Please wait - finding best movies...
It's the Christmas season. Wealthy Chicago ad executive Drew Latham has long avoided the family traditions of Christmas, but has dreaded being alone on the actual day. So when his tropical Christmas vacation with girlfriend Missy Vangilder falls through with Missy breaking up with him in the process β¦, Drew, in going through some self-therapy, decides what he really needs is to relive the memorable Christmases from his childhood, which includes spending time with his parents and younger brother. As that is not possible, he decides to rent a family, namely ones he's never met before, the Valcos - husband and wife Tom and Christine and their teenaged son Brian - who now live in Drew's childhood home in suburban Chicago. Tom initially wants nothing to do with Drew until an exorbitant sum of money is involved, all written in a contract which expires at the end of Christmas day. What Drew is initially unaware of, or what he chooses to remain ignorant about, is that the Valcos are going through their own family problems, which are only exacerbated by Drew's presence. For the Valcos, the questions become whether they can endure Drew's stay until the end of Christmas day, and if they can if the money will solve their family problems. In the process, Drew may come to an admission to himself of what he wants in life and perhaps how best to achieve it. The achieving it may be difficult if he doesn't fully know that life, and as external forces come into play to complicate matters. (Read More)
Subgenre: | black comedy |
Themes: | lonelinessangermemorychristmas |
Locations: | chicago illinoisairporttaxihelicoptertrain |
Characters: | psychiatristphotographeractorpolice officerbrother sister relationshipafrican americanfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | stage playairport securitychristmas presentchristmas treereference to sonny bonosliding down a banisterroasted chestnutsunwanted houseguestsalvation army bandnew automobilex ray machinesnow shovelwindow displaymall santatoboggan β¦skating rinkfestivegingerbread manamateur theaterinternet pornographydelidecorationchequemarshmallowchildhood homepretendingadvertising executivereference to charles dickenssnowball fightmetal detectorillinoissuicidalcartoon on tvunhappy marriagecontracthorse and carriagedeceithit on the headnostalgiagrandfatherbreakupremote controlphoto shootmechanicaudienceassaultsanta clausfireplacestagegiftbraceletknocked outsuburbcostumedinercamerawatching tvcomputersingingdancingbased on novel (See All) |
It is Christmas time and the McCallister family is preparing for a vacation in Paris, France. But the youngest in the family named Kevin got into a scuffle with his older brother Buzz and was sent to his room which is on the third floor of his house. Then, the next morning, while the rest of the fam β¦ily was in a rush to make it to the airport on time, they completely forgot about Kevin who now has the house all to himself. Being home alone was fun for Kevin, having a pizza all to himself, jumping on his parents' bed, and making a mess. Then, Kevin discovers about two burglars, Harry and Marv, about to rob his house on Christmas Eve. Kevin acts quickly by wiring his own house with makeshift booby traps to stop the burglars and to bring them to justice. (Read More)
Themes: | lonelinessangerchristmas |
Locations: | chicago illinoisairporttrain |
Characters: | brother sister relationshiphusband wife relationshipmother son relationship |
Story: | christmas treeillinoiscartoon on tvremote controlsuburbcostumewatching tvsingingdancing |
After a chance encounter at a theater, two men, Benigno and Marco, meet at a private clinic where Benigno works. Lydia, Marco's girlfriend and a bullfighter by profession, has been gored and is in a coma. It so happens that Benigno is looking after another woman in a coma, Alicia, a young ballet stu β¦dent. The lives of the four characters will flow in all directions, past, present and future, dragging all of them towards an unsuspected destiny. (Read More)
Themes: | lonelinessmemory |
Locations: | taxi |
Characters: | psychiatristphotographerfather daughter relationship |
Story: | stage playaudiencestagecostumecamerawatching tvcomputersinging |
During childhood, Fred Claus suffered his younger brother Nick's saintliness. Jump ahead: Fred is a fast-talking, genial but self-centered guy in Chicago looking for $50,000 to open an off-track-betting shop. When one scam goes awry, he calls Nick at the North Pole for a loan: Nick will give him the β¦ money only if Fred comes up to help a few days with the Christmas rush. After his girlfriend dumps him, Fred heads north. Santa's facing an audit from an efficiency expert, and it's not pleasant. Fred's job is to review charts and determine who's naughty and who's nice. Is there any fraternal feeling left, can either learn from the other, and what about Santa getting fired? (Read More)
Subgenre: | black comedy |
Themes: | christmas |
Locations: | chicago illinois |
Characters: | husband wife relationshipmother son relationshipfather son relationship |
Story: | christmas presentchristmas treesnowball fightcartoon on tvsanta clausfireplacedancing |
Tom Popper grew up having very little interaction with his father who was off exploring the world. When he grows up he spends most of time on his work and ignores his children. One day his father sends him an unusual gift: a penguin. Popper can't help but wonder why his father would send him a pengu β¦in. He tries to get rid of it, but accidentally orders five more. When his children and ex-wife show up to celebrate his son's birthday, the kids are taken with the penguins. And Popper finally gets to connect with his kids while his work suffers. (Read More)
Themes: | memorychristmas |
Locations: | taxihelicopter |
Characters: | police officerfather daughter relationshipfather son relationship |
Story: | christmas treeskating rinkremote controlgiftwatching tvcomputersingingdancingbased on novel |
Andrew Largeman is a semi-successful television actor who plays a intellectually disabled quarterback. His somewhat controlling and psychiatrist father has led Andrew ("Large") to believe that his mother's wheelchair bound life was his fault. Andrew decides to lay off the drugs that his father and h β¦is doctor made him believe that he needed, and began to see life for what it is. He began to feel the pain he had longed for, and began to have a genuine relationship with a girl who had some problems of her own. (Read More)
Themes: | loneliness |
Locations: | airport |
Characters: | psychiatristactorpolice officerbrother sister relationshipafrican americanmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | christmas treefireplacegiftsuburbwatching tvsingingdancing |
Four high-tech industrial spies, Beaupre, Alice, Jernigan and Unger, steal a top-secret microchip, and, to fool customs, hide it in a remote-control toy car. Through a baggage mix-up at the airport, grumpy old Mrs.Hess gets the toy and gives it to her neighbor, 8-year-old Alex. Spies want to get the β¦ toy back before their clients get angry and decide to burglarize every house at Alex's street to find the chip. But Alex is prepared for their visit... (Read More)
Themes: | christmas |
Locations: | chicago illinoisairport |
Characters: | brother sister relationshipmother son relationship |
Story: | illinoisremote controlfireplacesuburbwatching tvcomputer |
Kate and her actor brother live in N.Y. in the 21st Century. Her ex-boyfriend, Stuart, lives above her apartment. Stuart finds a space near the Brooklyn Bridge where there is a gap in time. He goes back to the 19th Century and takes pictures of the place. Leopold -- a man living in the 1870s -- is p β¦uzzled by Stuart's tiny camera, follows him back through the gap, and they both ended up in the present day. Leopold is clueless about his new surroundings. He gets help and insight from Charlie who thinks that Leopold is an actor who is always in character. Leopold is a highly intelligent man and tries his best to learn and even improve the modern conveniences that he encounters. (Read More)
Locations: | taxi |
Characters: | psychiatristphotographeractorbrother sister relationship |
Story: | advertising executiveremote controlcamerawatching tvcomputerdancing |
In Albuquerque, Sheryl Hoover brings her suicidal brother Frank to the breast of her dysfunctional and emotionally bankrupted family. Frank is homosexual, an expert in Proust. He tried to commit suicide when he was rejected by his boyfriend and his great competitor became renowned and recognized as β¦number one in the field of Proust. Sheryl's husband Richard is unsuccessfully trying to sell his self-help and self-improvement technique using nine steps to reach success, but he is actually a complete loser. Her son Dwayne has taken a vow of silence as a follower of Nietzsche and aims to be a jet pilot. Dwayne's grandfather Edwin was sent away from the institution for elders (Sunset Manor) and is addicted in heroin. When her seven-year-old daughter Olive has a chance to dispute the Little Miss Sunshine pageant in Redondo Beach, California, the whole family travels together in their old Volkswagen Type 2 (Kombi) in a funny journey of hope of winning the talent contest and to make a dream come true. (Read More)
Subgenre: | black comedy |
Characters: | brother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | suicidalgrandfatherremote controlaudiencesuburbdinerwatching tvcomputersingingdancing |
Meet Howard Langston, a salesman for a mattress company is constantly busy at his job, and he also constantly disappoints his son, after he misses his son's karate exposition, he tries hard to come up with a way to make it up to him, this is when his son tells Howard that he wants for Christmas is a β¦n action figure of his son's television hero, Turbo Man. Unfortunately for Howard, it is Christmas Eve, and every store is sold out of Turbo Man figures, now Howard must travel all over town and compete with everybody else including a mail man named Myron to find a Turbo Man action figure, and to make it to the Wintertainment parade which will feature Turbo Man. (Read More)
Themes: | christmas |
Characters: | police officerafrican americanhusband wife relationshipfather son relationship |
Story: | christmas presentchristmas treesanta clausfireplacegiftcostumedinerwatching tv |
In a castle high on top of a hill lives an inventor's greatest creation - Edward, a near-complete person. The creator died before he could finish Edward's hands; instead, he is left with metal scissors for hands. Since then, he has lived alone, until a kind lady called Peg discovers him and welcomes β¦ him into her home. At first, everyone welcomes him into the community, but soon things begin to take a change for the worse. (Read More)
Subgenre: | black comedy |
Themes: | lonelinesschristmas |
Characters: | psychiatristpolice officerbrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | christmas treesuburbdinerwatching tv |
When two people "connect" the bond between them can be so pure and simple as to stir hearts in heaven. When they connect in all the right places at all the wrong times, heaven weeps for broken hearts. To heal these broken hearts, heaven breaks time.
Locations: | chicago illinoistrain |
Characters: | african americanmother daughter relationshipfather daughter relationshipfather son relationshipmother son relationship |
Story: | skating rinkcartoon on tvgiftwatching tvcomputerdancing |
'Louisa May Alcott' (qv)'s autobiographical account of her life with her three sisters in Concord, Massachusetts in the 1860s. With their father fighting in the American Civil War, sisters Jo, Meg, Amy and Beth are at home with their mother, a very outspoken women for her time. The story tells of ho β¦w the sisters grow up, find love and find their place in the world. (Read More)
Themes: | christmas |
Characters: | mother daughter relationshipfather daughter relationshiphusband wife relationship |
Story: | christmas treereference to charles dickenshorse and carriagefireplacestagecostumesingingdancingbased on novel |
In Atlanta on business, straight-laced and overly analytical architect Peter Highman is flying home to Los Angeles and his wife Sarah for the imminent birth of their first child. However, traveling by plane no longer becomes an option when he and a fellow passenger, aspiring actor Ethan Tremblay, ar β¦e kicked off the plane, which was caused by Ethan's social inappropriateness, due to being generally unaware, exacerbated by Peter's temper at a situation against his sensibilities. Peter, who ends up without money or his suitcase, is forced to accept Ethan's offer of a shared car ride to Los Angeles, Ethan who is looking for his big acting break. For Peter, this partnership is one made in hell, but he feels he has no other choice. Peter obviously wants to take as direct and as quick a route as possible, while he is at Ethan's mercy as the person with the driver's license, car rental and money. They get into one misadventure after another on this trip, with the same issue at each misadventure being Ethan's ineptness as an adult combined with Peter's resulting temper. The questions become whether they will survive the trip together, and if so if Peter will make it home in time to witness the birth of his and Sarah's first child. (Read More)
Subgenre: | black comedy |
Themes: | lonelinessanger |
Locations: | airporttaxi |
Characters: | actorbrother sister relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | airport securitymetal detectorcartoon on tvknocked outdinerwatching tv |
Walter Goodfellow, the vicar for the small English country parish of Little Wallop, has allowed his marriage to Gloria go stale, and he is so detached from his family that he has not taken notice that his 17-year-old daughter Holly is going through a succession of relationships with unsuitable boyfr β¦iends, and his son Petey fears going to school owing to being bullied. Out of desperation for affection, Gloria begins to fall for the advances of Lance, an American golf pro who is giving her "private" lessons. The problems upsetting the family start to fade away after Grace Hawkins, the new housekeeper, arrives and starts tending to matters as an older, and rather darkly mysterious version of Mary Poppins. (Read More)
Subgenre: | black comedy |
Themes: | angermemory |
Locations: | taxitrain |
Characters: | police officerbrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | audiencefireplacestagewatching tvcomputer |
Lucy's life consists of constant loneliness that is until she saves Peter's life. Now she is a part of his family, and with a strong heart and fate on her side, others begin to realize what a terrific person she is, especially Jack, Peter's brother. An extraordinarily true-to-life sequence of events β¦ begin to take place as Lucy and Jack become closer and learn more about each other and themselves than one would ever expect from such coincidental, yet believable events. (Read More)
Themes: | lonelinesschristmas |
Locations: | chicago illinoistaxitrain |
Characters: | father daughter relationshipfather son relationshipmother son relationship |
Story: | christmas presentchristmas treepretendingillinoisfireplace |
Christmas is approaching and 9 year-old Ralphie wants only one thing: a Red Ryder Range 200 Shot BB gun. When he mentions it at the dinner table, his mother's immediate reaction is that he'll put his eye out. He then decides on a perfect theme for his teacher but her reaction is like his. He fantasi β¦zes about what it would be like to be Red Ryder and catch the bad guys. When the big day arrives he gets lots of present under the tree including a lovely gift from his aunt that his mother just adores. But what about the BB gun? (Read More)
Themes: | memorychristmas |
Characters: | mother son relationshipfather son relationship |
Story: | christmas presentchristmas treemall santanostalgiagiftcostumebased on novel |
Down-on-his-luck theatrical producer Max Bialystock is forced to romance rich old ladies to finance his efforts. When timid accountant Leo Bloom reviews Max's accounting books, the two hit upon a way to make a fortune by producing a sure-fire flop. The play which is to be their gold mine? "Springtim β¦e for Hitler." (Read More)
Characters: | actor |
Story: | stage playchequecontracthorse and carriagestagecostumesingingdancing |
Cathy is the perfect 50s housewife, living the perfect 50s life: healthy kids, successful husband, social prominence. Then one night she stumbles in on her husband Frank, kissing another man, and her tidy world starts spinning out of control. In her confusion and grief, she finds consolation in the β¦friendship of their African-American gardener, Raymond - a socially taboo relationship that leads to the further disintegration of life as she knew it. Despite Cathy and Frank's struggle to keep their marriage afloat, the reality of his homosexuality and her feelings for Raymond open a painful, if more honest, chapter in their lives. (Read More)
Themes: | christmas |
Locations: | train |
Characters: | psychiatristafrican americanhusband wife relationship |
Story: | christmas treeadvertising executiveunhappy marriageassaultsuburbdinerdancing |
Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr β¦overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)
Themes: | lonelinessmemorychristmas |
Characters: | psychiatristphotographerbrother sister relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | christmas presentchristmas treereference to charles dickensfireplacecamerawatching tvsingingdancingbased on novel |
Divorcee Scott Calvin is disgusted to learn that his ex and her husband have tried - and failed - to break it easy to their 6-year-old son Charlie that Santa isn't real. On Christmas Eve, Scott reads The Night Before Christmas... then receives an unexpected visitor on his roof. When he's startled by β¦ Scott's calling out and falls, the Santa impersonator disappears, leaving only an 8-reindeer sleigh and a suit with instructions to put it on if he's involved in an accident. Scott does, and is transported around the town dropping gifts through chimneys until he's taken to the North Pole and informed by a group who claim they're elves that he is now Santa. Charlie is proud of his dad's new job, though Scott's convinced it's a dream. Until his hair turns white, his beard refuses to stay shaved, he gains weight inexplicably, even for his sudden love of junk food... Now he's accepted it, there's just one problem: how to keep it secret from his disbelieving family? (Read More)
Locations: | chicago illinois |
Characters: | psychiatristpolice officerhusband wife relationshipmother son relationshipfather son relationship |
Story: | christmas treeadvertising executivesanta clausfireplacesuburb |
A married couple who have managed to remain blissfully happy into their autumn years, are surrounded over the course of the four seasons of one average year by friends, colleagues, and family who all seem to suffer some degree of unhappiness.
Themes: | lonelinessangermemorychristmas |
Locations: | taxitrain |
Characters: | father daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | nostalgiasuburbwatching tvcomputer |
Buddy was a baby in an orphanage who stowed away in Santa's sack and ended up at the North Pole. Later, as an adult human who happened to be raised by elves, Santa allows him to go to New York City to find his birth father, Walter Hobbs. Hobbs, on Santa's naughty list for being a heartless jerk, had β¦ no idea that Buddy was even born. Buddy, meanwhile, experiences the delights of New York City (and human culture) as only an elf can. When Walter's relationship with Buddy interferes with his job, he is forced to reevaluate his priorities. (Read More)
Themes: | christmas |
Locations: | taxi |
Characters: | husband wife relationshipfather son relationshipmother son relationship |
Story: | christmas treewindow displaysnowball fightsanta clausfireplacewatching tvsingingdancing |
Reuben Feffer thinks he's found the love of his life but on his honeymoon he discovers her cheating on him with a scuba instructor. Reuben travels back home to get his life on track. On a night out with best pal, Sandy Lyle, Reuben discovers an old school friend, Polly Prince. Reuben feels a connect β¦ion straight away, and tries constantly to get her to like him. But it's not going to be easy for Reuben, especially when he spends his days calculating risks, and when someone unexpected turns up. (Read More)
Themes: | anger |
Characters: | photographeractorhusband wife relationshipfather son relationshipmother son relationship |
Story: | stage playaudiencestagecameracomputersingingdancing |
American tourist Jesse and French student Celine meet by chance on the train from Budapest to Vienna. Sensing that they are developing a connection, Jesse asks Celine to spend the day with him in Vienna, and she agrees. So they pass the time before his scheduled flight the next morning together. How β¦ do two perfect strangers connect so intimately over the course of a single day? What is that special thing that bonds two people so strongly? As their bond turns to love, what will happen to them the next morning when Jesse flies away? (Read More)
Themes: | memory |
Locations: | train |
Characters: | psychiatristphotographeractorbrother sister relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | horse and carriagecamerasingingdancing |
Frank Cross runs a US TV station which is planning a live adaptation of Dickens' Christmas Carol. Frank's childhood wasn't a particularly pleasant one, and so he doesn't really appreciate the Christmas spirit. With the help of the ghosts of Christmas past, present and future, Frank realises he must β¦change. (Read More)
Subgenre: | black comedy |
Themes: | lonelinesschristmas |
Story: | reference to charles dickenscartoon on tvsanta clausgiftsingingdancingbased on novel |
A once handsome playboy, Cesar finds himself in a mental facility and he can't remember why. All he can remember is meeting the love of his life for one day, and then getting into a car accident which left his face horribly disfigured. But the pain of becoming physically undesirable may help him to β¦find the truth. (Read More)
Themes: | angermemory |
Characters: | psychiatristmother son relationshipfather son relationship |
Story: | cartoon on tvcontractremote controlwatching tvcomputerdancing |
Having given permission to male nurse Greg Focker to marry his daughter, ex-CIA man Jack Byrnes and his wife travel to Miami to Greg's parents, who this time around are Mr. and Mrs. Focker, who are as different from them as can be. As asked in the first movie, what sort of people name their son Gayl β¦ord M. Focker? (Read More)
Locations: | chicago illinoisairport |
Characters: | police officerfather daughter relationshipmother daughter relationshipmother son relationshipfather son relationship |
Story: | grandfathermechanicwatching tvdancing |
Aspiring actress serves lattes to movie stars in between auditions and jazz musician Sebastian scrapes by playing cocktail-party gigs in dingy bars. But as success mounts, they are faced with decisions that fray the fragile fabric of their love affair, and the dreams they worked so hard to maintain β¦in each other threaten to rip them apart. (Read More)
Themes: | memorychristmas |
Characters: | photographerbrother sister relationshipafrican americanmother daughter relationship |
Story: | christmas treecontractphoto shootaudiencecameracomputersingingdancing |
At the age of 21, Tim Lake (Domhnall Gleeson) discovers he can travel in time... The night after another unsatisfactory New Year party, Tim's father (Bill Nighy) tells his son that the men in his family have always had the ability to travel through time. Tim can't change history, but he can change w β¦hat happens and has happened in his own life-so he decides to make his world a better place...by getting a girlfriend. Sadly, that turns out not to be as easy as you might think. Moving from the Cornwall coast to London to train as a lawyer, Tim finally meets the beautiful but insecure Mary (Rachel McAdams). They fall in love, then an unfortunate time-travel incident means he's never met her at all. So they meet for the first time again-and again-but finally, after a lot of cunning time-traveling, he wins her heart. Tim then uses his power to create the perfect romantic proposal, to save his wedding from the worst best-man speeches, to save his best friend from professional disaster and to get his pregnant wife to the hospital in time for the birth of their daughter, despite a nasty traffic jam outside Abbey Road. But as his unusual life progresses, Tim finds out that his unique gift can't save him from the sorrows and ups and downs that affect all families, everywhere. There are great limits to what time travel can achieve, and it can be dangerous too. (Read More)
Subgenre: | black comedy |
Themes: | christmas |
Locations: | train |
Characters: | actorbrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | stage playreference to charles dickensgiftdancing |
Kevin McCallister is back. But this time he's in New York City with enough cash and credit cards to turn the Big Apple into his very own playground. But Kevin won't be alone for long. The notorious Wet Bandits, Harry and Marv, still smarting from their last encounter with Kevin, are bound for New Yo β¦rk too, plotting a huge holiday heist! Kevin's ready to welcome them with more battery of booby traps the bumbling bandits will never forget! (Read More)
Themes: | memorychristmas |
Locations: | airporttaxi |
Characters: | police officerbrother sister relationshiphusband wife relationshipmother son relationship |
Story: | christmas treecartoon on tvremote controlgift |
Smart-but-ineffectual journalist Dan "We use euphemisms!" cannot decide between his girlfriend, loving-but-clingy waitress Alice, or his lover cold-but-intellectual photographer Anna; herself indecisive between Dan and honest-but-thuggish "You're bloody gorgeous!" doctor Larry. The film puts the fou β¦r leading characters in a box and strips them apart. (Read More)
Themes: | anger |
Locations: | airporttaxi |
Characters: | photographerhusband wife relationship |
Story: | breakupphoto shootcameracomputerdancing |
Against the backdrop of aged has-been rock star Billy Mack's Christmas themed comeback cover of "Love Is All Around" which he knows is crap and makes no bones about it much to his manager Joe's chagrin as he promotes the record, several interrelated stories about romantic love and the obstacles to h β¦appiness through love for Londoners are presented in the five weeks preceding Christmas. Daniel's wife has just passed away, leaving him to take care of his adolescent stepson Sam by himself. Daniel is uncertain how to deal with Sam and his problems without his wife present, especially in light of a potential budding romance within their household. Juliet and Peter have just gotten married. They believe that Peter's best friend and best man Mark hates Juliet but won't say so to his or her face. Others looking at the situation from the outside believe Mark is jealous of Juliet as he is in love with Peter himself. Jamie, a writer, is taking a writing retreat by himself in rural France following catching his latest girlfriend in an indiscretion. Jamie ends up spending much time in France with Aurelia, the Portuguese woman hired as the housekeeper. The question becomes not only if they can communicate their day-to-day needs with each other as she speaks no English, he speaks no Portuguese, and neither speaks French well, but communicate what seems to be their increasing mutual attraction to each other. Sarah has been in love with her co-worker Karl for the two years they have worked toβ¦ (Read More)
Themes: | lonelinesschristmas |
Locations: | airport |
Characters: | actorbrother sister relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | airport securitychristmas treemetal detectorbreakupcostumecomputerdancing |
All that Neal Page wants to do is to get home for Thanksgiving. His flight has been cancelled due to bad weather, so he decides on other means of transport. As well as bad luck, Neal is blessed with the presence of Del Griffith, shower curtain ring salesman and all-around blabbermouth who is never s β¦hort of advice, conversation, bad jokes, or company. And when he decides that he is going the same direction as Neal.... (Read More)
Themes: | loneliness |
Locations: | chicago illinoisairporttaxitrain |
Characters: | husband wife relationship |
Story: | illinoisassaultsinging |
John and Jane Smith are a normal married couple, living a normal life in a normal suburb, working normal jobs...well, if you can call secretly being assassins "normal". But neither Jane nor John knows about their spouse's secret, until they are surprised to find each other as targets! But on their q β¦uest to kill each other, they learn a lot more about each other than they ever did in five (or six) years of marriage. (Read More)
Subgenre: | black comedy |
Themes: | memorychristmas |
Locations: | taxihelicopter |
Characters: | actorfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | remote controlsuburbwatching tvcomputersingingdancing |
Three grown prodigies, all with a unique genius of some kind, and their mother are staying at the family household. Their father, Royal had left them long ago, and comes back to make things right with his family.
Locations: | taxi |
Characters: | police officerbrother sister relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | stage playchequecamerawatching tv |
After causing a loss of almost one billion dollars in his company, the shoe designer Drew Baylor decides to commit suicide. However, in the exact moment of his act of despair, he receives a phone call from his sister telling him that his beloved father had just died in Elizabethtown, and he should b β¦ring him back since his mother had problem with the relatives of his father. He travels in an empty red eye flight and meets the attendant Claire Colburn, who changes his view and perspective of life. (Read More)
Subgenre: | black comedy |
Themes: | christmas |
Locations: | airporthelicopter |
Characters: | brother sister relationshipafrican americanmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | remote controlwatching tvcomputersingingdancing |
When Henry DeTamble meets Clare Abshire in a Chicago library they both understand that he is a time traveler, but she knows much more about him as he has not yet been to the times and places where they have already met. He falls in love with her, as she has already with him, but his continuing unavo β¦idable absences while time traveling - and then returning with increasing knowledge of their future - makes things ever more difficult for Clare. (Read More)
Themes: | christmas |
Locations: | chicago illinois |
Characters: | police officerfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | christmas treefireplacedinerbased on novel |
Bad Blake is a broken-down, hard-living country music singer who's had way too many marriages, far too many years on the road and one too many drinks way too many times. And yet, Bad can't help but reach for salvation with the help of Jean, a journalist who discovers the real man behind the musician β¦. (Read More)
Themes: | lonelinessmemory |
Locations: | taxitrain |
Characters: | photographermother son relationship |
Story: | nostalgiacamerawatching tvsingingdancingbased on novel |
Echoes of "Madame Bovary" in the American suburbs. Sarah's in a loveless marriage to an advertising executive, long days with her young daughter at the park and the pool, wanting more. Brad is an immature househusband, married to a flinty documentary filmmaker. Ronnie is just out of prison - two yea β¦rs for indecent exposure to a minor - living with his elderly mother, May; Larry is a retired cop, fixated on driving Ronnie away. Sarah and Brad connect, a respite of adult companionship at the pool. Ronnie and Larry have their demons. Brad should be studying for the bar; Larry misses his job; Ronnie's mom thinks he needs a girlfriend. Sarah longs to refuse to be trapped in an unhappy life. Where can these tangled paths lead? (Read More)
Subgenre: | black comedy |
Locations: | taxitrain |
Characters: | psychiatristbrother sister relationshipmother daughter relationshiphusband wife relationshipmother son relationship |
Story: | internet pornographyadvertising executiveunhappy marriagesuburbwatching tvcomputerbased on novel |
Ben Sobol, Psychiatrist, has a few problems: His son spies on his patients when they open up their heart, his parents don't want to attend his upcoming wedding and his patients' problems don't challenge him at all. Paul Vitti, Godfather, has a few problems as well: Sudden anxiety attacks in public, β¦a certain disability to kill people and his best part ceasing service when needed. One day, Ben unfortunately crashes into one of Vitti's cars. The exchange of Ben's business card is followed by a business visit of Don Paul Vitti himself, who wants to be free of inner conflict within two weeks, before all the Mafia Dons meet. Now, Ben Sobol feels somewhat challenged, as his wedding is soon, his only patient keeps him busy by regarding Ben's duty as a 24 hour standby and the feds keep forcing him to spy on Paul Vitti. And how do you treat a patient who usually solves problems with a gun? (Read More)
Themes: | anger |
Locations: | helicopter |
Characters: | psychiatristpolice officermother son relationshipfather son relationship |
Story: | contractaudiencedinerwatching tvcomputersingingdancing |
The resolutely single Don Johnston has just been dumped by his latest lover, Sherry. Don resigns himself to being alone yet again and left to his own devices. Instead, he is compelled to reflect on his past when he receives by mail a mysterious pink letter. It is from an anonymous former lover and i β¦nforms him that he has a 19-year-old son who may now be looking for his father. Don is urged to investigate this "mystery" by his closest friend and neighbor, Winston, an amateur sleuth and family man. Hesitant to travel at all, Don nonetheless embarks on a cross-country trek in search of clues from four former flames. Unannounced visits to each of these unique women hold new surprises for Don as he haphazardly confronts both his past and, consequently, his present. (Read More)
Themes: | lonelinessmemory |
Locations: | airport |
Characters: | psychiatristphotographerbrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | knocked outsuburbcomputer |
When his partner is killed by the mysterious and possibly nonexistent Jaguar Shark, Steve Zissou and his Team Zissou crew set off for an expedition to hunt down the creature. Along with his estranged wife, a beautiful journalist and a co-pilot who could possibly be Zissou's son, the crew set off for β¦ one wild expedition. (Read More)
Subgenre: | black comedy |
Locations: | helicopter |
Characters: | father son relationship |
Story: | unhappy marriageaudiencestagegiftcamerawatching tvcomputersinging |
The manager of the negative assets sector of Life magazine, Walter Mitty, has been working for sixteen years for the magazine and has a tedious life, not going anywhere but from his home to his job and vice-versa. He is an escapist, daydreaming into a world of fantasy many times a day. Walter has a β¦crush on the recently hired Cheryl Melhoff but he is too shy to invite her on a date and he is trying to contact her via online dating. The magazine is preparing to release its last printed edition and the loathsome manager of transition Ted Hendricks is preparing an inevitable downsizing over the next few days. Walter has been the liaison between the magazine and the mysterious independent photographer Sean O'Connell who has sent to him a package of negatives and a wallet as a gift for his work. Sean also suggests to the senior management the use of negative 25 for the cover of the last edition. However, Walter cannot find the negative that is missing. Walter has no means to contact Sean and finds a clue that he might be in Greenland. He decides to travel to Greenland to track Sean down in the beginning of an unbelievable adventure. (Read More)
Locations: | airporttaxihelicoptertrain |
Characters: | photographerbrother sister relationshipmother daughter relationshipmother son relationship |
Story: | airport securitymetal detectorgift |
Two sisters, plus a dead mother, a remarried father, and a hostile step-mother. The sisters, each in her way, have perfected the art of losing. The elder, Rose, is an attorney, responsible, lonely, with a closet full of shoes. The younger is Maggie, beautiful, selfish, and irresponsible. Her drunken β¦ behavior gets her tossed by her step-mother from her dad's house; worse behavior gets her tossed from Rose's apartment. Then, while searching in her father's desk for money to filch, Maggie finds an address; the past and the future open up to her and, with any luck, may open to her sister as well. (Read More)
Themes: | loneliness |
Locations: | chicago illinoistrain |
Characters: | father daughter relationshipmother daughter relationshiphusband wife relationship |
Story: | deceitremote controldinerwatching tvcomputerdancingbased on novel |
Toula Portokalos is 30, Greek, and works in her family's restaurant, Dancing Zorba's, in Chicago. All her father Gus wants is for her to get married to a nice Greek boy. But Toula is looking for more in life. Her mother convinces Gus to let her take some computer classes at college (making him think β¦ it's his idea). With those classes under her belt, she then takes over her aunt's travel agency (again making her father think it's his idea). She meets Ian Miller, a high school English teacher, WASP, and dreamboat she had made a fool of herself over at the restaurant; they date secretly for a while before her family finds out. Her father is livid over her dating a non-Greek. He has to learn to accept Ian; Ian has to learn to accept Toula's huge family, and Toula has to learn to accept herself. (Read More)
Locations: | chicago illinois |
Characters: | brother sister relationshipmother daughter relationshipfather daughter relationshipmother son relationshipfather son relationship |
Story: | suburbcameracomputerdancing |
Jon and Wendy Savage are two siblings who have spent their adult years trying to recover from the abuse of their abusive father, Lenny Savage. Suddenly, a call comes in that his girlfriend has died, he cannot care for himself with his dementia and her family is dumping him on his children. Despite t β¦he fact Jon and Wendy have not spoken to Lenny for twenty years and he is even more loathsome than ever, the Savage siblings feel obliged to take care of him. Now together, brother and sister must come to terms with the new and painful responsibilities with their father now affecting their lives even as they struggle with their own personal demons Lenny helped create. (Read More)
Themes: | memorychristmas |
Locations: | airporttaxitrain |
Characters: | photographerbrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationship |
Story: | christmas treewatching tvcomputersinging |
Despondent over his breakup with Desiree, Zia slashes his wrists and goes to an afterlife peopled by suicides, a high-desert landscape dotted by old tires, burned-out cars, and abandoned sofas. He gets a job in a pizza joint. By chance, Zia learns that Desiree offed herself a few months after he did β¦, and she's looking for him. He sets off with Eugene (an electrocuted Russian rocker) to find her, and they pick up a hitchhiker, Mikal, who's looking for the People in Charge, believing she's there by mistake. They're soon at the camp of Kneller, where casual miracles proliferate. They hear rumors of a miraculous king. Can Zia find Desiree? Then what? Where there's death there's hope. (Read More)
Subgenre: | black comedy |
Themes: | memory |
Locations: | taxitrain |
Characters: | mother son relationshipfather son relationship |
Story: | breakupdinerwatching tvcomputersingingdancing |
Determined to solve the coincidence of seeing the same conspicuous stranger three times in a day, Albert hires a pair of existentialist detectives, who insist on spying on his everyday life while sharing their views on life and the nature of the universe.
Subgenre: | black comedy |
Themes: | anger |
Characters: | mother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | breakupsuburbcamerawatching tvdancing |
It has been nine years since we last met Jesse and Celine, the French-American couple who once met on a train in Vienna. They now live in Paris with twin daughters, but have spent a summer in Greece on the invitation of an author colleague of Jesse's. When the vacation is over and Jesse must send hi β¦s teenage son off to the States, he begins to question his life decisions, and his relationship with Celine is at risk. (Read More)
Themes: | angermemory |
Locations: | chicago illinoisairporttrain |
Characters: | photographerfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | cameracomputer |