Best popular movies like The Beaver:

Do you need specific genre & keyword selection to find films similar to The Beaver?
<< FIND THEM HERE! >>

The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Beaver (2011)

Walter Black ('Mel Gibson') is depressed and sleeps most of the day. It's driving his family crazy, and his wife Meredith ('Jodie Foster' (qv)) kicks him out. Walter starts carrying a beaver puppet and tries to commit suicide (unsuccessfully). He uses the puppet to talk to himself, trying to bolster β€¦ his spirits, and is trying to rebuild his life. Through the beaver, the family begins to learn about Walter's history and problems, and as he continues rebuilding, the beaver shows us all a way to cope. (Read More)

Subgenre:
independent film
Themes:
mental illnessdysfunctional familydepression
Mood:
high school
Characters:
self acceptancehusband wife relationshipfather son relationshipfamily relationships
Story:
graduation speechdepressive disorderfight with selffatherhoodroller coasterdysfunctional marriagespeechpuppetanimal in titletitle directed by femaletwo word title

The Good Girl (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Good Girl (2002)

The plot revolves around a young married woman whose mundane life takes a turn for the worse when she strikes up a passionate and illicit affair with an oddball discount-store stock boy who thinks he's Holden Caulfield.

Subgenre:
independent filmblack comedy
Themes:
mental illnessdepressiondeathlovefriendshipsuicidemarriageinfidelitydrugsjealousyadulterypregnancydrinkingdrunkennessdeception β€¦extramarital affairtheftblackmaildrug useguiltunfaithfulnessillnesssuicide of friend (See All)
Mood:
rain
Locations:
hospitalchurchcarsmall townbathtubmoteltexassex in a motelsex in a store
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfriendboyfriend girlfriend relationshipbabywriterthiefchristianchristianitysecurity guardbibleemployer employee relationship β€¦older woman younger man relationshippregnant wifesuicide by gunshotsuicide by shooting one's self in the headsuicide of lover (See All)
Story:
dysfunctional marriagefemale nudityf ratedmale nudityflashbackmale frontal nuditymasturbationmale rear nuditydogbare chested malegunsex scenekisscigarette smoking β€¦male full frontal nuditythree word titlevoice over narrationcryingbeatingdreamface slapwatching tvdrinksex in bedbare buttvomitingliebeertearsbedmarijuanareference to jesus christswimminghalloweendrivingpainterbathnews reportpaingunshotspermliaruniformkissing while having sexhatetwenty somethingpickup truckoverallsmale masturbationburglarypet dogmental hospitalco workermakeupthirty somethinglonernotenervous breakdownadulterous wifewomen's rightsbarking dogstorecartoon on tvstabbed in the handgerman shepherdpaintmotel roompregnancy teststonedinfertilitysecond chancepsychiatric hospitalparasitelimpborn again christianliberationloudspeakerman slaps a womanwomen's bathroomfemale sitting on a toiletaspiring writerfemale vomitingpagancashierapplying makeupfood poisoninglife supportreference to the ten commandmentsbacteriafertilitybible studysex at workwatching news on tvadulteresscosmetics22 year old30 year oldstore roomfacial bruisepublic address systemtwisted ankletalking in bedblackberryhouse painterretailsperm samplereference to catcher in the ryediscovering one is pregnantdeath of a co workerpicnic tablealsatiandiscount storetalking in bed after sexdevil worshipertrying to conceiveheavy makeupretail storesalespersonsex with a coworkersperm countreference to holden caulfieldhand on a breastmotel desk clerkautomatic doorloudspeaker announcementsex with husband's best friendsuicide of colleague (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Chaos Theory (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Chaos Theory (2008)

At his daughter's wedding, time-management specialist Frank Allen corners the reluctant groom and tells him a long story: about the night his wife chose him, and then, about eight years later, when a missed ferry, a corporate groupie, a panicked expectant mother, and a medical test brought Frank's m β€¦arriage to a crisis. In the midst of the crisis were Frank, his wife Susan, their daughter Jesse, and Frank's best friend, the feckless Buddy. Things come to a head at a lake when Frank, armed with a shotgun, decides to cross something permanently from one of his time-management lists. Is there ever room for whim and chaos? (Read More)

Themes:
depressionloveinfidelityjealousyadulterypregnancydrunkennesswedding
Locations:
hospitalbarmotorcycleboatnightclublakemotelschool teacher
Characters:
husband wife relationshipfamily relationshipsfather daughter relationshipdoctorlove trianglebest friendbetrayal by friend
Story:
fatherhoodspeechflashbackgunfightcigarette smokingtitle spoken by charactertelephone callbeatingfistfightcar accidentface slapshotgunliebed β€¦classroombedroomhotel roombinocularsblack pantieschildbirthhelmettold in flashbackbeardnosebleedwristwatchbirthbra and pantiesplaygroundmisunderstandingbroken glassrowboatblack braice hockeysalesmanmarital separationnotenervous breakdownferryblack bra and pantiesgirl in bra and pantiesrunning awayfemale teacherlecturemotel roomhangovergroomwoman in lingeriefisticuffstrickmerry go roundneuroticsuicidal thoughtsice rinkchancemotivational speakergun storepassed out drunkliststreakingdishonestysterilitymedical testsinking boatbouquet of rosestwitchingfather of the bridenew year's resolutionhockey arenalab resultslist makingindex cards (See All)

Anomalisa (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Anomalisa (2015)

Michael Stone, an author that specializes in customer service, is a man who is unable to interact deeply with other people. His low sensitivity to excitement, and his lack of interest made him a man with a repetitive life on his own perspective. But, when he went on a business trip, he met a strange β€¦r - an extraordinary stranger, which slowly became a cure for his negative view on life that possibly will change his mundane life. (Read More)

Subgenre:
absurdismstop motion animationadult animation
Themes:
depressioninfidelityadulterydrinkingdrunkennessextramarital affairlonelinessunfaithfulness
Mood:
nightmare
Locations:
barhotelairplanetaxiairporttaxi driverhotel bar
Characters:
husband wife relationshipfather son relationshipsingerboyolder man younger woman relationshipcolleague colleague relationshipself helpself deprecation
Period:
2000s
Story:
speechpuppetsexfemale nuditymale nudityone word titlefemale frontal nuditymale frontal nuditymasturbationsex scenecigarette smokingtitle spoken by charactersinging β€¦showerbased on playsongurinationdrinkbookf wordno opening creditsdream sequencesmokingauthorhotel roomsuitcasemoaningfull frontal female nuditycharacter says i love yousex toyone night standcheating husbandbreakfastnicknamevoice over letternervous breakdownfull frontal male nuditylooking out a windowasthmaurinatingtitle same as booktelephone conversationsex shopsurprise partyvoiceconferencehotel managerroom servicemotivational speakerpublic speakingdrunken sexcincinnati ohiosmoking after sextelephone operatora cappellahotel desk clerknickname as titleportmanteaubellboygender confusioncustomer serviceinferiority complexex lover ex lover relationshipautomatonexistential crisisincommunicabilitypersonal diaryspoiled sonmaking a scenebad breakupmid life crisisreference to cyndi lauperantique dollclockwork toyhumming in a carmultiple characters voiced by same personsex in hotel room (See All)

Ordinary People (1980) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ordinary People (1980)

Beth, Calvin, and their son Conrad are living in the aftermath of the death of the other son. Conrad is overcome by grief and misplaced guilt to the extent of a suicide attempt. He is in therapy. Beth had always preferred his brother and is having difficulty being supportive to Conrad. Calvin is tra β€¦pped between the two trying to hold the family together. (Read More)

Subgenre:
coming of age
Themes:
dysfunctional familydepressiondeathsuicidefalling in loveself harmsuicide of friend
Mood:
high school
Locations:
swimming poolchicago illinoisstorm at sea
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipmother daughter relationshipbrother brother relationshipgrandfather grandson relationshipgrandmother grandson relationshipself centeredness
Story:
bare chested maledeath of friendsuicide attemptbirthday partydrowningdeath of childdeath of brothertragic eventdeath of sonsociopathforbidden lovemental hospitalpost traumatic stress disordersibling rivalrymarital separation β€¦repressionpeer pressurewrist slittingpsychoanalysisbereavementmiddle classhouston texaspsychotherapyteen suicidefamily crisisfather son conflictfamily conflicthusband wife conflictemotional abusebad motherstudent athletepsychological abuseepiphanymother son conflictphilosophical conversationlake michigantherapist client relationshipshock therapycircle of friendshuman conditionboating accidentplea for understandingswimming teamcruel mothersurvivor's guilt (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Squid And The Whale (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Squid And The Whale (2005)

In 1986, In Brooklyn, New York, the dysfunctional family of pseudo intellectuals composed by the university professor Bernard and the prominent writer Joan split. Bernard is a selfish, cheap and jealous decadent writer that rationalizes every attitude in his family and life and does not accept "phil β€¦istines" - people that do not read books or watch movies, while the unfaithful Joan is growing as a writer and has no problems with "philistines". Their sons, the teenager Walt and the boy Frank, feel the separation and take side: Walt stays with Bernard, and Frank with Joan, and both are affected with abnormal behaviors. Frank drinks booze and smears with sperm the books in the library and a locker in the dress room of his school. The messed-up and insecure Walt uses Roger Water's song "Hey You" in a festival as if it was of his own, and breaks up with his girlfriend Sophie. Meanwhile Joan has an affair with Frank's tennis teacher Ivan and Bernard with his student Lili. (Read More)

Subgenre:
independent filmsemi autobiographical
Themes:
dysfunctional familylovefriendshipmarriageinfidelitymoneyadulterypregnancydrinkingdrunkennessextramarital affairdivorceobsessionunfaithfulnessdating β€¦poetrybreak upregret (See All)
Mood:
high school
Locations:
hospitalnew york cityrestaurantbathtubelevatorbrothelmuseum
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipteenagerfriendboyfriend girlfriend relationshipdoctorsingerbrother brother relationshipboybrother sister relationshipteenage girlteenage boy β€¦girlnursepolicemanwriterlawyerteacher student relationshippsychiatristolder man younger woman relationshipolder woman younger man relationshipfrench kisschinese foodtalking to oneself in a mirror (See All)
Period:
1980s
Story:
animal in titlesexmasturbationbare chested malekissphotographsingingpartypantiesshowertelephone call β€¦cryingsongunderwearfoodmirrorface slapwatching tvcatdrinkcondomletterbookliebeertearsbedcafebathroomclassroomguitarbracookingcandleambulanceeatingtoiletboxingsubwaydinnerno opening creditsparklibrarymicrophonevirginliarreadingclassobscene finger gesturetypewritertherapyheart attackrecord playerlistening to musicrecordingguitaristwatching a movietherapistnosebleedpsychologisttennisbrooklyn new york citycelebrationpillsunderage drinkingfeministtheatre audienceturtlemarital separationsongwriterholding handsearphoneswhalecafeteriaguitar playerjunior high schoolping pongplagiarismpassing outcustodyreference to the rolling stonesbrother in law brother in law relationshipreference to charles dickenssquidtennis playertable tennisoxygen maskpneumoniacustody battlepublishingreptilesleeping on a sofaliterary agentfrecklesreference to f. scott fitzgeraldreference to pink floydradiatorreference to errol flynnreference to franz kafkachild supporttennis proreference to jean luc godardamphibiantape deckgalapagos islandspeanutparent teacher conferencecowboy bootreference to jean paul belmondowriting classschool blazertennis coachhugging pillowjoint custodyletter of rejectionprospect park brooklyn new york cityfolding bedobject in nosereference to john mcenroeslapping someone's handtylenol (See All)

About Schmidt (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

About Schmidt (2002)

Warren Schmidt has led a safe, predictable life working in the insurance industry in Omaha, Nebr. for many years, yet now faces retirement. At the same time he is forced to take a hard look at his wife, his life and his relationship with his estranged daughter. An often hilarious series of events fo β€¦llow as Schmidt embarks on an unpredictable RV journey to attend his daughter's wedding in Denver. (Read More)

Subgenre:
black comedyfish out of water
Themes:
dysfunctional familydepressiondeathmarriageinfidelityweddingfuneralseductiontravelgriefdeath of wife
Mood:
satire
Locations:
barrestaurantcemeterybathtubairportroad tripgas stationroad moviemuseum
Characters:
family relationshipsfather daughter relationshipnative americancatholicself discoverylove letterjapanese americaninsurance agentself narration
Story:
speechtwo word titlefemale nuditycharacter name in titlebased on novelmale nudityflashbackvoice over narrationcryingurinationkissinglettercollegef word β€¦orphanold manwomantoiletnundrawingwidoweron the roadafricananswering machinesupermarketinjuryloss of wiferetirementironycharitymedicationfrustrationhot tubsalesmanvoice over letterexistentialismdivorceemidlife crisiswedding receptionirreverencereflectioncar troublecrisisvacuum cleanercoloradofraternityinterracial marriagetoastgeneration gapfuneral homereference to abraham lincolnkansasrecreational vehiclefirst person narrationunwanted kissbanquetletter writingmorticianfamily gatheringnebraskahighway travelbohemianchild's drawingmobile homereference to george washingtonreference to walt disneyhouseguestshooting starodysseydenver coloradochildhood homecorrespondencetelephone boxfigurinein jokeson in lawwaterbedpen palmotor homemulletmullet haircutlife changingtourist attractionanger managementspiritual journeywinnebagolife crisisgolden ageretirement partyfuture in lawsarrowheadwedding rehearsalchannel surfingomaha nebraskamoral storyolder woman nudelawrence kansasmalaisereference to buffalo billactuarydairy queensalespeopleself absorbedwedding toastcommodecondolencestrailer camp (See All)

The Celebration (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Celebration (1998)

The Father turns 60. His family, which is a big one of the kind, gathers to celebrate him on a castle. Everybody likes and respects the father deeply...or do they? The youngest son is trying to live up to the father's expectations. He is running a grill-bar in a dirty part of Copenhagen. The oldest  β€¦son runs a restaurant in France, while the sister is a anthropologist. The older sister has recently committed suicide and the father asks the oldest son to say a few words about her, because he is afraid he will break into tears if he does it himself. The oldest son agrees without argument. Actually he has already written two speeches. A yellow and a green one. By the table, he asks the father to pick a speech. The father chooses green. The oldest son announces that this is the Speech of Truth. Everybody laughs, except for the father who gets a nervous look on his face. For he knows that the oldest son is about to reveal the secret of why the oldest sister killed herself. (Read More)

Subgenre:
cult filmblack comedyfamily drama
Themes:
dysfunctional familydepressionmurderfriendshipsuiciderapepregnancydrinkingdrunkennessfuneralincestmemoryracismsexualityhumiliation β€¦abuseabortionprejudicehuntingdeath of daughterfather daughter incestsuicide of daughter (See All)
Mood:
satire
Locations:
restauranthotelbathtubwaterairportkitchen
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerbrother brother relationshipbrother sister relationshipdancerchristianbullywaitress β€¦interracial relationshipdaughterfatheruncle nephew relationshipgrandfather grandson relationshipgrandmother grandson relationshipgrandmother granddaughter relationshipuncle niece relationshipgrandfather granddaughter relationshipparent child relationshipsuicide by drowningalcoholic drink (See All)
Story:
speechsexfemale nuditymale nudityviolenceone word titlebondagekissfightcigarette smokingdancingsingingpartytelephone call β€¦cryingcell phonesongbeatingunderwearfoodblondeface slapdrinksecretlettervomitingshowdowntearsbirthdaybathroompianohallucinationalcoholcookingwinecandleold maneatingdinnerchild abuseapologychilddrawingbirthday partybathcoffeeracial slurknocked outpianistdisappearancereunioncharacter says i love youtwinpsychicscandalsexual abuseragecookservantbreakfastembarrassmentcelebrationinterracial romancehaunted by the pasttensionhypocrisysonkickingdespairpedophiledrunkdeath of sisterfallracistboarding schooltuxedofamily secretpedophiliacafeteriafamily reunionlectureblonde womanestatedrunken manwhistleshoutingimaginary friendreceptioniststonedtoastgiving a toastman punching a womanrespectloss of sistercountry housespitanthropologynervousnessgravestonecircular staircasehypocriteriddletwin sisterretributionfather son conflictchild rapeman hits a womansocialistman slaps a womanman slaps womantied to a treepatriarchcaught in the actfamily gatheringsenilitydogme 95danish blondeman hits womantaxi ridecar keysalcohol abusefalling asleeprestaurant ownerreference to alfred hitchcockcountry estatewine cellarostracismdawnman punches a womancompanionlodgefreemasoncognacprodigal sondirty old mandisgracedisrespectdisgustshower curtaindrowning in a bathtubupstairs downstairsspontaneous sexwearing clothes in a bathtubbirthday dinnerfather son incestdeath of twinbanging on a doordanish culturefather sondismaysuicide of sisterdisdaindaybreakexcessive drinkingvenison60th birthdayhotelierpater familiasreference to little black sambo (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Wackness (2008) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wackness (2008)

Friendship, love, and coming of age in New York City, summer of 1994. Luke Shapiro has just graduated from high school, sells marijuana, and trades pot for therapy from a psychologist, Dr. Jeffrey Squires. Luke is attracted to a classmate, Stephanie, who's out of his league and Squires' step-daughte β€¦r. By July, he's hanging out with Stephanie, taking her on his rounds selling pot out of an ice-cream pushcart. Then things take a turn. In the background, Squires and his wife as well as Luke's parents are having their troubles. (Read More)

Subgenre:
independent filmcoming of ageerotic fantasy
Themes:
dysfunctional familydepressionlovefriendshipinfidelitydrugsmoneydrinkingdrunkennessdivorcelonelinessparanoiadrug useunrequited lovefalling in love β€¦first love (See All)
Mood:
high schoolhip hop
Locations:
new york citybarbeachtrainbicycleelevatorlakerooftopoceansex in shower
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipteenagermother daughter relationshipafrican americanfriendteenage girlteenage boypolice officerpolicemandancermusician β€¦best friendpsychiatristolder man younger woman relationshipgrandfather grandson relationshipgrandmother grandson relationshipdoctor patient relationshipsuicide by hangingstepfather stepdaughter relationshipolder man younger man relationshipparty girlsuicide by drowningconsidering suicidesuicide by pills (See All)
Period:
1990ssummeryear 1994
Story:
sexfemale nuditymale nuditymasturbationmale rear nuditydogbare chested malegunkisscigarette smokingdancingphotographtitle spoken by characterpartyerection β€¦pistolshowertelephone callvoice over narrationcryingdreammachine gunmirrorurinationslow motion scenewatching tvdrinkcondomarrestundressingbare buttbookvomitingbeertearsmarijuanasex standing upbathroomcollegejailvoyeurreference to jesus christguitarmanhattan new york citysubjective cameraswimmingnewspapercandledrug dealermontagecocainesuicide attempttoiletsubwayunderwater scenecoffeebartenderparkprologuefantasy sequencepay phonemassagereadingpremarital sexcharacter says i love youhandgunobscene finger gesturegraffititherapyfreeze framesexual fantasypot smokingloss of virginitylistening to musicice creamjail cellexerciseguitaristdrug abusetherapisteccentricphone boothswimsuitvirginitystreet lifepillsnew jerseyattempted suicidehypocrisyunderage drinkingbackpackpet dogheadphonescigarette lightercard playingnintendoraised middle fingertuxedobrushing teethmarital problemworld trade center manhattan new york cityferrymidlife crisisfast motion scenemale virginimpotencenarrated by charactersandwichbongshortscentral park manhattan new york cityevictionmen's bathroomsnorting cocainejukeboxstonermasseusedrug dealmaking outtape recordingunconsciousnessstonedpopularitybeach housecdplaying a video gamereindeeraudio cassettealtered version of studio logopsychoanalysisbroken heartaerobicshomeless personpsychotherapyheatpremature ejaculationhigh school graduationboom boxcrossword puzzlewife leaves husbandbailgeneration xcassette tapehidden moneyillegal drugspagerwriting on a wallempire state building manhattan new york cityreference to bob dylansweatingsocial outcastshared showerwatching pornographygame boycheating on wifemagic mushroompeepholesummer jobprescription drugsbeeperdancing in the streetwanting a divorceattempted drowningreference to kurt cobaingraduation partyrotterdam netherlandswater ballooneye dropsforeign exchange studentterrierbongo drumdog urinationoutdoor showerritalincrying during sexeuphoriahigh school yearbookscratching facereference to goldilocks and the three bearsgraduation cap and gownreference to pearl jamworkout video40 ozmagic markerwest highland white terrierflushing drugs down a toiletpush cartcigarette behind earpracticing a line of conversationreference to rudy giulianialcohol in brown paper bagapartment evictionice cream cartblowing smoke ringscharacter lies about agefalling out of lovereference to boyz ii men (See All)

Men, Women & Children (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Men, Women & Children (2014)

Men, Women and Children follows the story of a group of high school teenagers and their parents as they attempt to navigate the many ways the internet has changed their relationships, their communication, their self-image, and their love lives. The film attempts to stare down social issues such as v β€¦ideo game culture, anorexia, infidelity, fame hunting, and the proliferation of illicit material on the internet. As each character and each relationship is tested, we are shown the variety of roads people choose - some tragic, some hopeful - as it becomes clear that no one is immune to this enormous social change that has come through our phones, our tablets, and our computers. (Read More)

Themes:
depressionsexualityaffair
Mood:
high school
Locations:
hospital
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boy
Story:
bloodviolencemasturbationsex scenefightcell phoneface slapcomputersuicide attemptinternetteen angstrebellionvirginitysocial commentarybloody nose β€¦ensemble castsocial mediabully comeuppancedomineering motherfacebookaspiring actressinternet chatanorexiavideo gameplaying against typerunning away from hometext on screenoverprotective parenttablet computerwindow smashing (See All)

Blue Valentine (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blue Valentine (2010)

Dean Pereira and Cindy Heller Pereira are a young, working class married couple - Dean currently working as a painter, and Cindy working as a nurse in a medical clinic - with a young daughter named Frankie. Despite their relatively tender ages, they are both ravaged by the life they've eked out toge β€¦ther and by the experiences they've had leading into their marriage. Dean, a high school drop out, comes from a broken home, where he never really had a mother figure. He never saw himself getting married or having a family despite falling in love at first sight with Cindy. He doesn't have any professional ambition beyond his current work - which he enjoys since he feels he can knock off a beer at 8 o'clock in the morning without it affecting his work - although Cindy believes he has so much more potential in life. Cindy also comes from a dysfunctional family, with her own mother and father not setting an example of a harmonious married or family life. One of her previous serious relationships was with Bobby Ontario, that relationship which has a profound affect on many aspects of her marriage to Dean. Dean and Cindy head off on an overnight getaway together without Frankie, the getaway which may provide a clearer picture if their marriage can survive its many issues. (Read More)

Subgenre:
experimental film
Themes:
dysfunctional familydepressiondeathmarriagemoneypregnancydrinkingdrunkennessweddingangerdivorcewrestlingabortionfalling in love
Mood:
high school
Locations:
new york cityrestauranttraincarbustaxiwheelchairtruckmotelgas stationtaxi driversex in showersuvpennsylvaniamotel sex β€¦sex in taxi (See All)
Characters:
husband wife relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctortattoosingergirlnursedancermusicianlittle girllust β€¦ex boyfriend ex girlfriend relationshipgrandmother granddaughter relationshipgrandfather granddaughter relationship (See All)
Story:
dysfunctional marriagetwo word titlefemale nuditymale nudityviolencefemale frontal nudityflashbackmale rear nuditydogbare chested malesex scenekissfemale rear nudity β€¦fightcigarette smokingdancingnipplesphotographsingingleg spreadingpantiesshowertelephone callvoice over narrationfondlingcryingsongbeatingsex on couchfoodmirrorurinationface slappunched in the facedrinkbare buttbooktearsrunningcafesex standing upbathroomclassroomprayercolor in titlealcoholf wordcleavagebedroomold manbreast sucklingmontagebridgeeatingsubwaynonlinear timelinedrivingjudgeapologyman with glasseschildscantily clad femalecontroversyold womanflash forwardargumentblack pantiessuitcasereadingcollege studentu.s. presidentflowersdomestic violenceamerican flaginjectionfemale removes her clothesclasssleepingfireworksgrandmotherblack americangirl in pantieseyeglassesapplausehugginganswering machineno pantiesnipples visible through clothingwarehousehypodermic needlelistening to musicvandalismhollywood californiafloridahome moviebrooklyn new york citycoitusbreakfastpromisejanitorrear entry sexshoesbackpackgrandfatherjob interviewkickingpunched in the stomachlove at first sightco workerlaughterpanties pulled downe mailwedding ringnotelooking at self in mirrorfamily dinnerbrushing teethmarital problemfemale in showercopulationwrestlerdead dogearphonesunhappy marriagewedding ceremonystorepromiscuous womanfirst datefemale removes her dressreading aloudfencemotel roombrooklyn bridgepregnancy testclimbing through a windowreceptionistbusiness cardcdmilitary uniformunplanned pregnancymarriage problemsnursing homefilling stationrainbowsitting on a toiletfourth of julyspoonundressing someonehoodiehopelessnessnew york skylineshopping cartlocketexpectant motherpackingpanties hit the floorsex on the floortap dancingsaying graceman in a wheelchairliquor storeice cream conestealing moneygynecological examultrasoundbickeringjoke tellingwoman in a wheelchairdeath of petlooking for a jobshared showerwalkernursingmoving vanold people's homecd playerabortion clinicwedding daypretendingtwo in a showerlost dogclimbing a fencemultiple loverspunched in the gutukulelecopy machinewanting a divorcedoghousereservationpregnant bridepromiscuous pastface woundpainting a walldog hit by a carhouse paintervoice over readingdeath of a dogmissing dogremoving wedding ringdeath of a petoatmealburying a dead dogunhappily married womanmoverraisinreference to prince charmingunpackingweekend getawayreference to jon bon joviremoval vanburial of petblow dryertaking off one's pantiesthrowing away wedding ringreflection in a car windowassisted living facilitywilliamsburg brooklyn new york citybrushing someone's hairemployment officegift certificatestuffed toy dogmeat loafreflection in a glass windowrunning backwardsschool programtearing off someone's panties (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Patrick Melrose (2018)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Patrick Melrose (2018)

A critical and often humorous look at the upper class, tracking the protagonist’s harrowing odyssey from a deeply traumatic childhood through adult substance abuse and, ultimately, toward recovery.

Themes:
mental illnessdysfunctional familydepressionincestabusealcoholismchildhooddrug addictionchildhood trauma
Characters:
husband wife relationshipfather son relationshipself destructiveness
Period:
1980s1990s1960s2000s
Story:
two word titlealcoholchild abuseclassmillionaireabusive fatherchild molestationupper classrecoveryodysseytrackingtraumatic childhoodsubstance abusechild sexual abusefather son incest β€¦childhood sexual abuse (See All)

Spanglish (2004) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Spanglish (2004)

John Clasky is a devoted dad whose skills as a chef have offered his family a very upscale life, including a summer home in Malibu and a breathtaking new Mexican housekeeper, named Flor. She and her daughter Cristina have recently emigrated to L.A. from Mexico and are trying to find a better life. W β€¦hen they move in with the Claskys for the summer, Flor has to fight for her daughter's soul as she discovers that life in a new country is perilous! (Read More)

Subgenre:
independent film
Themes:
dysfunctional familymarriageinfidelitymoneyadulterydrinkingdrunkennessextramarital affairguiltunfaithfulness
Locations:
beachrestaurantcarlos angeles californiabuskitchenmexicoschool bus
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipsingerboygirlreference to godalcoholicmaidcatholichispanicself esteem
Story:
dysfunctional marriagesexdogkisssingingshowertelephone callvoice over narrationcryingcell phonesongunderwearfoodwatching tvdrink β€¦lettertearsrunningcafecollegeprayernewspaperwomaneatingimmigrantimmigrationscreamingstorytellingmanipulationconvertibleautomobileclass differencessingle parentflirtingjeepjoggingcooknosebleedchefculture clashspanishobesityjob interviewshoppinghousekeeperillegal immigrantpromiscuityvodkainsecuritylanguage barrierprivate schoolcadillacrealtorneuroticemigranttranslationaudimalibu californiamexican immigrantplaying against typedry cleanersreference to george lucasmonopoly the board gamefood criticprinceton universityenglish lessonsummer homenight jobspanglishreference to herbert hooverchild translates for adultcadillac escaladeaudi a4college admissionjeep grand cherokeeunable to speak english (See All)

Crazy, Stupid, Love. (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Crazy, Stupid, Love. (2011)

Cal (Steve Carell) and Emily (Julianne Moore) have the perfect life together living the American dream... until Emily asks for a divorce. Now Cal, Mr Husband, has to navigate the single scene with a little help from his professional bachelor friend Jacob Palmer (Ryan Gosling). Make that a lot of hel β€¦p... (Read More)

Themes:
depressionfriendshipmarriageinfidelitymoneyadulterydrinkingdrunkennessextramarital affairangerdivorceunfaithfulnessfight for love
Mood:
rainnightmare
Locations:
barlos angeles californiabicyclebaseball
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage boyteachergirlpolicemandancerlawyer β€¦sister sister relationshipreference to godemployer employee relationship (See All)
Story:
graduation speechmasturbationbare chested malesex scenekissfightdancingphotographchasetelephone callcryingcell phonedreamface slapslow motion scene β€¦punched in the facewatching tvcomputercameradrinkliesunglassesbedreference to jesus christclassroomf wordwomanmontagemarriage proposalcoffeebartenderscreaminglocker roomumbrellaflowersgympursuitdatebasementsadnesscharacter says i love yougardenblindfoldballetclasssleepingobscene finger gesturekissing while having sexrecord playerapplauseanswering machinelistening to musicbabysitterrecordingice creamone night standwomanizershoesbuddyensemble castmakeuplipstickwedding ringmarital separationraised middle fingermarital problemmidlife crisisreckless drivingtext messagingmale objectificationtitle ends with periodaccountantgardeningsneakersteenage lovewalletescalatortrue love17 year old13 year oldcredit cardballerinahonestysushinervousnessteenage crushtextingbouquetmiddle schoolforty somethinghardware storeplaying footsieimplied nuditysoul matetalking to oneselfpassing outapple computerlaw studentrecovering alcoholiccologneschool lockerlaw schoolmoving vanbaseball gloveminiature golfvaliumsextingplaying catchnude photoschool cafeteriaenglish classstanford universityreference to the titanicstanding in the raindisapproving fatherpickup linereference to steve jobsparent teacher conferencereference to mcdonald'swatching through a windowrunning a red lightreference to hugh hefnerbachelor padcopying machineunhappily married womanjumping out of a moving carlotharioreference to ashton kutcherreference to demi mooreschool auditorium44 year oldbar examreference to patrick swayzedomestic strifemen's clothingmale makeovermixing a drinkphotographing oneselfcaramel applemassage chairreference to the scarlet letterreference to wilt chamberlainslapping someone's handteen parentlifting a girl into the airreference to conan o'brienwater heater (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Raging Bull (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Raging Bull (1980)

When Jake LaMotta steps into a boxing ring and obliterates his opponent, he's a prizefighter. But when he treats his family and friends the same way, he's a ticking time bomb, ready to go off at any moment. Though LaMotta wants his family's love, something always seems to come between them. Perhaps  β€¦it's his violent bouts of paranoia and jealousy. This kind of rage helped make him a champ, but in real life, he winds up in the ring alone. (Read More)

Subgenre:
stand up comedybased on autobiography
Themes:
dysfunctional familyjealousydrunkennessweddingextramarital affairangerdivorcebrutalityparanoiamafiaredemption
Locations:
new york citybarrestaurantswimming poolhotelnightclubchicago illinois
Characters:
husband wife relationshippoliceboyfriend girlfriend relationshipbrother brother relationshipphotographertough guycomedianself destructivenessbrother in law sister in law relationshiptalking to oneself in a mirrorself hatred
Period:
1960s1940s
Story:
dysfunctional marriageanimal in titlebloodviolencefighttelephone callbeatingfistfightmirrorcameraarrestbrawlcompetitionmanhattan new york cityboxing β€¦domestic violencesadnesschampionmachismocoachiceragejail cellphone boothhome movieparking garagerampageunderage drinkingconfrontationitalian americanbackstagediscussionmiami floridaprideblack eyemale male kisspunchneighborhoodstage showhit in the faceviolence against womendetroit michiganfilm camerasweatinfatuationarenawrathbumoverweightbroken nosemiddle agedecadencein medias resprice of famebronx new york cityneglected wiferise and fallcleveland ohioslapsolitary confinementjealous husbandtroubled marriageendurancesnorricamstatutory rapefistwashed up starboxing gymhit with a car doormadison square garden manhattan new york citymarriage crisissports manchampionship beltfighting moviefixed fighthot tempernagging wifemale slaps a malefake nosehematomapathological jealousy (See All)

Whale Rider (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Whale Rider (2002)

On the east coast of New Zealand, the Whangara people believe their presence there dates back a thousand years or more to a single ancestor, Paikea, who escaped death when his canoe capsized by riding to shore on the back of a whale. From then on, Whangara chiefs, always the first-born, always male, β€¦ have been considered Paikea's direct descendants. Pai, an 11-year-old girl in a patriarchal New Zealand tribe, believes she is destined to be the new chief. But her grandfather Koro is bound by tradition to pick a male leader. Pai loves Koro more than anyone in the world, but she must fight him and a thousand years of tradition to fulfill her destiny. (Read More)

Subgenre:
independent filmmartial arts
Themes:
marriagepregnancydancedeath in childbirthdying in childbirth
Mood:
night
Locations:
hospitalbeachbathtubbicyclerural settingoceanschool bus
Characters:
father son relationshipfather daughter relationshiptattoofemale protagonistteachergirlbabyartistinterracial relationshipgrandmother granddaughter relationshipsingle fatheruncle niece relationshipgrandfather granddaughter relationshipbaby girldeath of baby in childbirth
Story:
speechanimal in titletitle directed by femalef ratedbased on noveltitle spoken by charactervoice over narrationswimmingconcertold manapologytongueritualunderwater scenesmoking β€¦legendprologuechildbirthunderwaterloss of mothertwinapplauseropetraditionjoggingloss of wifeflatulencevisitculture clashbirthsocial commentarydivingloss of sonsexismopening a doortrophydead motherriding a bicyclenew zealandceremonytriple f ratedmysticismwhalecanoetween girlgeneration gapheritagemotorboatlobsterchantingslide showcharacter says i'm sorrydead brothermaoriwarrior womanspeaking to audiencewarrior raceshadow puppettraditional dancemother dies in childbirthancestral heritagewar danceobligationbeached whaleschool pageanttribal eldermother died at childbirth (See All)

American Beauty (1999) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American Beauty (1999)

After his death sometime in his forty-third year, suburbanite Lester Burnham tells of the last few weeks of his life, during which he had no idea of his imminent passing. He is a husband to real estate agent Carolyn Burnham and father to high school student Janie Burnham. Although Lester and Carolyn β€¦ once loved each other, they now merely tolerate each other. Typical wallflower Janie too hates both her parents, the three who suffer individually in silence in their home life. Janie tries to steer clear of both her parents. Carolyn, relatively new to the real estate business, wants to create the persona of success to further her career, she aspiring to the professional life of Buddy Kane, the king of the real estate business in their neighborhood. Lester merely walks mindlessly through life, including at his job in advertising. His company is downsizing, and he, like all the other employees, has to justify his position to the newly hired efficiency expert to keep his job. Things change for Lester when he falls in love at first sight with Janie's more experienced classmate, Angela Hays. Both Janie and Angela can see Lester's sexual infatuation with Angela, who courts such attention from any man as a sign that she is model material, she having once appeared in Seventeen and it a career to which she aspires. Lester's infatuation with Angela gives him a reenergized view on life, where he openly doesn't care anymore what anyone thinks about what he does, anyone except Angela. This in… (Read More)

Subgenre:
cult filmcoming of ageblack comedydark comedyteen romancedeadpan comedytragicomedy
Themes:
dysfunctional familydepressionmurderdeathfriendshipinfidelitydrugsadulterydanceseductionextramarital affairangerobsessionparanoiablackmail β€¦drug useunfaithfulnesshomophobiafalling in lovecheating (See All)
Mood:
high schoolgoresatirerainsocial satiremoving
Locations:
swimming poolcarsmall townbathtubmotelsinging in a carsex in a motel
Characters:
husband wife relationshipfather son relationshipfamily relationshipshomosexualmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boywriterbest friendreference to godgay kiss β€¦lusthomosexualityolder man younger woman relationshipself discoverymilitary officerself destructivenessamerican dreamself hatredgirl nudityfather and daughteronly daughter (See All)
Period:
1990s
Story:
dysfunctional marriagetwo word titlefemale nudityf ratednuditybloodmale nudityviolencebare breastsfemale frontal nudityflashbackmasturbationmale rear nuditybare chested malegun β€¦sex scenekisscigarette smokingfingeringnipplessurprise endingpantiesshowertopless female nudityvoice over narrationfondlingbeatingshot to deathblood splatterblondeface slapshot in the headslow motion scenecomputercamerasex in bedbare buttbeerbedmarijuanabathroomneighborvoyeurtelevisionf wordcleavagegay slurbedroombratoplessvideo camerabasketballdrug dealerwomandinnermodelno opening creditsdream sequenceanti heroscantily clad femalelatex glovesgunshotargumentstrippingvirginbusinessmanscreamingsuburbfantasy sequencemini skirtmoaningdomestic violencefemale removes her clothestragic eventcheerleaderpremarital sexschoolgirlsemiautomatic pistoldirectorial debuthandgunobscene finger gesturegay couplecheating wifegaragehatesexual fantasyflirtingcloseted homosexualeavesdroppingpot smokingteen angstcountry name in titleheavy rainjoggingtold in flashbackexercisemagazinebuttocksvideotapeblockbustercrushvirginitycoloneldrug dealingwatching televisionsexual desirebuddhistbarefoottensionmale masturbationcouchcynicismmisunderstandingunfaithful wifejob interviewnipplereference to satanadvertisingroseperversiondeceitrainstormabusive fatherfamily dinnerexistentialismloss of husbandalienationmarital problemmidlife crisissports carneighborhoodlingerie slipexhibitionismlyingirreverencemain character diesage differencewoman in bathtubadulterous wifereal estate agentworkoutunhappy marriagetablegardeningtruthcannabisinsecuritypedophiliaparenthoodblue pantiessarcasmmotel roomrepressionloserweightliftingloud sexschoolboydenialquitting a jobexhibitionistinfatuationtyranttopless girlmale protagonistunderage smokingsofacamcordervideo footagesexual repressionmurder by gunshotnatural breastsrealtorreference to james bondin medias resdrug humorpool of bloodshooting rangemovie camerawet clothesunwanted kissfast food restaurantabsent motherlolitaolder man younger womanmaterialismcheerleader uniformcrime of passiondomineering fatherloveless marriageex marinesoul matewoman moaning from pleasurewoman moaningmoaning womanolder man young girl relationshipu.s. marinerainy nightcheerleadingplastic bagsecret lifehomophobeneurosisbasketball gamegirl toplessnarration from the gravecocktail partybeer bottlevhs tapespit takeillegal drugcubicleestranged couplemuscle cartalking during sexmale in a showerfiring rangemistrustrepressed homosexualinnuendomasturbating in a showerdirty old manbalaclavacovered female frontal nudityemotional breakdownlava lampteen smokingyounger woman older man relationshipfemales talking about sexblood on walldrive thrurepeated scene from a different perspectiveasparagusmemorabilianight drivingolder man younger girlmistaken for gayspying on someonevisual hallucinationbarely legalwoman undressing for a manplaying musicyounger girl older manreference to pink floydremote controlled toy carthe color redbroken dishdrug testingfamily problemsmother slaps daughterunexpected kissurine samplehouse cleaningvideotapingweight trainingman undressing a womanolder man teenage girl relationshipjoblessnessflower petallocking a doorvirgin girlcamera zooming inchange of minddissatisfactionfacadehomophobic violencehomosexual couplewoman taking off pantsrandomnessbench presslow paid jobrose petalwhirlwindman on topseverance payapplying for a jobdv cameraefficiency expertspying on neighbortalking dirty during sexnazi paraphernalianew automobileurine testvideo collectionman hugging a manvaporcushionnon communicationnymphetthreat of employment dismissalviolence against a teen (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Horse Whisperer (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Horse Whisperer (1998)

A teenage girl riding a horse is hit by a truck. To help heal her troubled/injured daughter, and horse, the mother takes them to Montana to recuperate at the ranch of a 'horse whisperer', a horse healer of mystical talents. The mother proceeds to fall in love with him, as well.

Themes:
dysfunctional familydepressiondeathadulteryextramarital affairtraveltrauma
Locations:
hospitalnew york cityhelicoptersnowrural settingofficeusa
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipteenage girlnursesecretaryhuman animal relationshiphorse actor
Period:
winter
Story:
animal in titlebased on noveltelephone callcell phonehorseinternetaccidentpay phonedirected by starhorse ridingtherapyteen angstoverallscountry musiclandscape β€¦snowingranchdead girlreflectioneditoramputeetween girlcattlehospital bedamputationrehabilitationgroommontanapublic phonepost traumatic stressbrandingfax machineequestriangracemagazine covermagazine editorrainy dayrider horse relationshiphorse trainerfaxwestern u.s.girl horse relationshippatiencestoicismstallionriding accidentapple macintosh computerwoman horse relationshipboy horse relationshipman horse relationshipamputated leggirl riding a horsehorse whisperingpaddockinjured horse (See All)

Peggy Sue Got Married (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Peggy Sue Got Married (1986)

A 43-year-old mother and housewife who's facing divorce is thrust back in time when she attends her high-school reunion. Given the chance to change the course of her life, she finds herself making many of the same choices.

Subgenre:
alternate historytime travel comedy
Themes:
dysfunctional familylovedivorcetime travelpoetrynear death experience
Mood:
high schoolaffection
Characters:
husband wife relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlfemale protagonistex husband ex wife relationshipself discovery
Period:
1960s
Story:
character name in titletitle spoken by characterwatching tvpantyhoseautomobiledatereunioncharacter says i love youheart attacknerdteen angstfatebikergirl with glassesbreakup β€¦nostalgiainventormarital probleminventionreference to the beatlesamericanamusic boxtime looptitle appears in songalternate timelinerepeated eventhigh school reunionwoman smoking cigarettereference to ernest hemingwayclass reunionlodgelife changingreference to napoleon bonapartereference to neil armstrongtime travel romancetheory of relativityrebellious teenagerdo overpoetry quotationmasonic lodgereference to william butler yeatsreference to yeats18 year old girlappliance storefilmed in mirrorreference to the great gatsbyedselrunning tracksecret ritual (See All)

Ghost World (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ghost World (2001)

This is the story of Enid and Rebecca after they finish the high school. Both have problems relating to people and they spend their time hanging around and bothering creeps. When they meet Seymour who is a social outsider who loves to collect old 78 records, Enid's life will change forever.

Subgenre:
independent filmcult filmcoming of ageteen moviecoming of age film
Themes:
dysfunctional familylovefriendshipsurrealismjealousyobsession
Mood:
high school
Locations:
los angeles californiabuswheelchairsummer school
Characters:
father daughter relationshipfriendsingerteenage girlteenage boyteacherjewishteacher student relationshippsychiatristolder man younger woman relationshipdysfunctional relationshipart teacher
Story:
two word titlesexf ratedbare chested malegunfightdancingpartypistolvoice over narrationcryingbased on comic bookold mandinerdrawing β€¦suburbmini skirthigh school studentcult directorsingle parentrecord playerjazzteen angstcakemovie theaterculture clashbossgirl with glassescensorshipcynicismunderage drinkingironymay december romancepunk rockalienationadolescentsurprise after end creditsage differencepractical jokecoffee shopreflectionreal estate agentgraduationboredomloss of jobvideo storesarcasmbus stopclinicmisfitprincipalinfatuationbased on graphic novelshort skirtart exhibitionbechdel test passedracial stereotypeblues musicintimacysex shopolder man younger womanidentity crisisforty somethinghigh school graduationhigh school friendolder man young girl relationshipdyed hairart classsocially awkwardpersonal adnunchakucrossroadsmilkshakeuncertaintysketchbookfried chickenyounger woman older man relationshipolder man younger girlprank telephone callreference to laurel and hardyyounger girl older mangraduation partyelitismgarage salefirst jobplasterconcession standmini martdrama queenrecord collectorrude customer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Regarding Henry (1991) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Regarding Henry (1991)

Henry is a lawyer who survives a shooting only to find he cannot remember anything. As if that weren't enough, Henry also has to recover his speech and mobility, in a life he no longer fits into. Fortunately, Henry has a loving wife and daughter to help him.

Themes:
adulteryamnesia
Locations:
hospitalnew york cityrestaurantschoolkitchenapartmentoffice
Characters:
husband wife relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipgirllawyermaidsecretary
Period:
1990s
Story:
speechtwo word titlesexcharacter name in titledogkisstelephone callshot in the headbookmanhattan new york citybedroomnew yorkapologybreast fondlinglibrary β€¦readingchristmas treescarhuggingbeer drinkingmovie theaterlosschristmas eveschool uniformboarding schoolpuppymemory lossstuffed animalcentral park manhattan new york cityreading aloudyuppieupper classrecoveryrehabilitationbullet wound11 year oldlearningmain character shotimplied sexbrain damagebakingdoormanberethousemaidloss of memorygirls' schoolice cream conesweatercolleaguelaw firmrepentanceloss of loverwalkerstory continued during end creditsbeaglelearning to readcaviarporno movieschool assemblylife changemalpracticephysical therapistbaking cookiesrehabilitation centersocial statusgirls' boarding schoolpublic libraryloss of humanityspeech therapistchildish behaviorchildishnessluxury apartmenttying shoelacesporno theatrevalueschild likefather disappoints childbrain injured manrehab clinicunethical practiceoccupational therapy (See All)

Spider (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Spider (2002)

Dennis Clegg is in his thirties and lives in a halfway house for the mentally ill in London. Dennis, nicknamed "Spider" by his mother has been institutionalized with acute schizophrenia for some 20 years. He has never truly recovered, however, and as the story progresses we vicariously experience hi β€¦s increasingly fragile grip on reality. (Read More)

Subgenre:
independent film
Themes:
mental illnessmurderrevengesurrealisminfidelitybetrayaladulterydrinkingdrunkennessmemoryextramarital affairangerdeath of motherparanoiaunfaithfulness β€¦death of wifetraumamurder of mother (See All)
Locations:
trainbathtublondon englandbicyclekitchenafrica
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipprostitutelittle boy
Story:
animal in titlesexfemale nuditybased on novelbloodone word titleflashbackcigarette smokingejaculationphotographsurprise endingbeatingcorpse β€¦underwearface slapcatdrinkundressinghallucinationnewspapernonlinear timelinechild abusebartenderflash forwardbeaten to deathkeystorytellingmurderergardencult directorpubtrusteyeglassesropeworking classhammerspiderassaulttimerailway stationburialschizophreniarealitymental institutionbarefootpastbroken glassshoveldelusionfamily dinnerneighborhoodlingerie slipmental healthmental patientpresentnotebookparalysisadolescencebicyclinglandladyscorpionbritainplumbersecond chancegasreturnmurder of wifehit with a shovelfur coatanguishmattressschizophrenicpet catasphyxiationboarding housemental asylumscreenplay adapted by authorspaniardmental disorderpassenger trainfalse teethnailscrewdriverexposed breastjigsaw puzzleeeloedipus complexsocklynchiantooleast end londonglass shardkleptomaniahalfway housespiderwebstringbrushing hairgrand guignolsoilsilent nightmumblingball peen hammerlying on the groundreference to sophia lorenemotionally disturbed personmixed identitycordcat's cradleleopard coat (See All)

It's Kind Of A Funny Story (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It's Kind Of A Funny Story (2010)

Craig is a high-school junior, in the gifted program, infatuated with his best friend's girl. When he realizes he's suicidal, he checks himself into the psychiatric ward of a hospital, thinking they'll do an observation, help him, and send him home in time for school the next day. Once in, however,  β€¦he must stay for a week; the juvenile ward is being renovated, so he's in with adults as well as a few youths. Bobby, a man with a young daughter, shows him around; Craig notices Noelle, about his age. He tries to keep his friends from finding out where he is. Little things: he draws, goes to therapy, sings, helps Bobby rehearse an interview. Is this the stuff of insight? (Read More)

Subgenre:
teen movie
Themes:
mental illnessdepressionbetrayaldanceart
Mood:
high school
Locations:
new york cityrooftop
Characters:
father son relationshipfather daughter relationshipteenage boypsychiatristself discovery
Story:
f ratedbased on novelkisspartyvomitingapostrophe in titlebasketballsuicide attemptapologydrawingsix word titletherapypizzaclaim in titlerock star β€¦schizophreniaambitionanxietybrooklyn bridgecontraction in titlestressping pongboy girl relationshipgeneration xwisdomegyptianreference to bob dylanpreparatory schoolgeneration ycreative processpsychiatric wardfemale psychiatristteenage romanceteen lovefake doctordrawingsperfectionisthasidic jewsocial isolationmusical sequence in non musical workwrist cuttingpositive thinkingfear of failureinsightzoloftfamily supportdrawing of penis (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

In The Bedroom (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Bedroom (2001)

In idyllic Mid-Coast Maine, the Fowler family's only son Frank comes home from his freshman year at college for summer vacation. His mother Ruth, the school choir director, is unhappy with Frank dating soon-to-be divorced mother Natalie who is several years his senior, but Frank's father Matt, the t β€¦own doctor, doesn't see a problem. While Frank considers holding off his future for Natalie, her jilted husband causes them all problems until an unthinkable tragedy shakes the community to its very core. (Read More)

Subgenre:
independent filmconspiracymelodrama
Themes:
dysfunctional familymurderrevengekidnappingmarriagejealousyangerdivorcepsychopathgriefrevenge murder
Mood:
gorerainnightdarkness
Locations:
barforestcemeterysmall townwoodscourtroomnew england
Characters:
husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorlove trianglesingle motherex husband ex wife relationshipolder woman younger man relationship
Period:
summer
Story:
dysfunctional marriageviolenceflashbackguncryingcorpseface slaplieheld at gunpointcleavagechildscantily clad femalemini skirtcollege studenttragic event β€¦death of sonclass differenceskillingcard gameattorneyconvenience storebarbecueinjusticebruiseabusive husbandphysical abusemini dressdisposing of a dead bodyshot in the eyelobstermaineoff screen murdermusic teacherchild's drawingsubarurevenge killingboston red soxmexican restaurantscene based on paintingevidence tamperingonly sonarchitecture studentprosecuting attorneytaking the law into one's own handsfemale slaps femaleschool choirgrieving familylobsteringsardine can (See All)

The Virgin Suicides (1999) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Virgin Suicides (1999)

A man about forty years of age tells the story from when he was a teenager in upscale suburban Detroit of his and three of his friends' fascination with the mysterious and doomed Lisbon sisters. In 1974, the sisters were seventeen year old Therese, sixteen year old Mary, fifteen year old Bonnie, fou β€¦rteen year old Lux, and thirteen year old Cecilia. Their fascination still remains as they try to piece together the entire story. The sisters were mysteries if only because of having a strict and overprotective upbringing by their father, who taught math at the girls' private co-ed school, and overly devout Catholic mother, who largely dictated the household rules. The story focuses primarily on two incidents and the resulting situations on the girls' lives. The first was an action by Cecilia to deal with her emotions over her life. And the second was the relationship between Lux - the sister who pushed the boundaries of the household rules most overtly in doing what most teenagers want to do - and Trip Fontaine, he who could have any girl he wanted but wanting solely Lux. (Read More)

Subgenre:
independent filmcult filmcoming of ageblack comedyteen moviecoming of age film
Themes:
mental illnessdepressiondeathsuicideinfidelitybetrayalghostjealousyadulterydrinkingescapedeceptionmemoryextramarital affairobsession β€¦unfaithfulnessunrequited lovefirst loveregret (See All)
Mood:
high school
Locations:
hospitalschoolswimming poolcemeterytaxischool dance
Characters:
husband wife relationshipfather son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerteenage girlteenage boyteacherdancerpriestsister sister relationshiplustpsychiatrist β€¦catholiccatholic priestgay fatherwriter directorself destructivenessdeath wishself inflicted injuryhomosexual father (See All)
Period:
1970ssummer
Story:
title directed by femalesexf ratedbased on novelflashbackkisscigarette smokingdancingsingingpartyvoice over narrationcryingsongdreamunderwear β€¦watching tvdrinkvomitingtearssunglassesmarijuananeighborhallucinationvoyeurclassroomprayertelephoneambulanceimpalementsuicide attemptdinnerchild abusegraveyardtalking to the cameravirginsuburbpop musicpoisonpassionstorytellinghangingdiarymanipulationtragic eventcrosssplit screenrock 'n' rollisolationdirectorial debutclassteenage sexrecord playerflirtingpot smokingloyaltyteen angstballoonloss of virginityrecordingcrucifixamerican footballwatching a moviemagazinemovie theatergossipgay parentflatulencehome movietennisvirginitypeeping tomgas masktelescopeunderage drinkingfootball playertheatre audiencecigarette lightertime lapse photographyaviationnotemelancholypromiscuityreflectionnews reportersexual awakeningteachingcannabishigh school teacherhomecomingpostcardfenceloss of daughterrepressiontombstonetween girltv reportersexual promiscuityinsomniarumorinfatuationpoisoninggeneration gapwrist slittingpopularityloss of childfootsie under the tablehearseprommichiganschoolteacherdown syndromequarantinebeltfootball teamlabor unionknittingenigmateen suicidefirst sexual experiencecocktailunicornfemale to male footsie playingabusive mothertennis courtasphyxiationsexual explorationtamponmental instabilitylabor strikemirror ballsleeping pillshigh school dancemodel airplanetv crewfootball stadiuminsulinsparklerfootball fieldlawn sprinklerpopsiclehouse arrestinnocence lostdebutantemorse codemass suicidelovesicksouvenirauditoriumhanged girlabused childrat poisonmentally challenged personchild suicidejumping off a rooffootball practiceoverprotective parentsuicide preventiondrugged foodpicket lineyale universitycarbon monoxide poisoninginsomniacgirls' bathroommathematics classmath teacherbrownie the foodprom dressschnappsgas stoveimpaled childstrict mothercataloguetalking to a plantemotional depressionhollyhomecoming dancereference to kiss the bandmaximum securityphotosynthesisdead child with eyes openreference to aerosmith the bandscotch tapemysteriousnesstwo on one footsie playingbaseball on tvelmiron fencemedicine overdosestrict parent (See All)

The Gift (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Gift (2000)

When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β€¦p her from constantly getting visions of Jessica's fate. (Read More)

Subgenre:
independent film
Themes:
mental illnessmurderdeathsuicideinfidelityghostjealousyadulteryinvestigationdeceptionincestextramarital affairdeath of fathersupernatural powerunfaithfulness β€¦father daughter incest (See All)
Mood:
rainnightmare
Locations:
schoolcemeterysmall townbathtubwaterwoodsrural settingwheelchaircourtroomstormbackwoods
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshiptattooboylawyersingle motherlustwitchsheriffsuicide by hanging
Story:
dysfunctional marriagetwo word titlefemale nudityf ratedbloodviolencefemale frontal nudityflashbackmasturbationmale rear nuditydogbare chested malegunfightdancing β€¦photographexplosionpartyleg spreadingpantiestelephone callfirebeatingdreamcorpsewatching tvthongbare buttsecretliedead bodysex standing uphallucinationhandcuffscleavagecandlestrangulationwomanwidowwhite pantieschild abusetrialscantily clad femaleritualunderwater scenesearchgraveyardgraveperson on fireliarmissing personbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upgrandmotherwhippingcult directorpsychictherapygarageheart attackgirl in pantiespickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sextherapistback from the deadchokingmechanicsexual desirecamera shot of feetredneckwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Ice Storm (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Ice Storm (1997)

In the weekend after thanksgiving 1973 the Hoods are skidding out of control. Benjamin Hood reels from drink to drink, trying not to think about his trouble at the office. His wife, Elena, is reading self help books and losing patience with her husband's lies. Their son, Paul, home for the holidays, β€¦ escapes to the city to pursue an alluring rich girl from his prep school. And young, budding nymphomaniac, Wendy Hood roams the neighborhood, innocently exploring liquor cabinets and lingerie drawers of her friends' parents, looking for something new. Then an ice storm hits, the worst in a century. Things get bad... (Read More)

Subgenre:
independent filmcoming of age
Themes:
dysfunctional familyfriendshipmarriageinfidelityreligionpoliticsadulterydrinkingdrunkennessextramarital affairdivorcedrug useguiltunfaithfulnesssexuality β€¦self abuse (See All)
Mood:
high schoolrainnight
Locations:
new york citytrainchurchswimming poolcarsnowbicyclekitchenstormsex in a car
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipfriendbrother brother relationshipboybrother sister relationshipteenage girlteenage boyteachergirlstudent β€¦french kiss (See All)
Period:
1970syear 1973
Story:
dysfunctional marriagesexbased on novelmasturbationbare chested malekisscigarette smokingtitle spoken by characterexplosionpartythree word titleshowertelephone callvoice over narration β€¦cryingunderwearwatching tvdrinkbooktearsbedmarijuanabathroomneighborclassroomprayermanhattan new york citybedroomwinebandfootballhousedinnerassassinationroommatejeansstrippingvirginkeysuburbelectrocutionreadingdeath of brothertragic eventdeath of sonsadnessclasssleepingteenage sexcouplerecord playericegolfdesiretape recordercomic bookrecordingamerican footballdrug abusemagazineaccidental deathrailway stationvirginitysocial commentaryembarrassmentshopliftingexplosiveministerburglarywhipsex talkfrustrationdead boyexistentialismliving roommarital problempajamasweatherpromiscuitythanksgivingrocketsexual awakeningbongswingerbicyclinggroup therapysexual promiscuityfascistpharmacyanarchynarcissismgeneration gapreverendupper classpsychiatric hospitalprivate schoolswingingreference to richard nixonhedonismpremature ejaculationopen marriagesaying gracewife swappingdrugstorepassing outturkey the birdsleeping pillmarital crisispassenger trainrainy nightice cubebrandywet dreambirth controlmodel airplanecocktail partyfirst amendmentcablegraceneglectinnocence lostpassed out drunkseminargrand central station manhattan new york citywaterbeddiving boardsmoking after sexvaliumreference to dostoyevskytromboneskylightyard salesexual experimentationpower linegeometryempty swimming poolmedicine cabinetsurrogate brothersexual revolutionspilled drinkcommuterschool bandaclureference to deep throathangman's noosewatergate scandalman wearing boxer shortsmarvel comicnixon maskparental neglectradio controlled toyreel to reel tape recorderreading a comic booksamoaelectric cableelectrocuted childice stormprecocious sexreference to the fantastic fourreference to fyodor dostoyevskyreference to jesus christ superstarsiliconsleetyoung republicankey partyreference to spiro agnewcranberry saucedrinking liquor from a bottlefacts of lifeice trayreference to philip rothsymbionese liberation army (See All)

Elephant (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Elephant (2003)

A day in the lives of a group of average teenage high school students. The film follows every character and shows their daily routines. However two of the students plan to do something that the student body won't forget.

Subgenre:
independent filmexperimental filmpunkteen movie
Themes:
murderdeathfriendshiprevengesuicidejealousyfeardrunkennessescapeangerbrutalitysadismbullyingphotographycruelty β€¦panicvengeance (See All)
Mood:
high school
Locations:
schoolcarschool shooting
Characters:
father son relationshipfriendboyfriend girlfriend relationshipboyteenage girlteenage boyteachergirlstudentphotographergay kissbullyteacher student relationship
Story:
animal in titlenuditybloodviolencedoggunphotographexplosionpistolshowertelephone callfireshot to deathblood splattercar accident β€¦shotgunwatching tvcamerashootingrifleheld at gunpointbombrunningmarijuanabathroompianoclassroomtelephonemassacrevideo cameraweaponnonlinear timelineman with glassesgunshotlibraryargumentscreaminglocker roomscreamactor shares first name with characterlong takegymhigh school studentlaptopkillingpot smokingstreetragetimepart of trilogyhomicidegirl with glassesexplosivethunderbackpackmercilessnessdiscussionstairsthunderstormhandheld cameraone dayclassmatepsychoticlaptop computerswastikaoutcasthigh school teachercar drivingcafeteriafirearmfemale teacherstaircaseadvicerestroomdrunk drivingconversationblackboardwalkingwarninghallwaydarkroomrunhigh school girlfrightbloodshedmultiple murderbaglunchdetentionbulimiascaregrudgedelivery manportland oregondisturbed individualcorridormultiple perspectivescity parkblond boycapfrisbeehigh school friendfemale studentmultiple homicidemass killingadolescent boyhigh school principalteenage angstadolescent girlhigh school boyschool lockerdeanmurderer duoschool libraryschool cafeteriafitting introubled teenage boylunchroomdisturbed personfur elisefemale classmatemultiple killingschool gymfirst time actor (See All)

He Got Game (1998) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

He Got Game (1998)

Tells the story of Jesus Shuttlesworth, the most sought after high school basketball prospect in the nation. Jesus and his dream to make it to the big ranks in professional basketball are overshadowed by his father, Jake, who is spending his life in prison for killing Jesus' mother.

Subgenre:
melodramabasketball movie
Themes:
murderdeathdrugsmoneyprisonlesbianismdeath of motherredemptiongreedabortionforgiveness
Mood:
high schoolsatire
Locations:
new york cityurban settingmotel
Characters:
father son relationshipfather daughter relationshipteenagerafrican americanboyfriend girlfriend relationshipbrother sister relationshipteenage boypolicemaninterracial relationshipcousin cousin relationshipuncle nephew relationshippimpaunt nephew relationship
Story:
roller coastersexfemale nudityviolencethreesomeflashbackinterracial sextitle spoken by characterthree word titlewritten by directorcollegeprostitutionreference to jesus christmanhattan new york citymenage a trois β€¦gay slurbasketballmontagenews reportracial slurfugitiveuniversitydomestic violenceconvertiblewigcharacter says i love youhateblack americanclaim in titleathletebrooklyn new york cityreconciliationplaygroundrejectionghettoinjusticeworld trade center manhattan new york citysneakerssports teamstereotypegovernorpeer pressurehugscholarshipfather son estrangementparolemerry go roundbasketball playerprison wardenfamily feudmale vomitingdomineering fatherwardenreference to mosescharacter appears on tvheadstonevisiting a graveparole officerred carconey island brooklyn new york cityconvicted felonatonementchildhood flashbackwatching news on tvhigh school basketballfather son hugreference to michael jordanknee injuryletter read aloudsigning an autographblonde wignational basketball associationbasketball coachcharacter appears on front page of a newspaperfamily violencefather daughter hugporn actor in mainstream moviesports agentwoman wearing a wigwatching self on tvrising starvisiting wife's graveatticaleaving flowers on a graveskittlesreference to kim novakreference to the new york knicksankle braceletone on one basketballalumnicollege recruitmentfather versus sonreference to samson and delilahreference to the parting of the red seafurloughgrilled cheese sandwichwide angle lenswig pulled offpress statementunwanted hug (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The King's Speech (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The King's Speech (2010)

England's Prince Albert must ascend the throne as 'King George VI' (qv), but he has a speech impediment. Knowing that the country needs her husband to be able to communicate effectively, Elizabeth hires Lionel Logue, an Australian actor and speech therapist, to help him overcome his stammer. An extr β€¦aordinary friendship develops between the two men, as Logue uses unconventional means to teach the monarch how to speak with confidence. (Read More)

Subgenre:
political drama
Themes:
deathfriendshipmarriagechristmasmoneydrinkingfeardivorcedeath of fatherfaithdyingdisabilityunlikely friendship
Mood:
rain
Locations:
snowairplanelondon englandelevatorenglandgermanychurch of england
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipfrienddoctorsingerbrother brother relationshipnursephotographerreference to godlittle girlaustralian β€¦americandoctor patient relationshipself confidence (See All)
Period:
world war two1930syear 1939
Story:
speechinterviewdogkisscigarette smokingdancingtitle spoken by charactersingingthree word titlebased on true storytelephone callpunctuation in titlecryingsongfood β€¦horsecameradrinksecretbookliebeertearsapostrophe in titlereference to jesus christprayertelephonef wordsubjective camerawinemontageeatingapologyno opening creditsradiokingcigar smokingprincessmarriage proposalparklimousinemicrophonefired from the jobumbrellaauditionstorytellingreadingchristmas treedeath of brothercrossprofanityreference to william shakespearetypewriterqueentrustprincestrong female characterrecord playereyeglassesapplauseteawhat happened to epiloguereference to adolf hitlerfriendship between menlistening to musicrecordingroyaltymale bondingfraudeccentricrehearsalservantclassical musiccrying mancompassionchokingpromisenicknamescotlandnewsreel footageanxietyheadphonescigarette lighterfogchoirbalconyhorse and carriagedivorceenannychauffeurhorseback ridingprime ministerunderdogceremonyearphonesdementiabarking doghandshakedefecationtreasonlooking out a windowmajorcomic reliefunited kingdom13 year oldteasinglistening to radiogreat depressiongiving a toastwhistlingchandelierbritaintitle in titlebritish soldiercowardnazismreference to shakespeare's hamletdistruststutteringmovie camerakiss on the cheekepilepsybiplanethroneflash cameratop hatphonographbromanceradio broadcastends with textscottishreference to josef stalintalking to oneselfportrait paintingreference to charles dickensmonarchymovie projectorempowermenthand kissingdead brotherwaltzkiltmodel airplanepneumoniawine cellarbbccoronationjoke tellingstuttertiarabritish royal familybritish empirecold the temperaturespeech impedimentmarblesignaturerocking horserepeated dialoguevoice recordingreference to shakespeare's othelloking of englandair raid sirenpre world war twoyear 1936archbishopcigarette casefountain penused car salesmanhelplessnessreference to australiabritish prime ministerreference to queen victoriabritish governmentdeath of kingprince of waleschivalryyear 1925air raid shelterbritish parliamenttherapist client relationshipstammeringabdicationpug dogyear 1934mumblingscenario which perverts factsdiaphragmreference to berlin germanyspeech therapiststamp collectiongarglingreference to shakespeare's twelfth nightprotocolspeech therapytongue twisterhandednesscongratulationsduke of windsorcorgiking george vireference to duchess of windsordeclaration of warhouse of windsorreference to neville chamberlainreference to pandora's boxbrewerreference to scotland yardshakespearean quoteshillingdecorumradio speecharchbishop of canterburybuckingham palace londondeath of teenage boyfelling a treemantle clockreference to geoffrey chaucerreference to new zealandvocal exercisebuilding model airplaneelocutionking edward viiiwestminster abbey (See All)

Happiness (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Happiness (1998)

A woman breaks up with her boyfriend, he thinks it's because he's fat. A man is unable to tell her next door neighbor he finds her sexually attractive. An old couple wants to split up, but they don't want to get a divorce. A therapist masturbates to teen magazines. An 11 year old kid is insecure abo β€¦ut the fact that he hasn't cum yet. Office workers try to recall the face of a coworker who recently died. A woman is sure she has everything she could ever want. The lives of these individuals intertwine as they go about their lives in their own unique ways, engaging in acts society as a whole might find disturbing in a desperate search for human connection. (Read More)

Subgenre:
independent filmcult filmblack comedy
Themes:
dysfunctional familysuicidemarriagerapedivorce
Mood:
satiresocial satire
Locations:
hospitalrestauranttaxielevatorkitchenapartmentofficetaxi driverschool bus
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipmother daughter relationshipboyteacherbabysister sister relationshiplittle boyrussian
Story:
dysfunctional marriagesexone word titleflashbackmasturbationdoggunkisscigarette smokingejaculationtitle spoken by charactersingingshowertelephone call β€¦cryingdreamunderwearshootingvomitingneighborguitardinnerchild abuseman with glasseschildcontroversyparkhotel roomcostumeprotestsuburbfantasy sequenceglassesdateneck breakingflowertherapysexual abuseice creammagazinetherapistrapistapartment buildingnew jerseyconvenience storeensemble castpedophilesunbathingmultiple storylinesandwichstorepedophiliaepisodic structurechild molestationstrikeboy with glassesunhappinessparentoverweightchild molestersiblingsmetromolestationchild rapeensemblecrime of passionshock humorserial rapistenglish teacherphone booklanguage learningdessertlynchiansibling relationshipthree sisterstunatelephone sexwoman murders a mandrugged foodpicket linesardonicsleep overlearning englishobscene telephone callrobot costumelanguage teaching (See All)

Little Miss Sunshine (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Little Miss Sunshine (2006)

In Albuquerque, Sheryl Hoover brings her suicidal brother Frank to the breast of her dysfunctional and emotionally bankrupted family. Frank is homosexual, an expert in Proust. He tried to commit suicide when he was rejected by his boyfriend and his great competitor became renowned and recognized as  β€¦number one in the field of Proust. Sheryl's husband Richard is unsuccessfully trying to sell his self-help and self-improvement technique using nine steps to reach success, but he is actually a complete loser. Her son Dwayne has taken a vow of silence as a follower of Nietzsche and aims to be a jet pilot. Dwayne's grandfather Edwin was sent away from the institution for elders (Sunset Manor) and is addicted in heroin. When her seven-year-old daughter Olive has a chance to dispute the Little Miss Sunshine pageant in Redondo Beach, California, the whole family travels together in their old Volkswagen Type 2 (Kombi) in a funny journey of hope of winning the talent contest and to make a dream come true. (Read More)

Subgenre:
independent filmcult filmblack comedy
Themes:
dysfunctional familydeathdrugsmoneydeath of fatherdrug usedrug addictionwriting
Mood:
social satireaffection
Locations:
hospitalbeachmotorcyclewheelchairroad tripmotelgas stationroad movienew mexico
Characters:
husband wife relationshipfather son relationshipfamily relationshipshomosexualpolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorsingerbrother sister relationshipteenage boyteacher β€¦dancersister sister relationshipwaitresshomosexualityteacher student relationshipuncle nephew relationshipgrandfather grandson relationshipuncle niece relationshipgrandfather granddaughter relationship (See All)
Story:
speechtitle directed by femalecigarette smokingdancingtitle spoken by charactersingingthree word titletelephone callcryingcell phonesongfoodmirrorwatching tvcomputer β€¦booktearsrunningdead bodyold mancaliforniaambulancewomandinerdrivingapologyno opening creditsjourneyvanargumentstrippingbusinessmanscreamingsuburbstripteasefired from the jobpay phoneon the roadreadingdirectorial debutheroingarageeyeglassesanswering machinequesthelmetice creamaudiencebikerremote controlinnocencesufferinghatredconvenience storemutemental hospitalpridearizonapierdressing roomreckless drivingirreverenceunderdogcar troubleporn magazinemake upparenthoodsarcasmlosertween girlpopcornbeauty pageantsuicidalauto mechanicfailurevolkswagenbechdel test passedtalent showcross countryroadtripbeggingwinnerdeath of grandfatherfreewaypackingoptimismfatbeauty contesthighway travelgraduate studentroad ragedirected by several directorsreference to friedrich nietzschegay pornographymotivational speakerpageantdrug snortingspeakerchild starvolkswagen buswar woundalbuquerque new mexicocross country tripfried chickenmagazine articledeadpanhospital waiting roomspritecar hornnotepadreference to marcel proustcolor blindhighway patrolmanvow of silencehair stylingmute boymaster of ceremonieseye testflight schooltalent auditionfreak outscottsdale arizonacrime scene cleanuppushing car (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Perks Of Being A Wallflower (2012) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Perks Of Being A Wallflower (2012)

Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr β€¦overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)

Subgenre:
coming of ageteen movieperiod film
Themes:
mental illnessdepressionfriendshipsuicidedrugschristmasjealousydrinkingfeardanceincestmemoryseductionlonelinessdrug use β€¦cancerguiltdatingpoetryabusebullyingunrequited lovehomophobiabreak updyingwritingcheatingfirst lovedying from cancerdeath of best friendsuicide of friend (See All)
Mood:
high school
Locations:
hospitalrestaurantchurchsnowtrucktunnelcatholic churchpennsylvaniaschool dancekitchen knife
Characters:
husband wife relationshipfather son relationshipfamily relationshipshomosexualmother son relationshipteenagerfriendboyfriend girlfriend relationshipdoctorsingerbrother brother relationshipboybrother sister relationshipteenage girl β€¦teenage boyteachergirlpolicemandancerphotographerwriterpriestbest friendreference to godgay kissbullylittle boyteacher student relationshippsychiatristcatholicgay teenagergay relationshipaunt nephew relationshipcatholic priestboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All)
Period:
1990syear 1991
Story:
based on novelflashbackkissfightdancingphotographsingingpartyknifetelephone callvoice over narrationcryingbeatingfood β€¦car accidentmirrorface slapslow motion scenepunched in the facewatching tvcamerawritten by directordrinkcondomsecretlettershootingbooktearsrunningbirthdaycafemarijuanabathroomcollegehallucinationreference to jesus christclassroomprayertelephonef wordsubjective cameragay slurbedroomwinecandledeath of friendeatingfootballsuicide attemptdinnerchild abusedrivingapologyracial slurpainflash forwardlibraryvirginreadingchristmas treecollege studentprankhigh school studentcheerleaderglassesrock 'n' rollsadnesssix word titleclassreference to william shakespearetypewritertrustteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualhuggingfireplacelooking at oneself in a mirrorlistening to musicsexual abuseice creamred dresshappinessamerican footballmovie theaterimpersonationnew year's evecrushvirginityclockpromisebuddhistmovie theatrenicknameinnocencepillssufferingmobile phonebackstagepunched in the stomachsexismkaraoketaking a picturemental hospitalfootball playertheatre audiencefirst kisschristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingothgraduation12 year oldshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingteenage lovefirst dateadolescencechild molestationblackoutlooking out a windowharmonicaponytailschool principallsd16 year old15 year oldstonedkiss on the lipsunhappinessgiving a toastveganhazingtutoreasterpromaudio cassettehouse partylip synchingcar radioteenage crushdance scene11 year oldwriting a letterabusive boyfriendwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausaspiring writerenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actreference to frank sinatracrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school dancehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glasseslast day of schoolenglish classfacial injuryprincipal's officeacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailmix tapewriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All)

All Good Things (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

All Good Things (2010)

A love story and murder mystery based on the most notorious unsolved murder case in New York history. The original screenplay uses newly discovered facts, court records and speculation as the foundation for a story of family, obsession, love and loss.

Themes:
mental illnessdepressionmurderdeathfriendshipsuicidemarriagemoneypregnancydrinkingfeardrunkennessweddingblackmaildrug use β€¦dyingabortionwealthmurder investigationsuicide of mother (See All)
Mood:
rain
Locations:
new york cityrestauranttrainswimming poollos angeles californiaparis franceboatbicycletaxielevatorapartmentcourtroomlakemotelchinese restaurant
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendsingerbrother brother relationshipboybrother sister relationshipgirlnursestudent β€¦dancerphotographerwriterlawyerjewishpsychiatristmaidjewmayorpregnant wifechinese foodbaby shower (See All)
Period:
1980s1970s2000syear 2000year 1982year 1972year 1971year 1978
Story:
dysfunctional marriagefemale nuditybloodviolenceflashbackdogbare chested malegunsex scenekisscigarette smokingdancingphotographsinging β€¦partythree word titlepantiesshowerbased on true storytelephone callcryingsongcorpseunderwearfoodmirrorurinationcameradrinkundressingsecretshootingtearssunglassesrunningdead bodyinterrogationcafemarijuanacollegeneighbormanhattan new york cityswimmingnewspaperwineold manvideo cameradisguisebridgeeatingcocainepoliticiansubwaydinnerjudgetrialbirthday partysearchmarriage proposalpay phoneumbrellasuitcasemissing persondomestic violencedisappearancewigsuspicionloss of mothercross dressingclass differencesdismembermenttrusttherapywashington d.c.record playerbirthday cakeeyeglassestv newsanswering machinepot smokingwhat happened to epiloguescene during opening creditsrecordingjoggingtherapistfloridaphone boothpress conferencehome movietennisladderapartment buildingyogatarget practiceshovelnovelisttime lapse photographyskiingtuxedopolice raidlooking at self in mirrorextortionbriefcasebriefsbruisedead motherlandlordabusive husbandphysical abusedead dogkilling a dogevictionmen's bathroomtrue crimesnorting cocainedouble lifemotel roomdrunk drivingreal estatetv reporterclimbing through a windowjuryself defensecredit carddistrict attorneyambassadorfamily businessmailboxunplanned pregnancyheirbased on true eventstimes square manhattan new york cityvolkswagencollectorreading a newspaperrealtorcircular staircasedistrustbronx new york citytoy gunspray paintwanted posterpeep holeu.s. senatorpackinghigh societydomineering fathervolkswagen beetleends with biographical notesbandanaswimming in underweartelephone numberwomen's bathroomtalking to selfponyshort shortsanswering machine messagevermontwashing disheslong island new yorkwife abuseempire state building manhattan new york citysnoopingliving togetherfemale judgemedical schoolcrossdressermissing womanman dressed as a womanmissing person posterhummingnew york city skylinehome movie footageabortion clinicoffice buildingoxygen tankbludgeoned to deathtwo in a showerunsolved murderswing setunsolved crimetrust funddead body in a car trunkjumping off a rooffile cabinetparent grown child relationshipwrong side of the trackscollege graduationmissing wifefacial bruisegraduation partyrich man poor womandestroying property42nd street manhattan new york cityfacial injuryhack sawplumbingeye dropslatenessbuying a houseelevator operatorman wearing tidy whitiesfemale district attorneytestifying in courtledgerwife beatingalbany new yorkdismembering a dead bodygalveston texasprimal screamspitting out foodvenetian blindsthrowing a chairwestchester new yorkhusband suspected of murdering his wifesuspicion of murdertelephone off hookpretending to be muteporno movie theatreshiksau.s. capitol building washington d.c.health food storeheir to fortunerent collectortaking off a woman's panties (See All)

Shortbus (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Shortbus (2006)

Numerous New York City dwellers come to the exclusive club Shortbus to work out problems in their sexual relationships. Rob and Sophia are a happily married couple, except for the fact that she has never experienced sexual climax. This irony follows her to work because she is a couples counselor who β€¦ frequently has to deal with the sexual issues other couples have. Two of her patients are Jamie and James, a gay couple who have been monogamous for five years and counting. James wants to bring other men in to the relationship, and his own history with depression may hint at an ulterior motive. Ceth (pronounced Seth) may be the perfect addition to their family, but Caleb, a voyeur from across the street, may have his own ideas about that. Sophia visits Severin, a dominatrix with secrets of her own to reveal. (Read More)

Subgenre:
independent filmvideo
Themes:
depressionmarriageinfidelityvoyeurismlonelinessgay love
Locations:
hospitalnew york citybeachswimming poolbathtubsex in car
Characters:
homosexualgay sexgay threesome
Story:
puppetfemale nudityone word titlefemale frontal nuditymale frontal nuditymasturbationmale rear nuditysex sceneejaculationtitle spoken by character β€¦singingerectionurinationface slapvibratorneighbororgymale pubic hairguitarmenage a troisbisexualcandlevideo cameracontroversydrowningtransvestitedrag queensadomasochismbrooklyn new york citys&mmale prostituteremote controlattempted suicideanimated sequenceunsimulated sexhustlerexhibitionismqueer cinemaswingerpolaroidinterracial marriageveganstatue of liberty new york citysex clubhome videolifeguardfilm starts with sexcamera phonerescue from drowningswingerspower failurependantacrobatic sexdrink thrown into someone's facesex positivealbinospin the bottlemonogamyfake orgasmground zeromarriage counselingagnosticcouples therapyauto fellatiocardiopulmonary resuscitationcircumcised penissensory deprivationstorage facilitywriting on someonemasturbation with a vibratorzoloftfemale masturbation in publicproofreadermale to male blow job (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Beautiful Creatures (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Beautiful Creatures (2013)

Teenager Ethan Wate is obsessed with his urge to finish high school and go on to college in order to leave the small town of Gatlin, South Carolina behind, until a mysterious girl begins to inhabit his dreams. When he meets Lena Duchannes, a newcomer who has just enrolled in his school, Ethan knows  β€¦she is the girl in his dreams. Lena is rejected by the rest of her classmates for being the niece of Macon Ravenwood, whom the town's superstitious residents consider to be a devil-worshiper. But Ethan gives her a ride anyway and they fall in love. Lena reveals to her new boyfriend that she is a witch, and that on her sixteenth birthday she will be claimed by either the forces of light or of darkness. She will remain in the light, but only if she does not remain in love with Ethan. To make matters worse, her evil mother, Sarafine, is casting spells to push Lena to the dark side. Ethan joins her in a search to find a magic spell to save their doomed love. Will the lovers succeed? (Read More)

Subgenre:
coming of ageblack comedysuspenseconspiracysupernaturalmelodrama
Themes:
dysfunctional familyfriendshipsurrealismchristmasbetrayalfeardrunkennessescapedeceptionmagicseductionangersupernatural powerparanoiapoetry β€¦unrequited loveamnesiaself sacrificenear death experiencebook of magic (See All)
Mood:
high schoolrainnightmarecar chaseambiguous endingbittersweet
Locations:
churchforestsnowcemeterysmall townboatwoodsfarmcampfirestormsinging in a car
Characters:
family relationshipsmother son relationshipteenagermother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipteenage boypriestsister sister relationshipchristianwitchcousin cousin relationshipmayorpolice chase β€¦grandmother granddaughter relationshipuncle niece relationshipaunt niece relationshipaunt nephew relationship (See All)
Period:
2010s
Story:
speechtwo word titlebased on novelflashbackbare chested malekissphotographexplosionsurprise endingfirevoice over narrationcell phonedreamhorsecar accident β€¦shot in the chesturinationrescuewritten by directorbattlebookriflesunglassesbirthdaypianodemongood versus evilorphandisguisemansionmontagemapfalse accusationno opening creditsdrawingdouble crossvoice overfemme fataletransformationlibrarycursecharacter repeating someone else's dialoguepossessionrace against timeknocked outlightningmanipulationscarhigh school studentsuspicionsacrificebattlefielddestinyteen angstbulletlooking at oneself in a mirrorcatfightjoggingloss of loved onemovie theatervillainessgossipmind controlforbidden lovefatepreacherfull moonreverse footagevisionhatredbroken glasslove at first sighthypnosisswampthrown through a windowaccidental killinglonercaneclassmateeye patchpassionate kissdemonic possessionstadiumplaying pianotelekinesismoral dilemmasouthern accentceremonyillusionoutcasthigh school teacherteenage lovespiral staircaseworld dominationmegalomaniactornadogreenhousepremonitioncookiehypnotismamerican civil warjockguardianstar crossed loversreference to googlesubterraneanreclusecar rolloverforce fieldglowing eyeslocketmagic spellstarts with narrationhit by a trainloss of memorymedallionsouth carolinacliquebritish actor playing american charactertalismanhigh school principalgrand pianobased on young adult novelwalking in the raindeath of uncleteenage romancesketchbookbenefactorerased memoryrecurring dreamweather manipulationflipping carshape shiftingmeet cuteshared dreamsiren the creatureseerreference to jane austenreference to the titanicbuilding firestanding in the rainplanetary alignmentcivil war reenactmentreference to charles bukowskireference to kurt vonnegutmacaroonpolice car rollover (See All)

A Royal Affair (2012) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Royal Affair (2012)

In 1767, the British Princess Caroline is betrothed to the mad King Christian VII of Denmark, but her life with the erratic monarch in the oppressive country becomes an isolating misery. However, Christian soon gains a fast companion with the German Dr. Johann Struensee, a quietly idealistic man of  β€¦the Enlightenment. As the only one who can influence the King, Struensee is able to begin sweeping enlightened reforms of Denmark through Christian even as Caroline falls for the doctor. However, their secret affair proves a tragic mistake that their conservative enemies use to their advantage in a conflict that threatens to claim more than just the lovers as their victims. (Read More)

Subgenre:
conspiracyperiod dramaperiod piececostume drama
Themes:
mental illnessdepressionlovemarriageinfidelityreligionbetrayalpoliticsadulteryprisonpregnancyfeartorturedanceextramarital affair β€¦drug useinsanityhumiliationillnessexecutiondyingrevolution (See All)
Mood:
rain
Locations:
beachchurchsnowbathtubenglandgermanybrothelsex in public
Characters:
husband wife relationshipfamily relationshipsmother son relationshipdoctorprostituteteenage boypriestlove trianglereference to godlittle boymaidfrenchcrying babystepmother stepson relationshipin love
Period:
18th century1700s
Story:
dysfunctional marriagefemale nudityf ratednuditybloodflashbackmasturbationdogbare chested malesex scenekissfemale rear nuditydancingbased on true storyvoice over narration β€¦cryingbeatingcorpsehorsemirrorface slapslow motion scenearrestundressingbare buttlettervomitingtearsdead bodydecapitationspygay slurcandleeatingnarrationbathkingflash forwardconfessionprotestfired from the jobhairy chestcrosschildbirthhorse ridingreference to william shakespearequeenlooking at oneself in a mirrorroyaltydemonstrationdenmarkservantmobrebellioncrying mantorchfatestreet lifepromisecensorshiparranged marriageintrigueunfaithful wifehistoricaltheatre audiencedead manvoice over letterprison celllanternpublic humiliationpassionate kisshorse and carriageholding handspalaceimprisonmenthorseback ridingdanish royal familybeheadingunhappy marriagepeasanthit in the facephysiciantreasonstepmotheridealismrumorstage play16 year oldfencingbare chested boycopenhagen denmarkillegitimate childsexual repressionenlightenmentcoup d'etataristocracyradicalsecret loveends with biographical notesstagecoachroyal familytortured to deathpuppet showcoupmasqueradecouncildanish historytalking to a doggreat danespitting on someonepublic executionmarital rapecopenhagenreformsmallpoxdestroying propertymarriage as hellreference to voltairevaccination1770slady in waitingmasked ballmasquerade partywoman in a bathfree thinkerringing a bellreference to jean jacques rousseaureference to king arthur1760sman in bathdanish politicsgovernment ministerpolitical reformmarriage troubleinoculationtalking to a horsemale male embracedowagerfancy dress party (See All)

Rebel Without A Cause (1955)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rebel Without A Cause (1955)

Jim Stark is the new kid in town. He has been in trouble elsewhere; that's why his family has had to move before. Here he hopes to find the love he doesn't get from his middle-class family. Though he finds some of this in his relation with Judy, and a form of it in both Plato's adulation and Ray's r β€¦eal concern for him, Jim must still prove himself to his peers in switchblade knife fights and "chickie" games in which cars race toward a seaside cliff. (Read More)

Subgenre:
cult filmcoming of ageteen moviecoming of age film
Themes:
dysfunctional familydeathlovefriendshipmarriagedrinkingfeardrunkennessangerlonelinessterrorismfalling in love
Mood:
high school
Locations:
carlos angeles californiapolice stationcar explosionnew school
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipchildrenbrother sister relationshipteenage girl β€¦teenage boystudentpolicemanbest friendpsychiatristmaidgay teenagergrandmother grandson relationshipself destructiveness (See All)
Period:
1950s
Story:
dysfunctional marriagebloodviolencebare chested malegunkissfightcigarette smokingchasetelephone callcryingshootoutfoodcar accidentmirror β€¦shot in the chestface slapdrinkshootinglietearsrunningbirthdaybathroompianocandlegangambulancemansiondeath of friendeatingdrivingapologyanti herocigar smokingpainjeansliarmistaken identityconvertibleamerican flagpursuitchickensleepingcult directortrustblack americanrunawayteen angstbreaking and enteringwoundhappinesstoyhidingladderhonorend of the worldmilkbreakfastchokingrole playingpromiseswitchbladetelescopeshoesstarcynicismunderage drinkinggunshot woundpsychotronicabsent fatherhawaiiknife fightblood on shirtyoung loveclifflonerhousekeeperdead boyjuvenile delinquentalienationchainpajamasshamet shirthandshakerunning awaystairwayname callingabandonmentpeer pressureanimal abusejacketgeneration gapunhappinesseasterconsciencegurneycar radiohiding placetormentanguishtoy gunhomosexual subtextjuvenile delinquencypeep holeabsent motherpolice sirenmotor scootercheckknife held to throatsurrogate fathertauntingwater hosedrinking from the bottlefalling asleepcandelabradelinquentjumping from a carreference to platogay subtextteen drinkingdrag racingpeanut butterstar died before releasedrive in classichummingknife woundfield tripcold the temperatureschool lockerbullhorndiving boardhot rodblack leather jacketcar falling off a cliffpolice radiocomboverprotective parentplanetariumsurroundedempty swimming poolupside down viewlistening to a car radiochild supportwind up toygreasersleeping in a chaircombing hairhenpecked husbandheadlightsdriving off a cliffcompactjuvenile hallthrowing water on someonelifesaveraddress bookturnstilejuviepretending to be marriedtoy monkeyfood traygriffith park observatory los angeleschicken racehands held over headimitating a chickenjuvenile detention officernazi reference (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Royal Tenenbaums (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Royal Tenenbaums (2001)

Three grown prodigies, all with a unique genius of some kind, and their mother are staying at the family household. Their father, Royal had left them long ago, and comes back to make things right with his family.

Subgenre:
independent filmcomedy of manners
Themes:
dysfunctional familydepressiondeathfriendshipmarriagelesbianismweddingfuneralartincestextramarital affairracismdivorcedeath of fatherredemption β€¦grieftheatrechildhooddrug addictionwealth (See All)
Locations:
hospitalnew york cityswimming poolhotelcemeterybathtubtaxiurban settingpolice car
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshippolice officernursepriestlawyerartistlittle girlinterracial relationship β€¦professorgrandfather grandson relationshiptalking to oneself in a mirror (See All)
Story:
sexcharacter name in titlebloodinterviewflashbackdogcigarette smokingphotographknifelesbian kissthree word titlepantiesvoice over narrationcar accidentslow motion scene β€¦watching tvcameracar crashfoot chasebranew yorkambulancejudgeman with glassesbirdcoffinchild in perilgravemassagetentskeletonactor shares first name with characterratcharacter says i love youballetheart attackrecord playerterminal illnessprivate detectivefalling down stairskilling an animaltape recordercowboy hatmousestabbed in the stomachloss of wifeservantbrother sister incesttennisforbidden loveinterracial romanceface paintshopliftingreconciliationsevered fingerattempted suicidepet dogtitle appears in writingnovelisttheatre audiencemedical examinationmedicationthrown through a windowblood on shirtmarital separationnervous breakdownplaysirengeniusmusic bandplaying cardsfiremanbisexualityaccountantmental breakdownfamily reunionphysicianreference to the beatlesclimbing through a windowplaywrightboy with glassesstage playinterracial kissballerinawrist slittingfinger cut offrazor bladewriter's blockbankruptcyshot in the handcruise shipdarkroomarcheologistboard gamechapter headingsestrangementadopted daughterdogfightracial stereotypeestranged fatherfinancechild prodigyeast indianphonograph recordbandaged handpainted facereference to the rolling stonestennis playerdelinquentfire enginefalconluxury hotelknife woundclergyshaving headextended familydalmatianfrat packfake illnesswar paintchequedeadpanneurologistdrug referencebb guntennis matchestranged family memberdeadbeat dadchild smoking a cigaretteelevator operatorhigh blood pressuremescalinebook coverplaying doctorstomach cancerex assassinliterary narrationfire drilltent indoorsrunning in traffic (See All)

Sophie Scholl: The Final Days (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sophie Scholl: The Final Days (2005)

The Final Days is the true story of Germany's most famous anti-Nazi heroine brought to life. Sophie Scholl is the fearless activist of the underground student resistance group, The White Rose. Using historical records of her incarceration, the film re-creates the last six days of Sophie Scholl's lif β€¦e: a journey from arrest to interrogation, trial and sentence in 1943 Munich. Unwavering in her convictions and loyalty to her comrades, her cross-examination by the Gestapo quickly escalates into a searing test of wills as Scholl delivers a passionate call to freedom and personal responsibility that is both haunting and timeless. (Read More)

Subgenre:
suspense
Themes:
mental illnessdepressionlovefriendshipbetrayalpoliticsprisontortureheroinvestigationtheftpsychopathterrorismguiltfaith β€¦executionfreedomwritingjusticecourage (See All)
Mood:
tearjerker
Locations:
snowbicyclecourtroomnazi germany
Characters:
father son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipchildrensingerbrother sister relationshipfemale protagonistnursestudentpoliceman β€¦photographerpriestlawyersister sister relationshipthiefjewcatholicgermanmayorgerman soldiernazi soldier (See All)
Period:
world war two1940syear 1943
Story:
speechf ratedcharacter name in titlebloodguncigarette smokingsingingpistolbased on true storytelephone callcryingsongdreammirrorcamera β€¦arrestundressingletterlietearsinterrogationjailhandcuffsreference to jesus christprayerdecapitationwineprisonerjudgetrialsearchcoffeeconfessionscreamingliarsuitcasestatueuniversitycourtcrosswitnesstypewriterrecord playertwenty somethinghuggingundergroundsabotageloyaltyreference to adolf hitlerheroinelistening to musiclawjail cellcrucifixmorguecommunisthonorjanitoranti semitismministerresistancehatredpeacehistoricalrosevoice over letterprison cellsuspectinjusticeactivistatheistrevolutionarybeheadinglaundryswastikastaircasetreasonidealismyoung womandeath rowmaildeath penaltymedical studentconscienceprosecutorcampusnazismatheismmartyrair raidrisksecret policeresistance fighterfreedom of speechflash cameratop hatguillotinegestapoletter writingmunich germanynazi uniformwomen's bathroomprotestantverdictdying youngdutyflyerprinting presspityart studioeternitynazi flagmanifestoblessingstampcopy machineheil hitleri.d.air raid sirencigarette casewhite rosedefamationleg amputationanti nazilutheranwoman killedleafletnational socialismunderground resistanceends with real life photospostage stamplavatoryracial hatredindictmentsharing a cigarettesummonsanti nazismnazi resistancecommissarnational socialistnon violent resistancewoman heroinepsychotic depressioncounselpassive resistanceration cardremand prisondemoralizationmimeograph machinenazi lawprison ministry (See All)

Greenberg (2010) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Greenberg (2010)

We like Florence: she's considerate, sweet, pretty, and terrific with kids and dogs. She's twenty-five, personal assistant to an L.A. family that's off on vacation. Her boss's brother comes in from New York City, fresh from a stay at an asylum, to take care of the house. He's Roger, a forty-year-old β€¦ carpenter, gone from L.A. for fifteen years. He arrives, doesn't drive, and needs Florence's help, especially with the family's dog. He's also connecting with former band-mates - two men and one woman with whom he has a history. He over-analyzes, has a short fuse, and doesn't laugh at himself easily. As he navigates past and present, he's his own saboteur. And what of Florence? is Roger one more responsibility for her or something else? (Read More)

Subgenre:
independent film
Themes:
mental illnessdepressiondeathfriendshipdrugsjealousypregnancydrinkingdrunkennessmemoryangerdeath of motherdrug useabortion
Mood:
rain
Locations:
hospitalnew york citybarrestaurantswimming poollos angeles californiataxikitchenaustraliamotelusa
Characters:
husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensingerbrother brother relationshipnursemusiciansister sister relationshipjewishbest friendlittle girl β€¦little boypsychiatristjewaustralianolder man younger woman relationshipex boyfriend ex girlfriend relationshipuncle niece relationshipaunt niece relationshipself deprecationhalf jewish (See All)
Story:
puppetsexfemale nuditycharacter name in titleone word titledogbare chested malesex scenekisscigarette smokingphotographtitle spoken by charactersinging β€¦partypantiestelephone callcell phonesongunderwearsex on couchfoodwatching tvcomputerdrinkundressingbare buttletterbeerbirthdaybedcafemarijuanabathroomguitarmanhattan new york cityalcoholsubjective cameraswimmingnewspaperbracandlebandcaliforniadeath of friendmontageeatingcocainedrivingapologypantyhosepainmicrophonechampagnestorytellingvacationsuitcaseloss of mothertwenty somethingeyeglassesapplausewaiteranswering machinefemale stockinged legspot smokingbeer drinkingheavy rainfriendship between menlistening to musicguitaristtoyhollywood californiaone night standbrooklyn new york citygrocery storecouchitalian americanshoppinganxietymental hospitalmedicationvoice over lettermarital separationsongwriterbarbecuenervous breakdownloss of brotherage differencefemale stockinged feetinterrupted sexpetnotebookparalysisbirthday presentveterinarianmen's bathroomgerman shepherdsnorting cocainegardenerhospital roomnarcissismassistantgeneration gapcdpool partycleaning ladyreading a newspapercarpenterfully clothed sexunwanted pregnancywriting a letterundressing someonehappy birthday to youloss of familyneuroticbrazilianpackingsurname as titlepanic attackcheckforty somethingletter writingorthodox jewfrisbeedrugstorehamsterpersonal assistantapple computerwaiting roommisanthropevoice mailpinatagrocery shoppingprescriptioncd playerabortion clinicstuffed animal toywalking a dograiny dayrat poisondead ratcar rentalnew york timesrulerdry cleanersdoghousefemale stockinged solesreference to lindsay lohandry cleaningmarital reconciliationhouse sitterpregnancy scarelong distance callwind up toyrecord contractreference to myspacehousesittingvicodinreference to starbuckssmogfeeding a dogkid artreference to gustav mahlersoaking wetreference to ac dcreference to charlie sheensick dogpatterned pantyhosezoloftcleaning a swimming poolinability to swimnoise pollutionreference to michael bloombergauto immune disorderbushwick brooklyn new york cityreference to the great gatsbyreference to american airlines (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Short Cuts (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Short Cuts (1993)

While helicopters overhead spray against a Medfly infestation a group of Los Angeles lives intersect, some casually, some to more lasting effect. Whilst they go out to concerts and jazz clubs and even have their pools cleaned, they also lie, drink, and cheat. Death itself seems never to be far away, β€¦ even on a fishing trip. (Read More)

Subgenre:
independent film
Themes:
murderfriendshipsuicidemarriageinfidelityrapejealousyadulterydrinkingdrunkennessincestextramarital affairdrug usecancerredemption β€¦unfaithfulnessalcoholismrape and murder (See All)
Locations:
hospitalbarswimming poolhelicoptermotorcyclelos angeles californianightclubbicycleurban settingcity
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfrienddoctorsingerpolicemanmusicianbabysister sister relationship β€¦artistwaitresslustsnipergrandfather grandson relationshipfishermanbakerdeath of boy (See All)
Story:
dysfunctional marriagepuppetsexfemale nuditybloodmale nudityfemale frontal nuditymale frontal nuditydogbare chested malefemale rear nudityfemale full frontal nuditycigarette smokingejaculation β€¦photographpartypantieslabiatelephone callcryingcorpseunderwearcar accidenturinationwatching tvcameradrinksex in bedbare buttsecretvomitingliebeertearsbirthdaylingeriedead bodymarijuanarivercleavagebandconcertcaliforniabasketballfemale pubic hairfishwhite pantieschildpainterscantily clad femalefishinghit by a carcontroversycoffeeskinny dippinglimousinepilotblack pantiesclownbased on short storyproduct placementbaseball batfemale removes her clothesdeath of sonreunionobscene finger gesturecheating wifejazzsurgerychainsawbirthday cakeno pantiesvandalismloss of loved onepicnicapartment buildingearthquakedrug overdoseunfaithful wifetheatre audienceensemble castaquariumpanties pulled downsalesmansongwriterenvironmentalismalarm clocklingerie slipmelancholychauffeurcoffee shophit and runadulterous wifeharassmentmultiple storylinemagic tricklaundrybreast feedingmake upepisodic structuretrailer homephone sexredheaded womangoldfishstethoscopebakerycellotrailer parkcoincidenceburlesquenaked dead womanquarantinemotorcycle copironingtoy gunfreewaypanties hit the floorcellistbudweiserfather in law daughter in law relationshipconcussionbottomlessbig citycmnfmakeup artistsnoopinggrandfather clocksouthern californiafly fishingwoman in a towelbludgeoned to deathdestruction of propertycovered female frontal nudityfemales talking about sexjazz scorepool cleanerred pubic hairprank telephone callstepsister stepsister relationshipjazz combocarbon monoxide poisoningdiaper changepatrolmansmothered to deathhouse sitterobscene telephone callwatching a cartoon on tvmusical quartettraffic copdouchehousesittingdeath of grandsonintersectionblood clottraffic ticketchildren's partysmelling fingercutting handstripscratching one's butt (See All)

Mcfarland, Usa (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mcfarland, Usa (2015)

A struggling coach and teacher who has had to move around for different incidents in his career finally comes to one of the poorest cities in America: McFarland, California. There he discovers buried potential in several high school boys and slowly turns them into championship runners and brings the β€¦m closer than even he could ever imagine. (Read More)

Mood:
high school
Locations:
school
Characters:
father son relationshipfamily relationshipsfather daughter relationshipteacherstudenthispanic
Period:
1980s
Story:
title directed by femalef ratedone word titlebased on true storyplace name in titlerunningcaliforniabirthday partycoachathletewhat happened to epiloguecountry name in titleunderdogsports teamschool life β€¦ends with biographical notestrack and fieldcountry in titletown name in titlefarm workercoachingcross country runningrunning racestate championshiplatino community (See All)

White Oleander (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

White Oleander (2002)

Astrid Magnussen is a 15 year old girl, living in California. Her mother, Ingrid, is a beautiful, free-spirited poet. Their life, though unusual, is satisfying until one day, a man named Barry Kolker (that her mother refers to at first as "The goat man") comes into their lives, and Ingrid falls madl β€¦y in love with him, only to have her heart broken, and her life ruined. For revenge, Ingrid murders Barry with the deadly poison of her favourite flower: The White Oleander. She is sent to prison for life, and Astrid has to go through foster home after foster home. Throughout nearly a decade she experiences forbidden love, religion, near-death experiences, drugs, starvation, and how it feels to be loved. But throughout these years, she keeps in touch with her mother via letters to prison. And while Ingrid's gift is to give Astrid the power to survive, Astrid's gift is to teach her Mother about love. (Read More)

Subgenre:
coming of agemelodramapunk
Themes:
dysfunctional familymurderlovefriendshipsuicideinfidelitychristmasmoneyjealousyadulteryprisonpregnancydrinkingdrunkennessextramarital affair β€¦angerdivorcelonelinessdeath of motherparanoiaredemptionunfaithfulnessgamblingevilcrueltywealthfirst love (See All)
Mood:
high schoolnightmare
Locations:
beachrestaurantschoolswimming poollos angeles californiabuscourtroomrooftopmexicoschool busforest fire
Characters:
husband wife relationshipfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshiptattoosingerboybrother sister relationshipteenage girlprostitute β€¦teenage boyteacherpolice officerphotographerlawyerartistchristianactressreference to godsingle motherbibleolder man younger woman relationshiprussianreligious fanatic (See All)
Story:
roller coastertwo word titlesexbased on novelbloodviolenceinterviewflashbackgunkissfightcigarette smokingphotographparty β€¦pantiesfirevoice over narrationcryingdreamunderwearwatching tvcomputerdrinkarrestthongsecretlettershootingpaintingbeertearscafejailhandcuffsreference to jesus christclassroomcolor in titlerevolvershot in the backswimmingbrawinecaliforniaambulancecocainenonlinear timelinechild abusejudgetrialpainterdrawinggunshotflash forwardpoisonrabbitcourtmanipulationcrosspremarital sexreunionflowerclassheroinchessrunawayteen angstcomic bookjoggingvideotapecompassiontowelmilkdrug overdosehaircutprison guardwindbraveryconstruction sitehypocrisyministerhatredjunkiebible quoteamusement parkwomen's prisonabsent fatherbarbecuejuvenile delinquenthysteriajewelrycartoon on tvtestimonyconstruction workerbaptismmakeoverpolaroiddomineering motherparamedic15 year oldadult actress playing teenage girlreverendpalm treebullet woundprison visithonestycarpentersex with a minorsalvationaccusationastrologycheckcollageeggsjail breakborderline personality disorderrearview mirrorfoster childsnowglobefoster homeart classnova scotiatrailer trashdrug rehabilitationfoster familybad motherjuvenile detentionfoster parentwashing handsinnocence lostjuicetopless dancingbible studyflea marketwatercolorpepsi colameteor showercomic book artcomic book shoppoker the card gameart showsocial servicesgarbage collectorpoor white trashchild carefeng shuigreyhound busfdawomen's studiesbarrenesschristmas pageantnarcissistic personality disordersound of sexborn againfoster parentingfalling starmurder of loverjuvenile hallhanging mobilegirls' dormitoryjesus freaksanta monica pierflip flops the shoesairbrushdeath by drug overdose (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Tideland (2005) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tideland (2005)

Pre-teen Jeliza-Rose's parents are hopeless drug addicts. When pa, rocker Noah, finds ma's OD'd, he fears to be charged with homicide and takes Jeliza along to his ma's place, in a desolate country region. With Noah passed out, the girl mentally transfers to a fantasy world she and her doll heads en β€¦ter magically. Jeliza's adventures also star the crazy locals, notably Dell, and Dell's grown but intellectually disabled brother Dickens. (Read More)

Subgenre:
independent filmcult filmfairy taledark fantasybased on fairy talemodern fairy tale
Themes:
mental illnessdysfunctional familydeathsurrealismpregnancydrinkingfearlonelinessdeath of fathersupernatural powerdeath of motherdrug useinsanityabusedeath of wife
Mood:
nightmareavant garde
Locations:
bartrainbusrural settingkitchenfarmsubmarineschool bus
Characters:
family relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerboybrother sister relationshipgirlmusicianreference to godgrandmother granddaughter relationshipfrench kiss
Story:
puppetsexbased on novelbloodflashbackkisscigarette smokingphotographexplosionsingingknifefiresongbeating β€¦dreamcorpsefoodmirrorurinationdrinksecretfalling from heightpaintingbookvomitingriflesunglassesrunningbeddead bodypianohallucinationprayerguitarswimmingorphanflashlightbandstabbingeatingrock bandchild in perilritualunderwater scenevoice overtreedrug addictscreamingfantasy sequencestorytellingsuitcasedollreadingrabbitdomestic violencescarwigcrossrock 'n' rollisolationloss of fatherloss of mothersleepingcult directorheroinheart attackflirtingpickup truckhypodermic needletalking animalfaintingguitaristdenmarkdrug abuseeccentricflatulencesharkskullfalse identitypeeping tomdrug overdoseimaginationrock concertinnocenceshoeswhipjunkiemakeupdynamiteatticlipstickshadowalternate realitywedding dressfamily dinnerlanternfieldpumpkinshaved headbrainsouthern accentminingface maskdinner partymummynecrophiliapedophiliastuffed animalold dark houseeyedead fathermental retardationabandoned housebeebugfarmhousetween girlsquirrelimaginary friendwhisperinglistening to a radioelectric guitaranttrain trackstrain ridepieseizurecleaningfart jokerock musicianheroin addictaltarman childepilepsyclose up of eyedelivery boyalice in wonderlandwingspillow fightchildhood sweetheartrocking chairwagondutch anglecar wreckdecomposing bodymirror ballpassenger traintreasure chestapplying makeuptaxidermylemonademousetrapprairiefireflygrave diggerpinatapeanut buttershooting uplobotomyspider webcandy bardissectiontrain wreckpretendinggeesechild neglectphalluswatchingapple piereference to alice in wonderlanddesecrationembalmingdeath by overdosetrain derailmentwonderlandtransistor radioexploding trainfeather boajutlandtalking dollreference to barbie the dollscrubbingalonenessplaying dress upshotgun shellurinating on the groundburritodead treementally handicapped personrabbit holebroken dollpillow feathersspasticdoll's headribcagehead scarlightning bugcrushed skullfalling off a bedswim fins (See All)

Pretty In Pink (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pretty In Pink (1986)

Teenager Andie is one of the not-so-popular girls in high school. She usually hangs out with her friends Iona or Duckie. Duckie has always had a crush on her, but now she has met a new guy at school, Blane. He's one of the rich and popular guys but can the two worlds meet?

Subgenre:
independent filmcult filmcoming of ageteen movieteen romanceteen comedy
Themes:
dysfunctional familyfriendshipdrinkingdrunkennessdanceangerpovertydatingunrequited lovefashionwealthfirst love
Mood:
high school
Locations:
trainschoolnightclubschool teacherschool dance
Characters:
father daughter relationshipteenagerboyfriend girlfriend relationshipsingerteenage girlteenage boystudentmusicianlustteacher student relationshipchinesesingle father
Period:
1980s
Story:
kissdancingphotographsingingthree word titlepantiescryingunderwearfistfightblondewatching tvcomputertearsmarijuanacolor in title β€¦cleavagebrarock bandwhite pantieslibraryargumentmicrophoneconvertiblegymhigh school studentclass differencesredheadrecord playergirl in pantieseyeglassesnerdtraditionanswering machineteen angstdresstitle based on songcrushforbidden lovepet dogshoppingposterplaying cardscartoon on tvteenage lovelockeralarmbicyclingmaking outvolleyballlistening to radiogeneration gapteenage daughterpromaudio cassettehouse partysewing machinedesignerhigh school girlopposites attracthomeworkreference to madonnasuitorrecord storemusic storedance contestsnobphonograph recorddevotionreference to karl marxhigh school danceslumber partyyearbookhigh school boynylonsrich snobwashroomteenage romancehalljuvenilehigh school promteen lovereference to franklin d. rooseveltunderageparty dressbrat packwrong side of the tracksrich man poor womanshy girlschool yearbookrailroad tracksreference to david lettermanmusic albumhigh school sweetheartsprom dressbreasts growingsocial consciousnessreference to tina turnertwo suitorspreppiesingle dadreference to lionel richieshermer illinois (See All)

The Past (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Past (2013)

Coming back to accomplish the divorce procedure, Ahmad an Iranian man, arrives in Paris after four years to meet his ex-wife and her daughters from her previous marriage. He notices his ex is in a relationship with an Arab named Samir who also has a son and a wife in a coma. The relationship of the  β€¦older daughter and her mother is in deterioration because the daughter thinks her mother is the cause of Samir's wife comatose state. The affairs get more complicated when the older daughter discloses something heinous she has done. (Read More)

Themes:
dysfunctional familydepressionlovefriendshiprevengesuicidemarriageinfidelityadulterypregnancyfearmemoryextramarital affairdivorceguilt β€¦unfaithfulnesschildhood trauma (See All)
Mood:
rain
Locations:
hospitalrestaurantparis franceairportshed
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother daughter relationshipfrienddoctorboyteenage girlgirllove trianglesingle mothermotherfrenchemployer employee relationshipdaughter β€¦ex husband ex wife relationshiplove letterstepfather stepdaughter relationshipasking for forgivenessmother and daughter (See All)
Period:
year 2012
Story:
two word titlecigarette smokingphotographchasetelephone callcell phonefoodurinationface slapsecretlietearsrunningtelephonef word β€¦cookingeatingsuicide attemptsubwayjudgeapologyprologueliarsuitcaselong takepursuitgiftcomairanpromisesufferingattempted suicidepaste mailcellphonemarital separationhandshakesubway stationlooking out a windowlaundromathospital bed16 year oldpharmacyiranianbunk bedperfumesuicidal thoughtstoothbrushremarriagepharmacistdoorbellpretending to be someone elsehair dryersidewalk cafeclotheslinescratchhalf brother half sister relationshipoverhearing a conversationdry cleanersstrained relationshiprunaway teendry cleaningpainting a wallwanting to diepost partum depressionsearch for truthmaking a bedlocking a doorwrist bandageabsent husbandillegal workertelephone hangupdivorce settlementcutting one's fingersearching for the truthkicking a doormother and daughter share a bedpostpartum depressionspilled paintiranian expatriatereference to brussels belgiumwitnessing a suicidedaughter dislikes mother's boyfriendscratching oneself (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cat On A Hot Tin Roof (1958)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cat On A Hot Tin Roof (1958)

The family of "Big Daddy" Pollitt convenes at his and Big Momma's vast 28,000 acre East Mississippi plantation for his sixty-fifth birthday, although it may as well be for his funeral on the belief that he is dying. Despite his latest medical report being clean, in reality he truly does have termina β€¦l colon cancer, something the doctor only tells Big Daddy's two sons, Gooper Pollitt, a lawyer, and Brick Pollitt, who recently left his job as a sportscaster. Brooding Brick and his wife Maggie Pollitt, who have driven up from New Orleans for the occasion, are going through a long rough patch in their marriage. Brick wanted to split, but Maggie convinced him to stay married on the condition that she not pressure him for sex. In their troubles, Brick has turned to the bottle, leading to a drunken incident which has left Brick currently on crutches. Maggie believes Gooper and his wife Mae Pollitt are trying to orchestrate Brick out of Big Daddy's will. Brick and Maggie's saving grace is Big Daddy has greater affinity for them than Gooper and Mae. Maggie is beautiful and Brick was a star athlete, specifically in football and track. As Gooper and Mae have a sixth child on the way, Maggie also believes they could combat anything Gooper and Mae could do by having a child of their own. In his current state, Brick has contempt for everyone and everything around him, which includes Big Daddy's money. All Brick and Maggie's problems seem to center on their respective relationships with Bric… (Read More)

Subgenre:
gay interest
Themes:
dysfunctional familydepressionfriendshipmarriagejealousypregnancydrunkennessseductionobsessioncanceralcoholismgreedwealthinheritance
Locations:
airportstorm
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipdoctorchildrenbrother brother relationshiplawyerlittle girllittle boyalcoholichomosexualitymaiduncle nephew relationshipuncle niece relationship β€¦aunt niece relationshipaunt nephew relationshipmother in law daughter in law relationshiptrying to get pregnant (See All)
Story:
dysfunctional marriagebare chested malesingingpartybased on playliebirthdaymansionfootballbirthday partycontroversyargumentsuitcaseconvertible β€¦basementterminal illnessbirthday cakefemale stockinged legsloyaltydestructionathletehypodermic needledrugcakehatice creamdiseaseloss of friendamerican footballwhiskeynicknamereconciliationgrandfatherfootball playerthunderstormone dayrainstormthirty somethingcellarfamily secretlingerie slipman cryingreflectionunhappy marriagelast will and testamentcrutchespiano playingsouthern u.s.drunk drivingchangemarriage problemsdocumentsexual frustrationfootball teammorphinetoy gunhomosexual subtexttycoonmississippimemphis tennesseedomineering fatherfather in law daughter in law relationshipcigarpatriarchfamily gatheringcrutchgay subtextnylon stockingssouthern gothicoverbearing fatherterminal cancergrandchilddrinking problemfaked pregnancysouthern bellebroken anklewanting a babydressing gownleg in a castconceptionprivate planelove hatemarital reconciliationplaster casthero worshipsports announcerex football playerremoving nylon stockinghurdleshomosexual jockpretending to be pregnantcorporate lawyerathletic fieldpregnancy issuewoman takes off stockingfather and son talkfood thrown into someone's face (See All)

We Need To Talk About Kevin (2011) is one of the best movies like The Beaver (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

We Need To Talk About Kevin (2011)

Eva Khatchadourian is trying to piece together her life following the "incident". Once a successful travel writer, she is forced to take whatever job comes her way, which of late is as a clerk in a travel agency. She lives a solitary life as people who know about her situation openly shun her, even  β€¦to the point of violent actions toward her. She, in turn, fosters that solitary life because of the incident, the aftermath of which has turned her into a meek and scared woman. That incident involved her son Kevin Khatchadourian, who is now approaching his eighteenth birthday. Eva and Kevin have always had a troubled relationship, even when he was an infant. Whatever troubles he saw, Franklin, Eva's complacent husband, just attributed it to Kevin being a typical boy. The incident may be seen by both Kevin and Eva as his ultimate act in defiance against his mother. (Read More)

Themes:
mental illnessdysfunctional familymurderdeathchristmasjealousyprisonpregnancydrinkingangerpsychopathparanoiaguiltinsanitycruelty β€¦death of daughtermurder of husbandmurder of daughter (See All)
Mood:
high schoolrain
Locations:
hospitalnew york cityrestauranttrainschoolwheelchairpolice carschool shootingoffice party
Characters:
husband wife relationshipfather son relationshipfamily relationshipsmother son relationshipfather daughter relationshipmother daughter relationshipdoctorsingerboybrother sister relationshipteenage boygirlpolicemandancerbaby β€¦little girllittle boycrying babyself referentialbaby boytravel writer (See All)
Period:
christmas party
Story:
title directed by femalefemale nudityf ratedcharacter name in titlebased on novelbloodviolenceflashbackmasturbationbare chested malekissdancingphotograph β€¦singingpartytelephone callcryingsongfoodmirrorurinationface slapwatching tvcomputerdrinkpaintingbookvomitinglietearssunglassesrunninghandcuffstelephonef wordsubjective camerahalloweenbrawinenew yorkname in titlemassacrebasketballeatingmapnonlinear timelinedinnerapologysearchflash forwardauthorsuburbliarumbrellareadingchristmas treehalloween costumescargymamerican flagtragic eventchildbirthdeath of husbandmurdererhugginganswering machineclaim in titlesupermarketbow and arrowkilling an animalballoonmass murderegglooking at oneself in a mirrorcakelistening to musicsociopathmonologuecaught having sexvandalismhidingflatulencemobcovered in bloodpromisejanitorgrocery storeprison guardtarget practicepillsthundercrossbowjob interviewsex talkballmedicationeye patchbroken armalienationkilling spreearrowpajamasholding handsmotherhoodvideo tapeearphonesnew jobsandwichtriple f ratedchristmas presentstuffed animaldefecationpaintreading aloudname callinglooking out a windowshot with an arrowvacuum cleaner17 year oldarcheryanimal crueltyknocking on a door15 year oldstretcherreference to donald trumppatricideantcdplaying a video gamerazor bladeprison visittomatostation wagoninmatetitle same as bookfirst person titlesick childin medias resironingtargetvideo gameextreme close upnude photographarm slingevil childchristmas decorationstoddlerhamstercomputer viruscerealnew househandicapped personlawn mowerdoctor's officereference to led zeppelindiapermedia frenzyoxygen maskbaby carriageostracismtrick or treatheartbeatincarcerationlawn sprinklerstubbornnessglass eyelittle sisterman carrying a womannew homeloosely based on real eventsphotocopierbelief in the afterlifecomputer discprecociousnessmementocountingminiature golfreference to robin hoodbelief in hellguinea pigjackhammerbarkingcopy machinecrayondefiancetravel agencyhead held underwatername tagsororicideparceltravel agentprozacreflection in eyeeye bandagethe color redgarbage disposalkissing in the rainreading to a childwindshield wiperarm in a castmother son estrangementkitchen sinkbody searchscrubbing a floorson kills fatherkilled with an arrowmissing petplaying with foodmiscommunicationheredityjellyxylophoneintellectual disability slurroot beergarlandreference to buddy hollyseeing parents have sexincommunicabilitykilling a pethand slapredecoratingscrambled eggvenetian blindsbroken eggdeer antlersjingle bellsloss of eyepainting a roompaint guntetherballbicycle lockbrother kills sisterdestructivenesspeanut butter and jelly sandwichbreaking a lockcalling 911potty trainingred painteternal damnationnail bitingq tiptoilet trainingdirty diaperstuffed toy dogegg shellmarital estrangementstubborn child (See All)

Young Adult (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Young Adult (2011)

Thirty-seven year old Mavis Gary seems incapable of happiness. She has had one failed marriage with no romance in her immediate horizon. She ghosts writes a young adult series of books, which has just been canceled due to low sales. She is in the process of writing the last book, with which she is h β€¦aving a mental block. She lives vicariously through Kendall Strickland, the teenaged female heroine in her books, as like Kendall she believes her high school years were the best years of her life when she was the prom queen. When she receives news that her high school beau, Buddy Slade, and his wife, Beth Slade, have just had their first child, Mavis takes it as a sign that she and Buddy are meant to be together. As such, she devises a false pretense to travel from her Minneapolis home back her her old hometown of Mercury, Minnesota to reclaim Buddy from Beth. As Mavis slyly or not so slyly does whatever she can to hang out with Buddy, even in Beth's company if need be, she also runs into another old high school colleague named Matt Freehauf. She barely remembers Matt until she is reminded that he was the "hate crime" kid i.e. he was beaten almost to death by the school jocks who believed he was gay (which he is not), which has left him among other things needing to walk with a brace. Matt ends up being Mavis' drinking buddy and confidante, Matt, in turn, who tries to be Mavis' voice of reason to get her out of her delusional state about Buddy and get a grip on reclaiming her life… (Read More)

Subgenre:
tragicomedy
Themes:
mental illnessdepressionfriendshipmarriagejealousypregnancydrinkingdrunkennessmemorydivorceself harm
Mood:
high school
Locations:
barrestaurantforestcarsmall towntaxiwoodswheelchairmotelsinging in a car
Characters:
husband wife relationshipfamily relationshipshomosexualmother son relationshipfather daughter relationshipmother daughter relationshipfriendsingerbrother sister relationshipbabywritersingle motherlittle boyalcoholic β€¦cousin cousin relationshipex husband ex wife relationshipex boyfriend ex girlfriend relationshipgrandmother granddaughter relationshipaunt niece relationshipbaby girlself hatredself delusion (See All)
Story:
two word titlefemale nudityf ratedfacialfemale frontal nuditydogsex scenekissphotographsingingpartypanties β€¦telephone callvoice over narrationsongbeatingcar accidentmirrorwatching tvcomputerdrinkundressingbookliesunglassesbedcafeguitarf wordgay slurwinebandmontagedinerpantyhosecoffeeprologueon the roadsuitcasestalkingreunionsleepinggarageeavesdroppingwaiterhuggingfemale stockinged legslistening to musicbabysitterice creamhappinessfollowing someoneapartment buildingboxer shortsdrummermakeupbookstorelipsticke mailcellphonebalconycaneclassmatelooking at self in mirrorbrushing teethreckless drivingmiscarriageparking lott shirtfemale stockinged feetdrumsbeing followedgay bashinghomecomingmetaphorreal estatesexual promiscuitymaking outtape recordingdepartment storecredit cardenvyfoot closeupnarcissismhate crimeunhappinesscrippleguitar playerspitbeauty saloncrowbartequilasuntan pantyhoseminnesotareturning homerock climbingdonuthometownborderline personality disorderoverheard conversationcrutchfrench friesaction figureminneapolis minnesotabreast milkpityweldernude pantyhoseschool lockerchildren's bookmementoemotional breakdownmanicurechild's bedroomarrested developmentbaby bottlephone messagemorning afterpedicurecar damagedrum setmini cooperdog urinationbookkeeperhigh school sweetheartex classmatefemale drummerspecial needs childblack socksmale feet in socksspilling a drinkwedding photographgay straight relationshipbaby nurseryreal estate brokerall girl bandreference to kentucky fried chickenfemale bandfingernail polishwoman getting dressedbuying clothesclose up of feetmotel desk clerk37 year oldaction toybookstore clerkspilled winereference to ben and jerry's (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to The Beaver?
<< FIND THEM HERE! >>