskateboardingheadphonespower outagekaraokeattempted suicidekickingmobile phoneboxer shortsinventorconfrontationcynicismsufferingmale underwearpromiseapplechokingembarrassmentfateskateboardwalkie talkievandalismragelawsupermarketteashavingeyeglassesarsonsleepingloss of fatherdomestic violencesadnessautomobilepursuitbraceletbankreadingdebtstorytellingfired from the jobliarscreamingprologuemicrophoneargumentracial slurpainnecklacevandream sequenceapologysuicide attemptwidoweatingmontageambulancecookinggay slurf wordtelephoneneighborcafebirthdayrunningsunglassestearsliebookletterdrinkcamerapunched in the faceslow motion sceneface slapmirrorcar accidentfoodsongcryingchasesingingphotographejaculationdancingcigarette smokingbare chested maleone word titlekissbloodviolencefightmasturbation (See All) |
59 year old Ove is the block's grumpy man who several years earlier was deposed as president of the condominium association, but he could not give a damn about being deposed and therefore keeps looking over the neighborhood with an iron fist. When pregnant Parvaneh and her family moves into the terr …aced house opposite and accidentally backs into Ove's mailbox it turns out to be an unexpected friendship. A drama comedy about unexpected friendship, love and the importance of surrounding yourself with the proper tools. (Read More)
Themes: | griefdeath of fatherangerdrinkingmoneyfriendship |
Mood: | rain |
Locations: | bicyclebusswimming pooltrainrestauranthospital |
Characters: | neighbor neighbor relationshipfrenchbabyphotographerdancergirlteacherteenage boydoctorfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | reading a bookrearview mirrorlooking at oneself in a mirrortelephone calloxygen maskbride and groomlooking out a windowname callinghead woundhit in the facelaughterattempted suicidemale underwearpromisechoking …fateeyeglassessleepingloss of fatherpursuitprologueapologysuicide attemptambulancef wordtelephoneneighborcaferunningliebookletterdrinkcameraslow motion scenemirrorfoodcryingchasephotographdancingbare chested malekissblood (See All) |
Early summer. In a village in northern Turkey, Lale and her four sisters are walking home from school, playing innocently with some boys. The immorality of their play sets off a scandal that has unexpected consequences. The family home is progressively transformed into a prison; instruction in homem …aking replaces school and marriages start being arranged. The five sisters who share a common passion for freedom, find ways of getting around the constraints imposed on them. (Read More)
Themes: | freedomescapedrunkennessfeardrinkingmoney |
Locations: | busbeachhospital |
Characters: | uncle niece relationshipdancergirlteacherteenage boysingerdoctorboyfriend girlfriend relationshipmother son relationshipteenager |
Story: | looking at oneself in a mirrorsubjective cameratelephone callhouse cleaningwading in waterchewing gumgiving a toastvacuum cleanerlooking out a windowname callingshoutingappleteasleepingdomestic violence …pursuitreadingscreamingapologyeatingambulancecookingtelephonerunningbookdrinkslow motion sceneface slapmirrorcar accidentfoodsongcryingchasesingingphotographdancingone word titlekissbloodviolence (See All) |
Themes: | humiliationfeardrinkingmoneyfriendship |
Locations: | taxibathtubswimming poolrestaurantbeach |
Characters: | photographerdancersingerfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | crying womantelephone callimitating fellatiovagina slurkiss on the cheekdoorbellgiving a toastvacuum cleanersufferingmale underweareyeglassesdomestic violencepursuitmicrophonepain …apologyeatingf wordtelephonecaferunningsunglassesdrinkcameraface slapfoodsongcryingchasesingingphotographejaculationdancingcigarette smokingbare chested maleone word titleviolencefightkissblood (See All) |
Maria Altman sought to regain a world famous painting of her aunt plundered by the Nazis during World War II. She did so not just to regain what was rightfully hers, but also to obtain some measure of justice for the death, destruction, and massive art theft perpetrated by the Nazis.
Themes: | humiliationdeath of fatherescapedrinkingmoney |
Locations: | taxibicycle |
Characters: | uncle niece relationshiplawyerbabydancergirlsingerdoctorfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorcrying womantelephone callclotheslinekiss on the cheekbride and groomradio newsgiving a toastlawsuithandshakeparking lotcellphonepridecynicismeyeglasses …sleepingpursuitdebtliarnecklaceapologymontagef wordtelephonerunningsunglassestearsliebookletterdrinkmirrorsongcryingchasesingingphotographdancingcigarette smokingfight (See All) |
A young idealistic English filmmaker, Sue, arrives in India to make a film on Indian revolutionaries Bhagat Singh, Chandrashekhar Azad and their contemporaries and their fight for freedom from the British Raj. Owing to a lack of funds, she recruits students from Delhi University to act in her docu-d …rama. She finds DJ, who graduated five years ago but still wants to be a part of the University because he doesn't think there's too much out there in the real world to look forward to. Karan, the son of Industrialist Rajnath Singhania, who shares an uncomfortable relationship with his father, but continues to live off him, albeit very grudgingly. Aslam, is a middle class Muslim boy, who lives in the by-lanes near Jama Masjid, poet, philosopher and guide to his friends. Sukhi, the group's baby, innocent, vulnerable and with a weakness for only one thing - girls. Laxman Pandey, the fundamentalist in the group, the only one who still believes that politics can make the world a better place and finally Sonia - the sole girl in the group, tomboy and vivacious spirit, engaged to Ajay - the dashing air pilot. Through her film, Sue wishes to showcase to the world the efforts of these young revolutionaries and the enormity of their contribution to the freedom movement in India. What unfolds is the inspiration behind Sue's passion for bringing their story to the world. The twist in the tale is of course the fact that more than just telling the world, Sue's film makes DJ and his friends stop… (Read More)
Themes: | freedomgriefangerdrunkennessfeardrinkingmoneyfriendship |
Mood: | rain |
Locations: | taxi drivertaxibicycletrainbarhospital |
Characters: | babydancergirlsingerdoctorboyfriend girlfriend relationshipfriendhusband wife relationshipmother son relationship |
Story: | reading a booklooking at oneself in a mirrorsubjective cameratelephone callwading in waterapplying makeupoxygen maskdead husbanddoorbellradio newsgiving a toastwhistlinglooking out a windowname callingdead father …head woundhit in the facehandshakepridelaughterkickingpromisefatewalkie talkielawteashavingsleepingpursuitbraceletprologuemicrophoneapologyeatingmontagetelephonerunningsunglassestearsbookdrinkslow motion sceneface slapmirrorfoodsongcryingchasesingingphotographdancingcigarette smokingbare chested malebloodviolencefight (See All) |
Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr …overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)
Themes: | writingbullyingfeardrinkingjealousychristmasfriendship |
Locations: | restauranthospital |
Characters: | bullyphotographerdancergirlteacherteenage boysingerdoctorboyfriend girlfriend relationshipfriendhusband wife relationshipmother son relationshipteenager |
Story: | looking at oneself in a mirrorsubjective cameratelephone callgraduation cap and gowntouching someone's breastslip synchinggiving a toast15 year oldstonedlooking out a windowsurprisekaraokemobile phonesufferingpromise …eyeglassessadnessreadingracial slurpainapologysuicide attempteatinggay slurf wordtelephonecafebirthdayrunningtearsbookletterdrinkcamerapunched in the faceslow motion sceneface slapmirrorcar accidentfoodcryingsingingphotographdancingkissfight (See All) |
Vincent is an old Vietnam vet whose stubbornly hedonistic ways have left him without money or a future. Things change when his new next-door neighbor's son, Oliver, needs a babysitter and Vince is willing enough for a fee. From that self-serving act, an unexpected friendship forms as Vincent and Oli …ver find so much of each other's needs through each other. As Vincent mentors Oliver in street survival and other worldly ways, Oliver begins to see more in the old man than just his foibles. When life takes a turn for the worse for Vincent, both them find the best in each other than no one around them suspects. (Read More)
Themes: | bullyingdrunkennessdrinkingmoneyfriendship |
Locations: | taxibicyclebusbarhospital |
Characters: | single motherlawyerdancerteacherfriendhusband wife relationshipmother son relationship |
Story: | reading a bookrearview mirrortelephone calldoorbellhomeworkmailmanvacuum cleanerlooking out a windowname callinghit in the facelaundryparking lotcellphonecigarette lightercynicism …skateboardeyeglassessleepingsadnessbankapologyeatingmontagef wordtelephoneneighborrunningsunglassestearsbookdrinkface slapfoodcryingphotographdancingcigarette smokingfightblood (See All) |
T.J., a high school freshman, lost his mother two months before in a car accident: his father pops pills and sits on the couch; his grandmother holds things together, chatting and cooking. T.J. wants the car back from the salvage yard where the owner's son is a bully. By happenstance, Hesher, a foul …-mouthed squatter, moves in with T.J's family. T.J. also meets Nicole, a grocery clerk near poverty who helps him once. Hesher involves T.J. in crime, the bully is omnipresent, mom's car is slipping away, dad has checked out, T.J. watches Nicole at work, and his grandma invites him to join her morning walk: the odds are long that T.J. can assemble a family to help him thrive. (Read More)
Themes: | bullyinggriefdrinkingjealousymoneyfriendship |
Mood: | rain |
Locations: | bicyclebathtubswimming pool |
Characters: | older woman younger man relationshipbullyteacherteenage boysingerdoctorfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | telephone calllooking in a windowwashing machinelooking out a windowparking lotcigarette lighterboxer shortssufferingvandalismshavingeyeglassesarsonsleepingpursuitstorytelling …liarprologuepainvanapologyeatingcookingf wordrunningtearsliedrinkpunched in the faceslow motion scenecar accidentfoodsongcryingchasesingingphotographcigarette smokingbare chested maleone word titleviolencebloodmasturbationfight (See All) |
A young man is released from prison after many years and given a new identity in a new town. Aided by a supervisor who becomes like a father to him he finds a job and friends and hesitantly starts a relationship with a compassionate girl. But the secret of the heinous crime he committed as a boy wei …ghs down on him, and he learns that it is not so easy to escape your past. (Read More)
Themes: | bullyingdysfunctional familyescapedrunkennessfeardrinkingjealousyfriendship |
Locations: | taxibusbathtubtrainrestaurantbeachbar |
Characters: | bullylawyerphotographerdancergirlteacherboyfriend girlfriend relationshipfriendmother son relationship |
Story: | surveillance cameratelephone calldressingpridekickingpromiseembarrassmentvandalismsleepingfired from the jobliarscreamingprologuevandream sequence …apologyambulancecafebirthdaytearslieletterdrinkcamerapunched in the faceface slapmirrorcar accidentcryingphotographdancingbare chested malebloodviolencekissfight (See All) |
A mother lives quietly with her twenty-eight-year-old son, Do-joon, providing herbs and acupuncture to neighbors. One day, a girl is brutally murdered, and Do-joon is charged with the killing. Now, it's his mother's call whether to prove him innocent or to leave him imprisoned.
Themes: | writingbullyingdrunkennessfeardrinkingmoneyfriendship |
Mood: | rain |
Locations: | busrestaurantbar |
Characters: | mother lovelawyerdancergirlfriendmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | rearview mirrorsubjective camerawading in waterband aidpsychiatric hospitalname callingcigarette lighterattempted suicidekickingsufferingappleteaarsonsleepingdebt …prologuemicrophonepaineatingcaferunningtearsbookdrinkface slapmirrorcar accidentfoodcryingphotographdancingcigarette smokingbare chested maleone word titlebloodfightviolence (See All) |
Lil ('Naomi Watts' (qv)) and Roz ('Robin Wright (V)' (qv)) are two lifelong friends, having grown up together as neighbors in an idyllic beach town. As adults, their sons have developed a friendship as strong as that which binds their mothers. One summer, all four are confronted by simmering emotion …s that have been mounting between them, and each find unexpected happiness in relationships that cross the bounds of convention. (Read More)
Themes: | death of fatherdrunkennessfeardrinkingjealousyfriendship |
Locations: | busbeachbarhospital |
Characters: | older woman younger man relationshipbabydancerteenage boysingerboyfriend girlfriend relationshipfriendhusband wife relationshipmother son relationship |
Story: | reading a bookrearview mirrorlooking at oneself in a mirrortelephone callleg woundgiving a toastcard playingteasadnessapologywidoweatingf wordtelephoneneighbor …birthdayrunningsunglassestearsliebookdrinkface slapmirrorfoodsongcryingsingingphotographdancingcigarette smokingbare chested malekissfight (See All) |
Class struggle becomes all too real as a young doctor moves into a modern apartment block in suburban 1975 London. Drugs, drink & debauchery dissolve into murder, mayhem and misogyny in this pseudo-post-apocalyptic breakdown of societal norms.
Themes: | drunkennessdrinkingmoney |
Characters: | neighbor neighbor relationshipfrenchbabydancergirldoctormother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorsubjective cameracrying womansticking out one's tonguemaniagrocery shoppingapplying makeupshopping cartname callinghit in the faceparking lotcigarette lighterpower outagekickingsupermarket …shavingeyeglassessleepingdebtscreamingdream sequenceapologyeatingmontagef wordliedrinkpunched in the faceslow motion sceneface slapmirrorfoodphotographdancingcigarette smokingbare chested malekissviolenceblood (See All) |
Returning from Navy service in World War II, Freddie Quell drifts through a series of breakdowns. Finally he stumbles upon a cult which engages in exercises to clear emotions and he becomes deeply involved with them.
Themes: | writingdrunkennessfeardrinkingjealousy |
Locations: | taxibeachhospital |
Characters: | photographerdancersingerdoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrortelephone callvagina slurkiss on the cheekbride and groomgiving a toastlooking out a windowdead fathersleepingpursuitstorytellingmicrophoneapologyeatingmontage …f wordtelephonerunningtearsliebookletterdrinkcameraface slapmirrorfoodsongcryingchasesingingphotographdancingcigarette smokingbare chested malemasturbationviolencefightkiss (See All) |
Seventeen-year-old Greg has managed to become part of every social group at his Pittsburgh high school without having any friends, but his life changes when his mother forces him to befriend Rachel, a girl he once knew in Hebrew school who has leukemia.
Themes: | humiliationgriefdeath of fatherangerdrinkingfriendship |
Locations: | bushospital |
Characters: | single mothergirlteenage boyboyfriend girlfriend relationshipfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrortelephone callwalking down the middle of a streetstocking caplooking in a windowkiss on the cheekdoorbellawkwardness15 year oldstonedlooking out a windowname callingcellphonesurpriseheadphones …promisestorytellingprologueapologyeatingmontageambulancetelephonelieletterdrinkslow motion scenemirrorfoodsongcryingsingingphotographfightmasturbation (See All) |
Based on Rosalie Ham's best selling novel, The Dressmaker is the story of femme fatale Tilly Dunnage who returns to her small home town in the country to right the wrongs of the past. A stylish drama with comic undertones about love, revenge and haute couture.
Themes: | bullyingdrinkingfriendship |
Locations: | busbathtubtrain |
Characters: | bullyphotographerdancergirlsingerfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | crying womantelephone calllooking in a windowbride and groomlooking out a windowname callingboxer shortsteaeyeglassesarsonsleepingpursuitbankdebtscreaming …microphoneapologyf wordtelephonerunningsunglassesliebookletterdrinkcameraface slapmirrorsongchasesingingphotographdancingcigarette smokingbare chested malebloodkissviolence (See All) |
The true story of London's most notorious gangsters, twins Reggie and Ronnie Kray. As the brothers rise through the criminal underworld, Ronnie advances the family business with violence and intimidation while Reggie struggles to go legitimate for local girl Frances Shea. In and out of prison, Ronni …e's unpredictable tendencies and the slow disintegration of Reggie's marriage threaten to bring the brothers' empire tumbling to the ground. (Read More)
Themes: | griefdrunkennessfeardrinkingjealousymoneychristmas |
Mood: | rain |
Locations: | taxirestaurantbar |
Characters: | photographerdancergirlsingerboyfriend girlfriend relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorsubjective camerawalking down the middle of a streetvagina slurincest subtextclotheslinekiss on the cheekdoorbellgiving a toastlooking out a windowname callingblood on facecigarette lighterlaughterkicking …cynicismsufferingpromiseteaeyeglassesdomestic violenceautomobiledebtprologuemicrophonepainapologyeatinggay slurf wordbirthdayrunningliedrinkcamerapunched in the faceface slapmirrorfoodsongsingingphotographdancingcigarette smokingbare chested maleone word titleviolencebloodkiss (See All) |
The story of John Lennon's childhood and teenage years from 1944 to 1960, his relationship with his aunt Mimi and his mother Julia -the two dominant women in the first part of his life-, his first meeting with Paul McCartney and George Harrison, their friendship, their love for music and the birth o …f The Beatles. (Read More)
Themes: | angerdrunkennessdrinkingmoneyfriendship |
Locations: | bicyclebusrestaurant |
Characters: | babydancergirlteacherteenage boysingerboyfriend girlfriend relationshipfriendhusband wife relationshipmother son relationship |
Story: | telephone callmailmanlooking out a windowrageteasleepingsadnessreadingmicrophoneargumentwidoweatingmontageambulancetelephone …cafebirthdayrunningtearsliebookletterdrinkpunched in the facemirrorfoodsongcryingsingingphotographdancingcigarette smokingbloodkissmasturbation (See All) |
Ishaan Awasthi is an eight-year-old child whose world is filled with wonders that no one else seems to appreciate; colours, fish, dogs and kites are just not important in the world of adults, who are much more interested in things like homework, marks and neatness. And Ishaan just cannot seem to get … anything right in class. When he gets into far more trouble than his parents can handle, he is packed off to a boarding school to 'be disciplined'. Things are no different at his new school, and Ishaan has to contend with the added trauma of separation from his family. One day a new art teacher bursts onto the scene, Ram Shankar Nikumbh, who infects the students with joy and optimism. He breaks all the rules of 'how things are done' by asking them to think, dream and imagine, and all the children respond with enthusiasm, all except Ishaan. Nikumbh soon realizes that Ishaan is very unhappy, and he sets out to discover why. With time, patience and care, he ultimately helps Ishaan find himself. (Read More)
Themes: | hopebullyingangerfeardrinkingjealousyfriendship |
Locations: | taxibicyclebustrain |
Characters: | bullybabydancerteachersingerfriendhusband wife relationshipmother son relationship |
Story: | reading a booklooking at oneself in a mirrorsubjective cameracrying womantelephone callmaking faces360 degree well shotwaving goodbyeapplying makeupdoorbellhomeworkdressingpencilwhistlingname calling …laughtersufferinglawshavingeyeglassessadnessliarprologueapologyeatingmontagecookingtelephonerunningtearslieface slapmirrorfoodsongcryingsingingphotographdancingkissfight (See All) |
Steven Russell is happily married to Debbie, and a member of the local police force when a car accident provokes a dramatic reassessment of his life. Steven becomes open about his homosexuality and decides to live life to the fullest - even if it means breaking the law. Steven's new, extravagant lif …estyle involves cons and fraud and, eventually, a stay in the State Penitentiary where he meets sensitive, soft-spoken Phillip Morris. His devotion to freeing Phillip from jail and building the perfect life together prompts Steven to attempt and often succeed at one impossible con after another. (Read More)
Themes: | moneychristmasfriendship |
Locations: | taxi drivertaxirestauranthospital |
Characters: | lawyerdancergirlfriendmother daughter relationshipfather daughter relationshiphusband wife relationship |
Story: | looking at oneself in a mirrorsubjective cameratelephone callchewing gumn wordsurprisemale underwearpromiselawsupermarketshavingeyeglassesreadingdebtliar …racial slursuicide attempteatingambulancegay slurcafebirthdayrunningtearsliebookletterpunched in the faceface slapmirrorcar accidentfoodcryingsingingdancingbare chested malemasturbationkissblood (See All) |
Frank Adler (Chris Evans) is a single man raising a child prodigy - his spirited young niece Mary (Mckenna Grace) in a coastal town in Florida. Frank's plans for a normal school life for Mary are foiled when the seven-year-old's mathematical abilities come to the attention of Frank's formidable moth …er Evelyn (Lindsay Duncan) whose plans for her granddaughter threaten to separate Frank and Mary. Octavia Spencer plays Roberta, Frank and Mary's landlady and best friend. Jenny Slate is Mary's teacher, Bonnie, a young woman whose concern for her student develops into a connection with her uncle as well. (Read More)
Themes: | bullyingangerfearmoneyfriendship |
Locations: | taxiswimming poolrestaurantbeachbarhospital |
Characters: | uncle niece relationshipbullylawyerdancergirlteachersingerfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorcrying womanlooking out a windowname callinghead woundcellphoneattempted suicidepromiseeyeglassessleepingsadnessmicrophoneapologymontageneighbor …runningsunglassesletterslow motion sceneface slapmirrorsongsingingphotographdancingone word titlefightkiss (See All) |
Betty Anne Waters (Swank) is a high school dropout who spent nearly two decades working as a single mother while putting herself through law school, tirelessly trying to beat the system and overturn her brother's (Rockwell) unjust murder conviction.
Themes: | death of fatherfeardrinkingjealousymoneychristmasfriendship |
Locations: | bar |
Characters: | single motherlawyerbabyphotographerdancergirlboyfriend girlfriend relationshipfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | telephone callwrist slittingprideattempted suicidepromiselawsupermarketliarapologyeatingrunningsunglassestearslieletter …drinkcamerapunched in the faceface slapmirrorfoodcryingphotographdancingcigarette smokingbare chested maleone word titlebloodviolencefight (See All) |
Kris is attacked one night, and hypnotized, using a grub with hypnotic properties, administered by a thief. She follows the thief's instructions to give him everything, even taking out loans. After the worms are extracted, she wakes up to find her life ruined. She's lost her job, her finances are de …stroyed. Years later, she meets Jeff whom she may have a lot in common with. (Read More)
Themes: | drinkingmoney |
Mood: | rain |
Locations: | bicyclebathtubswimming pooltrainrestaurantbarhospital |
Characters: | mother daughter relationshiphusband wife relationship |
Story: | reading a bookputting one's head underwater in a bathtubdrinking from the cartonvideo cameratelephone callleg woundwhistlinglooking out a windowhead woundsupermarketeyeglassessleepingbankreadingfired from the job …apologyeatingambulancetelephonecaferunningbookdrinkfoodphotographbloodkissfight (See All) |
Julieta (Emma Suarez) is a middle-aged woman living in Madrid with her boyfriend Lorenzo. Both are going to move to Portugal when she casually runs into Bea, former best friend of her daughter Antia, who reveals that this one is living in Switzerland married and with three children. With the heart b …roken after 12 years of total absence of her daughter, Julieta cancels the journey to Portugal and she moves to her former building, in the hope that Antia someday communicates with her sending a letter. Alone with her thoughts, Julieta starts to write her memories to confront the pain of the events happened when she was a teenager (Adriana Ugarte) and met Xoan, a Galician fisherman. Falling in love with him, Julieta divides her time between the family, the job and the education of Antia until a fatal accident changes their lives. Slowly decaying in a depression, Julieta is helped by Antia and Bea, but one day Antia goes missing suddenly after a vacation with no clues about where to find her, leaving Julieta desperate to understand the reasons of her missing... (Read More)
Themes: | hopegriefdeath of fatherfearfriendship |
Mood: | rain |
Locations: | taxi drivertaxibusbathtubtrainhospital |
Characters: | single motherbabygirlteacherfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipteenager |
Period: | 2010s |
Story: | reading a booktitle appears in writingcrying womantelephone callmiddle aged womankiss on the cheekdoorbellradio newsfemale friendshipgiving a toastrespectname callingpromiseteaeyeglasses …loss of fatherpainapologyeatingcookingtelephonesunglassesbookletterslow motion scenefoodphotographcigarette smokingbare chested maleone word titlekiss (See All) |
Baby is a young and partially hearing impaired getaway driver who can make any wild move while in motion with the right track playing. It's a critical talent he needs to survive his indentured servitude to the crime boss, Doc, who values his role in his meticulously planned robberies. However, just …when Baby thinks he is finally free and clear to have his own life with his new girlfriend, Deborah, Doc coerces him back for another job. Now saddled with a crew of thugs too violently unstable to keep to Doc's plans, Baby finds himself and everything he cares for in terrible danger. To survive and escape the coming maelstrom, it will take all of Baby's skill, wits and daring, but even on the best track, can he make it when life is forcing him to face the music? (Read More)
Themes: | death of fatherangerescapefearmoney |
Mood: | rain |
Locations: | taxibicyclerestaurant |
Characters: | babydancersingerboyfriend girlfriend relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Period: | 2010s |
Story: | rearview mirrorsubjective cameratelephone callbubble gumblond manwashing machinelip synchingchewing gumbaseball caplooking out a windowname callinghit in the faceparking lotcellphoneheadphones …mobile phonewalkie talkierageeyeglassesloss of fatherdomestic violenceautomobilepursuitbankdebtscreamingprologuemicrophoneracial slurvanapologymontagegay slurf wordtelephonecaferunningsunglasseslieletterpunched in the faceslow motion scenecar accidentfoodsongchasesingingphotographdancingcigarette smokingbloodviolencekiss (See All) |
After the Battle of Gallipoli, in 1915, an Australian farmer, Connor (Russell Crowe), travels to Turkey to find his 3 missing sons. While staying at a hotel in Istanbul, he meets Ayshe (Olga Kurylenko), the hotel manager. And tries to find a way to Gallipoli.
Themes: | hopehumiliationgriefangerdrinkingfriendship |
Locations: | trainbeach |
Characters: | dancergirlsingerfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorcrying womankiss on the cheekdead husbandgiving a toasthandshakecigarette lighterprideenglishkickingpromisefateteaeyeglassespursuit …liarapologywidowrunningtearsliebookdrinkslow motion sceneface slapmirrorfoodsongcryingchasesingingphotographdancingcigarette smokingbare chested malebloodviolencefight (See All) |
In late 1951, Eilis Lacey, a young Irish girl, emigrates to Brooklyn. Sponsored by Father Flood, a priest from her native town Enniscorthy, she is assured to find a full-time job there. But the early days are tough, seasickness being soon replaced by loneliness and homesickness, two feelings all the … more acutely felt by Eilis for having had to leave behind her widowed mother and her dear sister Rose. She nevertheless little by little manages to find her footing by adapting to her job as a salesgirl, by studying bookkeeping at Brooklyn College as well as with a little help from both Father Flood and Mrs. Kehoe, the owner of the boarding school she now lives in. And not only does graduation follow but love shows its face in Tony, an Italian-American plumber, full of adoration and respect for her. They end up marrying, although keeping the thing secret. It is at that point that tragedy strikes inciting Eilis to return to Enniscorthy to support her mother morally. And there a strange thing happens : she gradually gets lured by the charms of her native place, going far as to let herself be wooed by Jim Farrell, a young local. (Read More)
Themes: | drinkingjealousymoneychristmasfriendship |
Locations: | taxitrainrestaurantbeachbar |
Characters: | dancergirlteachersingerboyfriend girlfriend relationshipfriendmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorsubjective cameracrying womantelephone callsalesclerkwaving goodbyedead husbandbride and groomrespectgiving a toastwhistlingname callingdead fatherpromisetea …eyeglassessadnessprologueapologyeatingambulancef wordtelephonesunglassestearsletterdrinkmirrorfoodsongcryingsingingphotographdancingcigarette smokingbare chested maleone word titlekiss (See All) |
Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen …ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)
Themes: | griefangerescapefearfriendship |
Locations: | hospital |
Characters: | babyteacherteenage boydoctorfriendhusband wife relationshipmother son relationship |
Period: | 2010s |
Story: | looking at oneself in a mirrorvideo camerasubjective cameracrying womantelephone callwine bottleclosetblood on facesurprisemobile phonesleepingdomestic violenceliarscreamingargument …dream sequenceapologyeatingmontageambulancef wordtelephonerunninglielettercamerapunched in the faceslow motion sceneface slapmirrorcar accidentfoodcryingchasephotographcigarette smokingbloodfightkissviolence (See All) |
Sutter Keely lives in the now. It's a good place for him. A high school senior, charming and self-possessed, he's the life of the party, loves his job at a men's clothing store, and has no plans for the future. A budding alcoholic, he's never far from his supersized, whiskey-fortified thirst-master …cup. But after being dumped by his girlfriend, Sutter gets drunk and wakes up on a lawn with Aimee Finecky hovering over him. She's different: the "nice girl" who reads science fiction and doesn't have a boyfriend. While Aimee has dreams of a future, Sutter lives in the impressive delusion of a spectacular now, yet somehow, they're drawn together. (Read More)
Themes: | death of fatherdrunkennessdrinkingjealousymoneyfriendship |
Locations: | swimming poolbarhospital |
Characters: | single motherdancergirlteacherteenage boyboyfriend girlfriend relationshipfriendmother daughter relationshiphusband wife relationshipmother son relationshipteenager |
Story: | telephone calltutoringhomeworkgiving a toastdead fatherhandshakepridepromisesleepingreadingstorytellingfired from the jobprologueapologymontage …f wordtelephonesunglassestearsliedrinkslow motion scenecar accidentcryingdancingcigarette smokingbare chested malekiss (See All) |
A story following Archer, a man tortured by his roots. With a strong survival instinct, he has made himself a key player in the business of conflict diamonds. Political unrest is rampant in Sierra Leone as people fight tooth for tooth. Upon meeting Solomon, and the beautiful Maddy, Archer's life cha …nges forever as he is given a chance to make peace with the war around him. (Read More)
Themes: | griefdeath of fatherdrunkennessdrinkingmoney |
Mood: | rain |
Locations: | taxibicyclebusrestaurantbeachbar |
Characters: | babyphotographerdancerteachersingerdoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | video camerasubjective cameratelephone callbegins with textmobile phonecynicismwalkie talkievandalismarsonpursuitprologuemicrophoneracial slurvaneating …montagecaferunningsunglassestearsdrinkcameramirrorcar accidentfoodsongcryingchasesingingphotographdancingcigarette smokingbloodkissviolencefight (See All) |
Uxbal, single father of two children, finds his life in chaos as he is forced to deal with his life in order to escape the heat of crime in underground Barcelona, to break with the love for the divorced, manic depressive, abusive mother of his children and to regain spiritual insight in his life as …he is diagnosed with terminal cancer. (Read More)
Themes: | griefescapedrunkennessfeardrinkingmoney |
Mood: | rain |
Locations: | restaurantbeachbarhospital |
Characters: | babydancergirldoctormother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorsubjective cameratelephone calltouching someone's breastssense of smelldead fatherboxer shortssufferingmale underwearpursuitprologuemicrophonepainapologyeating …montagecookingtelephonecafebirthdayrunningtearsdrinkface slapmirrorfoodcryingchasesingingphotographdancingcigarette smokingbare chested maleone word titlekissbloodviolencefight (See All) |
At a foster-care facility for at-risk teenagers, Grace is a young counselor trying to do her best for kids who often have been pulled from the worst kinds of home situations. Even then, life is not easy as Grace and her colleagues care for kids who are too often profoundly scarred, even as they try …to have lives of their own. Now, things are coming to a head as Grace readies for marriage even as some her charges are coming to major turning points in their lives. To cope, Grace will have to make difficult perceptions and decisions that could put her career, and more importantly her charges, at dire risk. (Read More)
Themes: | angerfriendship |
Locations: | bicyclebusbathtubhospital |
Characters: | babydancersingerdoctorboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipmother son relationshipteenager |
Story: | looking at oneself in a mirrortelephone callwrist slittinggiving a toastvacuum cleanerhit in the faceboxer shortseyeglassespursuitbraceletreadingstorytellingprologueracial slurapology …suicide attempteatingcookingbirthdayrunningslow motion sceneface slapmirrorfoodcryingchasesingingdancingbare chested malekissbloodfight (See All) |
At the age of 38, Mark O'Brien, a man who uses an iron lung, decides he no longer wishes to be a virgin. With the help of his therapist and his priest, he contacts Cheryl Cohen-Greene, a professional sex surrogate and a typical soccer mom with a house, a mortgage and a husband. Inspired by a true st …ory, The Sessions, follows the fascinating relationship which evolves between Cheryl and Mark as she takes him on his journey to manhood. (Read More)
Themes: | feardrinkingjealousymoneyfriendship |
Locations: | bicyclebathtubrestaurantbeachhospital |
Characters: | girlteenage boysingerboyfriend girlfriend relationshipfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | reading a booksubjective cameratelephone calldoorbellpower outagepromisechokingeyeglassessleepingsadnessreadingfired from the jobpainapologyeating …ambulancef wordtelephonecaferunningsunglassestearsbookdrinkfoodsongsingingejaculationcigarette smokingbare chested malemasturbationkiss (See All) |
Coming back to accomplish the divorce procedure, Ahmad an Iranian man, arrives in Paris after four years to meet his ex-wife and her daughters from her previous marriage. He notices his ex is in a relationship with an Arab named Samir who also has a son and a wife in a coma. The relationship of the …older daughter and her mother is in deterioration because the daughter thinks her mother is the cause of Samir's wife comatose state. The affairs get more complicated when the older daughter discloses something heinous she has done. (Read More)
Themes: | dysfunctional familyfearfriendship |
Mood: | rain |
Locations: | restauranthospital |
Characters: | frenchsingle mothergirldoctorfriendmother daughter relationshiphusband wife relationship |
Story: | telephone callwrist bandageclotheslinedoorbelllooking out a windowhandshakecellphoneattempted suicidesufferingpromisepursuitliarprologueapologysuicide attempt …eatingcookingf wordtelephonerunningtearslieface slapfoodchasephotographcigarette smoking (See All) |
Violet Weston ('Meryl Streep' (qv)) has cancer and a propensity for pills and alcohol. She's a difficult woman to deal with and her husband has finally had enough. Violet's family gathers including middle daughter Ivy, youngest daughter Karen (with her new fiance), eldest daughter Barbara (with her …separated husband and teenage daughter), and her sister Mattie Fae (with her husband and son in tow). A family tragedy causes tensions to run high and secrets to come out. The Weston women will be forced to examine themselves and their lives whether they want to or not. Welcome to Osage County, Oklahoma in the sweltering heat of August. (Read More)
Themes: | humiliationdysfunctional familydeath of fatherangerfeardrinkingmoney |
Locations: | bus |
Characters: | uncle niece relationshipsingerdoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | apple pielooking at oneself in a mirrorsubjective cameratelephone callmissing fathersense of smellcellphonecynicismsufferingeyeglassesstorytellingliarprologuepainapology …f wordtelephonesunglassestearsliebookdrinkface slapmirrorfoodsongcryingsingingphotographcigarette smokingkissfight (See All) |
England's Prince Albert must ascend the throne as 'King George VI' (qv), but he has a speech impediment. Knowing that the country needs her husband to be able to communicate effectively, Elizabeth hires Lionel Logue, an Australian actor and speech therapist, to help him overcome his stammer. An extr …aordinary friendship develops between the two men, as Logue uses unconventional means to teach the monarch how to speak with confidence. (Read More)
Themes: | death of fatherfeardrinkingmoneychristmasfriendship |
Mood: | rain |
Characters: | photographersingerdoctorfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | subjective cameratelephone callkiss on the cheekstutteringgiving a toastwhistlinglooking out a windowhandshakecigarette lighterheadphonespromisechokingteaeyeglassesreading …storytellingfired from the jobmicrophoneapologyeatingmontagef wordtelephonetearsliebookdrinkcamerafoodsongcryingsingingdancingcigarette smokingkiss (See All) |
Finding himself in considerable debt, Chris, a Texan drug dealer, decides the only solution is to murder his mother to collect the insurance money. Getting together with his father, the ex-husband of Chris' mother, they decide to hire Joe Cooper (a contract killer) who also happens to be a police de …tective. The plan is that the money will go to Chris' sister Dottie. However due to the size of the contract fee, Chris agrees that Joe can take Dottie as a retainer until the insurance comes through. (Read More)
Themes: | dysfunctional familydrunkennessdrinkingmoney |
Mood: | rain |
Locations: | trainrestaurantbar |
Characters: | babyboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | running mascaralooking at oneself in a mirrortelephone callblack leather jacketincest subtextbaseball caphandshakecellphonecigarette lighterpromisearsonpursuitdebtstorytellingapology …eatingf wordtelephonecafebirthdaysunglassestearsliedrinkpunched in the faceface slapmirrorfoodcryingchasephotographcigarette smokingbare chested maleviolenceblood (See All) |
Soon after moving in, Beth, a brainy, beautiful writer damaged from a past relationship encounters Adam, the handsome, but odd, fellow in the downstairs apartment whose awkwardness is perplexing. Beth and Adam's ultimate connection leads to a tricky relationship that exemplifies something universal: … truly reaching another person means bravely stretching into uncomfortable territory and the resulting shake-up can be liberating. (Read More)
Themes: | death of fatherfeardrinkingjealousy |
Locations: | trainrestaurant |
Characters: | lawyerbabyteacherboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshiphusband wife relationship |
Story: | looking at oneself in a mirrorsubjective cameratelephone callgrocerieslooking for a jobwashing machineawkwardnesslaundryclosetrefrigeratorboxer shortspromiseteareadingfired from the job …argumentvanapologyeatingneighborcafetearsliebookdrinkmirrorfoodcryingphotographone word titlefightkiss (See All) |
Follow a week in the life of a young folk singer as he navigates the Greenwich Village folk scene of 1961. Guitar in tow, huddled against the unforgiving New York winter, he is struggling to make it as a musician against seemingly insurmountable obstacles -- some of them of his own making.
Themes: | drinkingmoneyfriendship |
Mood: | rain |
Locations: | busrestaurantbar |
Characters: | singerdoctorfriendhusband wife relationship |
Story: | title appears in writingtelephone calllooking out a windowloserhit in the facekickingboxer shortssleepingpursuitreadingstorytellingliarmicrophoneapologyeating …cookingtelephonecafesunglassesliedrinkpunched in the facefoodsongcryingchasesingingphotographcigarette smoking (See All) |
Forever alone in a crowd, failed comedian Arthur Fleck seeks connection as he walks the streets of Gotham City. Arthur wears two masks -- the one he paints for his day job as a clown, and the guise he projects in a futile attempt to feel like he's part of the world around him. Isolated, bullied and …disregarded by society, Fleck begins a slow descent into madness as he transforms into the criminal mastermind known as the Joker. (Read More)
Themes: | writinghumiliationdeath of fatherangerescapedrunkennessmoney |
Locations: | taxi driverbusbathtubhospital |
Characters: | neighbor neighbor relationshipsingle mothermother son relationship |
Story: | looking at oneself in a mirrortelephone callapplying makeupradio newsrefrigeratorblood on facelaughterkickingcynicismsufferingmale underwearvandalismrageloss of fatherdomestic violence …sadnessreadingfired from the jobliarmicrophoneargumentpainmontageambulancef wordtelephoneneighborrunninglieletterpunched in the faceslow motion scenemirrorcar accidentchasesingingdancingcigarette smokingbare chested maleone word titleviolencefightblood (See All) |
Curtis, a father and husband, is starting to experience bad dreams and hallucinations. Assuming mental illness, he seeks medical help and counseling. However, fearing the worst, he starts building an elaborate and expensive storm shelter in their backyard. This storm shelter threatens to tear apart …his family, threatens his sanity and his standing in the community, but he builds it to save his family's life. (Read More)
Themes: | death of fatherfeardrinkingmoneyfriendship |
Mood: | rain |
Locations: | beach |
Characters: | babydoctorfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | rearview mirrorsubjective cameratelephone calloxygen maskwashing machinesense of smelllooking out a windowboxer shortssupermarketsleepingbankreadingfired from the jobargumentpain …apologyeatingambulancecookingf wordtearsbookdrinkpunched in the faceface slapmirrorcar accidentfoodcryingphotographfight (See All) |
In 'Gegen die Wand' Cahit, a 40-something male from Mersin in Turkey has removed everything Turkish from his life. He has become an alcoholic drug addict and at the start of the movie wants to end it all. Sibel a 20-something female from Hamburg wishes to please her Turkish parents yet yearns for fr …eedom. She has had her nose broken by her brother for being seen holding hands with a boy and yet she can not break her mother's heart and run away. She too attempts suicide and she first approaches Cahit there at the Hospital. Sibel asks Cahit to marry her, as she believes this to be the way out of her parent's house. She promises Cahit that their relationship will be like roommates, not like a married couple. The film follows Sibel and Cahit as they get married, become closer and eventually fall in love. (Read More)
Themes: | freedomdeath of fatherdrunkennessdrinkingjealousymoneyfriendship |
Locations: | taxi drivertaxibusrestaurantbarhospital |
Characters: | dancergirlsingerdoctorboyfriend girlfriend relationshipfriendmother daughter relationshipfather daughter relationshiphusband wife relationship |
Story: | video cameratelephone callwrist slittingcdstonedvacuum cleanerhit in the facekickingshavingpursuitliarapologysuicide attemptmontagecooking …gay slurcaferunningtearslieletterdrinkface slapcar accidentfoodsongcryingchasesingingphotographdancingcigarette smokingfightkissviolenceblood (See All) |
Muriel finds life in Porpoise Spit, Australia dull and spends her days alone in her room listening to Abba music and dreaming of her wedding day. Slight problem, Muriel has never had a date. Then she steals some money to go on a tropical vacation, meets a wacky friend, changes her name to Mariel, an …d turns her world upside down. (Read More)
Themes: | bullyingdysfunctional familydrinkingmoneyfriendship |
Mood: | rain |
Locations: | taxiswimming poolrestaurantbeachbarhospital |
Characters: | dancerdoctorfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | telephone bookmicrowave oventelephone callwedding bouquetwedding cakebride and groomlip synchinglaundryembarrassmenttealiarracial slurambulancef wordtelephone …cafetearsliedrinkcryingsingingphotographdancingcigarette smokingfightkiss (See All) |
Jordan Belfort is a Long Island penny stockbroker who served 22 months in prison for defrauding investors in a massive 1990s securities scam that involved widespread corruption on Wall Street and in the corporate banking world, including shoe designer Steve Madden.
Themes: | drunkennessfeardrinkingmoneyfriendship |
Locations: | bathtubswimming poolrestaurantbar |
Characters: | frenchsingle motherlawyerdancerteacherfriendhusband wife relationship |
Story: | title appears in writingsurveillance cameralooking at oneself in a mirrorsubjective cameratelephone callimitating fellatiovagina slurmaniabride and groomsense of smelln wordname callinghit in the faceblood on facekicking …boxer shortspromisechokingskateboardteaeyeglassesdomestic violencedebtfired from the jobmicrophoneapologyeatingmontagegay slurf wordtelephonecaferunningsunglassesliedrinkpunched in the faceslow motion scenemirrorcar accidentfoodphotographdancingcigarette smokingbare chested malebloodmasturbationfightkiss (See All) |
Eva Khatchadourian is trying to piece together her life following the "incident". Once a successful travel writer, she is forced to take whatever job comes her way, which of late is as a clerk in a travel agency. She lives a solitary life as people who know about her situation openly shun her, even …to the point of violent actions toward her. She, in turn, fosters that solitary life because of the incident, the aftermath of which has turned her into a meek and scared woman. That incident involved her son Kevin Khatchadourian, who is now approaching his eighteenth birthday. Eva and Kevin have always had a troubled relationship, even when he was an infant. Whatever troubles he saw, Franklin, Eva's complacent husband, just attributed it to Kevin being a typical boy. The incident may be seen by both Kevin and Eva as his ultimate act in defiance against his mother. (Read More)
Themes: | dysfunctional familyangerdrinkingjealousychristmas |
Mood: | rain |
Locations: | trainrestauranthospital |
Characters: | babydancergirlteenage boysingerdoctorfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorsubjective cameratelephone callcopy machineoxygen maskcd15 year oldvacuum cleanerlooking out a windowname callingpromisevandalismsupermarketreadingliar …apologyeatingf wordtelephonebirthdayrunningsunglassestearsliebookdrinkface slapmirrorfoodsongcryingsingingphotographdancingbare chested malebloodviolencemasturbationkiss (See All) |
A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.
Themes: | hopedrinking |
Mood: | rain |
Locations: | taxi drivertaxibicyclebathtubhospital |
Characters: | photographerdancergirlteenage boydoctormother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | subjective cameratelephone callstocking capbeing watchedwatching someonewashing machinevacuum cleanereyeglassespursuitreadingeatingmontageneighborbirthdayrunning …tearsbookdrinkcamerafoodcryingchasephotographdancingcigarette smokingkissblood (See All) |
Hank, stranded on a deserted island and about to kill himself, notices a corpse washed up on the beach. He befriends it, naming it Manny, only to discover that his new friend can talk and has a myriad of supernatural abilities...which may help him get home.
Themes: | drunkennessfearjealousyfriendship |
Mood: | rain |
Locations: | busbeach |
Characters: | singerboyfriend girlfriend relationshipfriendmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking in a windowleg woundname callinglaughterembarrassmentsleepingpursuitprologuemicrophoneapologysuicide attempteatingmontageambulancef word …birthdaysunglassesbookslow motion sceneface slapfoodsongchasesingingphotographmasturbationfight (See All) |
Nader ('Payman Maadi' (qv)) and Simin ('Leila Hatami' (qv)) argue about living abroad. Simin prefers to live abroad to provide better opportunities for their only daughter, Termeh. However, Nader refuses to go because he thinks he must stay in Iran and take care of his father (Ali-Asghar Shahbazi), …who suffers from Alzheimers. However, Simin is determined to get a divorce and leave the country with her daughter. (Read More)
Themes: | fearmoney |
Locations: | bushospital |
Characters: | girlteacherdoctormother daughter relationshipfather daughter relationshiphusband wife relationship |
Story: | subjective cameratelephone callcopy machineoxygen maskdoorbellhomeworkcdlooking out a windowmobile phonepromiselawteaeyeglassessleepingdomestic violence …bankdebtfired from the jobliarprologuepainapologytelephonerunningsunglassestearsliecar accidentcryingphotographbare chested malefight (See All) |
In 1937 China, during the second Sino-Japanese war, a mortician, John ('Christian Bale' (qv)) arrives at a Catholic church in Nanjing to prepare a priest for burial. Upon arrival he finds himself the lone adult among a group of convent girl students and prostitutes from a nearby brothel. When he fin …ds himself in the unwanted position of protector of both groups from the horrors of the invading Japanese army, he discovers the meaning of sacrifice and honor. (Read More)
Themes: | humiliationdeath of fatherescapedrunkennessfeardrinkingmoneychristmas |
Mood: | rain |
Locations: | bicycle |
Characters: | girlsingerfather daughter relationship |
Story: | hiding in a closetlooking at oneself in a mirrorsubjective camerabeing watchedwatching someonebegins with textwhistlinglooking out a windowhead woundcigarette lightersufferingpromiseteashavingeyeglasses …pursuitpainrunningtearsliedrinkslow motion sceneface slapmirrorfoodsongcryingchasesingingphotographcigarette smokingkissblood (See All) |
Libby Day is a lifeless woman who survived the massacre of her family in their farmhouse in the countryside of Kansas when she was eight. She's been living on donations and lectures ever since. Thirty years ago, the police believed that a satanic cult was responsible for the murder of her mother and … two sisters, and her brother Ben was convicted with her testimony in court. Today, however, an acquaintance, Lyle Wirth, invites Libby to visit "The Kill Club", where amateurs investigate famous crimes, and she finds that they believe Ben is innocent. Libby needs money and, in return, accepts to revisit the slaughter of her family and comes up to the painful revelations and the ultimate truth. (Read More)
Themes: | writingangerescapedrunkennessfeardrinkingmoney |
Locations: | taxibicyclerestaurantbar |
Characters: | lawyerphotographerdancergirlboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | looking at oneself in a mirrorsubjective cameratelephone calllistening to music on a radiopetty theftstocking capdoorbellwelfarebaseball capcoughinglaundrycellphonesadnesspursuitdebt …prologueapologyeatingcookingf wordtelephoneliebookletterdrinkcameraface slapmirrorfoodchasephotographdancingcigarette smokingbare chested malebloodkissviolence (See All) |