Please wait - finding best movies...
Subgenre: | suspenseblack comedyindependent film |
Themes: | bullyinggriefdeath of motherblackmaildeath of fatherpsychopathdeceptionbetrayaldeathmurderfriendshiprevenge |
Mood: | car chasehigh school |
Locations: | fire truckfarmrural settingsmall townrestaurantbar |
Characters: | military policeex soldierwaitressbullytough guyteenage boybrother sister relationshipboyfriend girlfriend relationshipafrican americanfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationships β¦teenager (See All) |
Story: | halloween partyhalloween decorationbully comeuppancebeer keghalloween costumebar fightface spattered with bloodfalse accusation of murderbashing someone's head into a wallcosmopolitan the drinkhit with a pool cuecrawling on the floorchained doorunderground parking garagehead on collision β¦bloody footprinthomemade haunted house attractionhall of mirrorsneo 80s360 degree well shotman wearing a toweldrink thrown into someone's facepumpkin carvingbritish actor playing american character20 year oldhigh school principalclotheslineshot through a wallrunning for your lifehundred dollar billwoman wearing black lingeriebalisongprotective malestrobe lightjob promotionbreaking a bottle over someone's headdog tagescaped mental patientquarryvillain not really dead cliche555 phone numberjack o'lanternman with no nameoverhead camera shothiding under a beddetentionexperiment gone wrongshot in the footcrashing through a windowscarecrowcdmedalarms dealermajorframed for murdershot in the neckvillain played by lead actorhomagemysterious manmazeshot through a windowbeing followedharassmentberettafirefighterkilling spreebruisetitle at the endjumping through a windowcellphoneassault riflepost traumatic stress disorderstabbed in the legspecial forcesstabbed in the neckunderage drinkingbloody nosestealing a carfaked deathguestbroken legfalse identityfollowing someonestrangernosebleedjoggingelectronic music scorepot smokinggrenadepickup trucknewspaper headlinekissing while having sexdeath of soncharacter says i love youdeath of brothermercenarypremarital sexsuspicionlaptophigh school studentshot in the shouldercharacter repeating someone else's dialoguestabbed in the backone against manyshot in the foreheadbartendershot in the legdouble crossone man armyno opening creditsstabbed in the cheststabbed to deathdeath of frienddinerthroat slittingdrug dealerambulancestrangulationflashlightgay slursubjective camerahalloweenshot in the backf wordrevolverclassroommarijuanacar crashbeerbrawlarrestwatching tvpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingwoman on topshootoutfirepistolsurprise endingknifepartyexplosionphotographcigarette smokingbare chested malebare breastssex scenekissbloodviolence (See All) |
Subgenre: | suspenseblack comedy |
Themes: | deceptionbetrayalmurderdeathrevenge |
Mood: | car chase |
Locations: | fire truckrestaurantbar |
Characters: | tough guybrother sister relationshipafrican american |
Story: | hall of mirrorsshot through a wallshot in the footcrashing through a windowarms dealershot in the neckshot through a windowbruisestabbed in the legstabbed in the neckstealing a carshot in the shouldercharacter repeating someone else's dialoguestabbed in the backone against many β¦shot in the foreheadshot in the legdouble crossone man armyno opening creditsstabbed in the cheststabbed to deaththroat slittingstrangulationshot in the backf wordcar crashbrawlpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpseshootoutfirepistolsurprise endingknifepartyexplosionphotographcigarette smokingbloodviolence (See All) |
Professional Brooklyn hitman Jimmy Conlon is more commonly known as THE GRAVEDIGGER. Jimmy was a mob hit-man, who was best friends with his boss Sean Maguire. But when Jimmy's son, Michael, is marked for death by the mob, Jimmy must go up against Sean to protect Michael at all costs. Together, he an β¦d Michael must avoid corrupt cops, contract killers and the mob to survive the night. (Read More)
Subgenre: | independent film |
Themes: | death of fatherdeathmurderrevenge |
Mood: | car chase |
Locations: | restaurantbar |
Characters: | brother sister relationshipmother daughter relationshiphusband wife relationshipfather son relationshipfamily relationships |
Story: | shot through a wallcrashing through a windowframed for murdershot in the neckshot through a windowstabbed in the legstabbed in the neckstealing a carbroken legfollowing someoneelectronic music scorenewspaper headlinedeath of sonshot in the shouldercharacter repeating someone else's dialogue β¦stabbed in the backone against manyshot in the foreheadone man armyno opening creditsstabbed to deathdeath of frienddinerdrug dealershot in the backf wordrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolknifeexplosionphotographcigarette smokingbloodviolence (See All) |
A down and out cynical detective teams up with a down and out ex-quarterback to try and solve a murder case involving a pro football team and a politician.
Subgenre: | suspenseblack comedy |
Themes: | blackmailpsychopathdeceptionbetrayalrevengedeathmurderfriendship |
Mood: | car chase |
Locations: | fire truckbar |
Characters: | bullytough guyboyfriend girlfriend relationshipafrican americanfather daughter relationshipmother daughter relationshiphusband wife relationshipteenager |
Story: | bully comeuppanceshot in the footframed for murderharassmentfirefighterassault riflestabbed in the legbloody nosestealing a carshot in the shouldercharacter repeating someone else's dialogueone against manyshot in the foreheadbartendershot in the leg β¦double crossone man armydeath of friendgay slurshot in the backf wordrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographcigarette smokingbare chested malebare breastsviolenceblood (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | death of motherpsychopathbetrayalrevengedeathmurderfriendship |
Mood: | high school |
Locations: | small town |
Characters: | teenage boybrother sister relationshipboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipfamily relationshipsteenager |
Story: | high school principalbreaking a bottle over someone's headvillain not really dead clicheframed for murderhomagejumping through a windowstabbed in the legunderage drinkingstealing a carfaked deathpremarital sexsuspicionhigh school studentshot in the shoulderstabbed in the back β¦shot in the foreheadno opening creditsstabbed in the cheststabbed to deathdeath of friendthroat slittingambulanceflashlightsubjective cameraf wordcar crashbeerarrestwatching tvpunched in the faceslow motion sceneshot in the headshot in the chestblood splattershot to deathcorpsefirepistolsurprise endingknifepartycigarette smokingbare chested maleviolenceblood (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
Subgenre: | suspenseblack comedyindependent film |
Themes: | psychopathdeceptionbetrayalfriendshiprevengemurderdeath |
Mood: | car chase |
Locations: | farmsmall townbar |
Characters: | waitressbrother sister relationshipfather daughter relationshipfather son relationshipfamily relationshipsteenager |
Story: | bar fightbalisongshot through a windowjumping through a windowstealing a carstrangerelectronic music scorepickup truckshot in the foreheadbartendershot in the legdouble crossstabbed in the cheststabbed to deathdiner β¦throat slittingstrangulationflashlightshot in the backf wordrevolverbeerbrawlwatching tvpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosioncigarette smokingbare chested maleviolencekissblood (See All) |
Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing, β¦to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)
Subgenre: | black comedyindependent film |
Themes: | death of fatherpsychopathdeceptionbetrayalfriendshiprevengedeathmurder |
Mood: | car chase |
Locations: | fire truckbar |
Characters: | tough guyteenage boybrother sister relationshipboyfriend girlfriend relationshipfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsteenager |
Story: | bar fightshot in the neckshot through a windowfirefighterkilling spreejumping through a windowassault riflebroken legfollowing someoneelectronic music scoredeath of sondeath of brothershot in the shouldercharacter repeating someone else's dialogueone against many β¦shot in the foreheadshot in the legdouble crossone man armydeath of friendambulancestrangulationflashlightsubjective camerashot in the backrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingpartyexplosionphotographbare chested maleviolenceblood (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to β¦ survive the night in Los Angeles. (Read More)
Subgenre: | suspense |
Themes: | death of fatherpsychopathdeceptionrevengemurderdeath |
Characters: | waitresstough guyboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationship |
Story: | man with no namearms dealerassault riflestealing a cardeath of sonmercenarylaptopshot in the shouldercharacter repeating someone else's dialogueshot in the foreheadshot in the legno opening creditsstabbed in the cheststabbed to deathambulance β¦shot in the backf wordrevolvercar crashslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutfirepistolsurprise endingknifeexplosionphotographbare chested malebloodviolence (See All) |
When drug violence worsens on the USA Mexico border, the FBI sends an idealistic agent, Kate Macer (Emily Blunt) on a mission to eradicate a drug cartel responsible for a bomb that had killed members of her team.
Subgenre: | suspenseindependent film |
Themes: | blackmaildeceptionbetrayalrevengemurderfriendshipdeath |
Locations: | bar |
Characters: | tough guyafrican americanhusband wife relationshipfather son relationship |
Story: | british actor playing american charactermysterious mantitle at the endassault riflespecial forceselectronic music scoredeath of sonmercenarysuspicionlaptopshot in the shouldercharacter repeating someone else's dialogueshot in the foreheadshot in the legdouble cross β¦no opening creditsstabbed to deaththroat slittingstrangulationsubjective camerashot in the backf wordbeerarrestpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutpistolsurprise endingknifeexplosionphotographcigarette smokingbare chested maleviolence (See All) |
Subgenre: | black comedy |
Themes: | deceptionbetrayalrevengemurderdeath |
Mood: | car chase |
Locations: | fire truckrestaurant |
Characters: | ex soldierwaitresstough guy |
Story: | crashing through a windowarms dealermajorshot through a windowjumping through a windowspecial forcesstealing a carnewspaper headlinemercenaryone against manyone man armyno opening creditsdinerdrug dealerambulance β¦flashlightrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunmachine gunfistfightbeatingshootoutpistolsurprise endingknifeexplosionphotographcigarette smokingbare chested maleviolence (See All) |
Phil Broker is a former DEA agent who has gone through a crisis after his actions against a biker gang went horribly wrong and it cost the life of his bosses son. He is recently widowed and is left with a 9 year old daughter, Maddy. He decides to quit the turbulent and demanding life of thrill for M β¦addy's sake and retires to a small town. His daughter fights off a boy who is bullying her at school, and this sets in motion a round of events that end in his direct confrontation with the local Meth drug lord. His past history with the biker gang also enters the arena, making matters more complex. But he has a mission in his mind to protect his daughter and he is ready to pay any cost that it demands. (Read More)
Themes: | bullyingdeceptionrevengemurderdeath |
Mood: | car chase |
Locations: | fire trucksmall townbar |
Characters: | bullytough guybrother sister relationshipfather daughter relationshiphusband wife relationshipmother son relationship |
Story: | bully comeuppancerunning for your lifetitle at the endbloody nosestealing a carbroken legnosebleeddeath of soncharacter repeating someone else's dialogueone against manyshot in the foreheadshot in the legone man armystabbed in the cheststabbed to death β¦dinerdrug dealerambulancestrangulationshot in the backf wordrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathbeatingshootoutfirepistolsurprise endingknifeexplosioncigarette smokingviolenceblood (See All) |
Ray Breslin is the world's foremost authority on structural security. After analyzing every high security prison and learning a vast array of survival skills so he can design escape-proof prisons, his skills are put to the test. He's framed and incarcerated in a master prison he designed himself. He β¦ needs to escape and find the person who put him behind bars. (Read More)
Subgenre: | black comedy |
Themes: | deceptionbetrayalmurderfriendshiprevengedeath |
Locations: | fire truck |
Characters: | tough guyfather daughter relationship |
Story: | shot through a windowfirefighterassault riflestabbed in the legfalse identitymercenaryshot in the shouldercharacter repeating someone else's dialogueshot in the foreheadshot in the legdouble crossone man armyno opening creditsstabbed in the cheststrangulation β¦flashlightgay slursubjective camerashot in the backf wordbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosioncigarette smokingbare chested maleviolenceblood (See All) |
This urban nightmare chronicles several days in the life of Caine Lawson, following his high-school graduation, as he attempts to escape his violent existence in the projects of Watts, CA.
Subgenre: | black comedyindependent film |
Themes: | death of motherdeath of fatherpsychopathbetrayalrevengefriendshipdeathmurder |
Mood: | high school |
Characters: | boyfriend girlfriend relationshipafrican americanhusband wife relationshipmother son relationshipfamily relationshipsteenager |
Story: | underage drinkingstealing a carpremarital sexhigh school studentshot in the shouldercharacter repeating someone else's dialogueno opening creditsdeath of frienddrug dealerflashlightgay slurshot in the backf wordrevolverbeer β¦brawlarrestwatching tvpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathbeatingshootoutpistolsurprise endingknifepartycigarette smokingbare chested maleviolenceblood (See All) |
When a gang of masked, ax-wielding murderers descend upon the Davison family reunion, the hapless victims seem trapped... until an unlikely guest of the family proves to be the most talented killer of all.
Subgenre: | black comedy |
Themes: | death of motherdeath of fatherpsychopathdeceptionmurderdeath |
Characters: | brother sister relationshipboyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | woman wearing black lingeriehiding under a bedcrashing through a windowshot through a windowtitle at the endjumping through a windowstabbed in the neckguestdeath of brothershot in the shouldercharacter repeating someone else's dialoguestabbed in the backshot in the foreheadno opening creditsstabbed in the chest β¦stabbed to deaththroat slittingflashlightshot in the backpunched in the faceslow motion sceneblood splattershot to deathcorpsesurprise endingknifecigarette smokingbare chested malebare breastsviolence (See All) |
Subgenre: | suspenseblack comedyindependent film |
Themes: | death of fatherdeceptionbetrayalfriendshipmurderrevengedeath |
Locations: | bar |
Characters: | tough guyboyfriend girlfriend relationshipfather daughter relationshipteenager |
Story: | shot in the neckshot through a windowassault riflestealing a carpickup truckshot in the shouldershot in the foreheadbartendershot in the legdouble crossone man armyno opening creditsdeath of frienddinerdrug dealer β¦subjective camerashot in the backf wordrevolverbrawlarrestwatching tvpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathbeatingshootoutpistolsurprise endingknifepartyexplosionphotographbare chested malebloodviolence (See All) |
Subgenre: | suspenseindependent film |
Themes: | deceptionbetrayalrevengemurderdeath |
Mood: | car chase |
Locations: | farm |
Characters: | boyfriend girlfriend relationship |
Story: | british actor playing american characterexperiment gone wrongkilling spreestabbed in the neckstealing a carjoggingelectronic music scoresuspicionlaptopshot in the shouldercharacter repeating someone else's dialoguestabbed in the backshot in the foreheaddouble crossstabbed in the chest β¦stabbed to deathdeath of frienddinerstrangulationshot in the backf wordbrawlpunched in the faceshot in the headshot in the chestblood splatterfistfightcorpsebeatingpistolsurprise endingknifebare chested maleviolenceblood (See All) |
In TRIPLE 9, a crew of dirty cops are blackmailed by the Russian mob to execute a virtually impossible heist. The only way to pull it off is to manufacture a 999, police code for "officer down". Their plan is turned upside down when the unsuspecting rookie they set up to die foils the attack, trigge β¦ring a breakneck, action-packed finale filled with double-crosses, greed and revenge. (Read More)
Subgenre: | suspenseindependent film |
Themes: | blackmaildeceptionbetrayalfriendshipmurderrevengedeath |
Locations: | fire truckrestaurantbar |
Characters: | ex soldierboyfriend girlfriend relationshipafrican americanhusband wife relationshipfather son relationshipmother son relationshipfamily relationships |
Story: | british actor playing american charactershot in the neckshot through a windowfirefighterassault rifleelectronic music scorepot smokinggrenadenewspaper headlinedeath of brothersuspicionlaptopshot in the foreheaddouble crossdeath of friend β¦drug dealerambulanceflashlightf wordrevolvercar crashbrawlarrestpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingknifepartyexplosionphotographcigarette smokingbare chested malebare breastsviolenceblood (See All) |
An extremely wealthy man, dying from cancer, undergoes a radical medical procedure that transfers his consciousness into the body of a healthy young man. But all is not as it seems when he starts to uncover the mystery of the body's origin and the organization that will kill to protect its cause.
Subgenre: | black comedyindependent film |
Themes: | deceptionbetrayalmurderdeathfriendshiprevenge |
Mood: | car chase |
Locations: | fire truckrestaurantbar |
Characters: | ex soldierfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationship |
Story: | british actor playing american charactertitle at the endstealing a carfaked deathnewspaper headlinemercenarypremarital sexlaptopcharacter repeating someone else's dialogueone against manyshot in the legdouble crossno opening creditsdinerambulance β¦flashlightsubjective camerarevolvercar crashbrawlpunched in the faceslow motion sceneshot in the headshotgunshot in the chestblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionphotographbare chested maleviolence (See All) |
An elite DEA team raids the safe house of a drug cartel and hide $10 million in the plumbing. When they go back to retrieve the money it is not there. The team is under investigation for the missing $10 million. Then after a couple months the investigation is lifted. The team trains together again a β¦nd then celebrates at a strip club. Then one of the team is murdered. He wakes up in his RV on railroad tracks. Then a second team member is nailed to the ceiling. The third team member is gunned down at his remote cabin. There is a female City of Atlanta investigator in charge of the murders. After investigating the cartel angle, the twisted truth comes to light. (Read More)
Subgenre: | independent film |
Themes: | deceptionbetrayaldeathfriendshipmurderrevenge |
Mood: | car chase |
Locations: | bar |
Characters: | ex soldiertough guyhusband wife relationship |
Story: | shot through a wallshot in the neckshot through a windowassault riflestealing a carcharacter says i love yoususpicionshot in the shouldercharacter repeating someone else's dialogueshot in the foreheadshot in the legdouble crossno opening creditsstabbed in the cheststabbed to death β¦death of friendthroat slittingshot in the backf wordrevolvercar crashpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutpistolsurprise endingknifepartyexplosionphotographcigarette smokingbare chested malebloodviolence (See All) |
In The Equalizer, Denzel Washington plays McCall, a man who believes he has put his mysterious past behind him and dedicated himself to beginning a new, quiet life. But when McCall meets Teri (Chloe Grace Moretz), a young girl under the control of ultra-violent Russian gangsters, he can't stand idly β¦ by - he has to help her. Armed with hidden skills that allow him to serve vengeance against anyone who would brutalize the helpless, McCall comes out of his self-imposed retirement and finds his desire for justice reawakened. If someone has a problem, if the odds are stacked against them, if they have nowhere else to turn, McCall will help. He is The Equalizer. (Read More)
Subgenre: | suspense |
Themes: | deceptionmurderdeath |
Locations: | restaurantbar |
Characters: | ex soldiertough guyafrican american |
Story: | bar fightshot in the neckmysterious mantitle at the endassault riflestabbed in the necklaptopshot in the shouldercharacter repeating someone else's dialoguestabbed in the backone against manyshot in the foreheadshot in the legone man armyno opening credits β¦stabbed in the cheststabbed to deathdinerthroat slittingstrangulationsubjective camerashot in the backf wordrevolverbrawlarrestpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolknifeexplosionphotographbare chested maleviolenceblood (See All) |
In an America wracked by crime and overcrowded prisons, the government has sanctioned an annual 12-hour period in which any and all criminal activity-including murder-becomes legal. The police can't be called. Hospitals suspend help. It's one night when the citizenry regulates itself without thought β¦ of punishment. On this night plagued by violence and an epidemic of crime, one family wrestles with the decision of who they will become when a stranger comes knocking. When an intruder breaks into James Sandin's (Ethan Hawke) gated community during the yearly lockdown, he begins a sequence of events that threatens to tear a family apart. Now, it is up to James, his wife, Mary (Lena Headey), and their kids to make it through the night without turning into the monsters from whom they hide. (Read More)
Subgenre: | suspense |
Themes: | death of fatherpsychopathdeceptionbetrayalrevengedeathmurder |
Characters: | boyfriend girlfriend relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationships |
Story: | hit with a pool cuedog taghiding under a bedkilling spreejumping through a windowstabbed in the legstrangernosebleedcharacter says i love youcharacter repeating someone else's dialoguestabbed in the backshot in the legdouble crossstabbed in the cheststabbed to death β¦death of friendflashlightshot in the backf wordrevolvershot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutpistolsurprise endingknifebloodviolence (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo β¦u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
Subgenre: | suspenseblack comedyindependent film |
Themes: | psychopathdeceptionbetrayalmurderdeathrevenge |
Mood: | car chase |
Locations: | bar |
Characters: | bullytough guyhusband wife relationship |
Story: | shot through a wallwoman wearing black lingeriebalisongbreaking a bottle over someone's headexperiment gone wrongcrashing through a windowshot through a windowkilling spreejumping through a windowstabbed in the legstealing a carfaked deathelectronic music scorecharacter says i love youmercenary β¦premarital sexshot in the shoulderstabbed in the backone against manyshot in the foreheadshot in the legdouble crossone man armystabbed in the cheststabbed to deaththroat slittingstrangulationgay slursubjective camerashot in the backf wordrevolvercar crashbrawlpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosioncigarette smokingbare chested malebare breastsbloodviolence (See All) |
Twenty three-year-old Mitch lost his parents to a tragic car accident at the age of fourteen, and his girlfriend to a terrorist attack just as they were engaged. Seeking revenge, he is enlisted by CIA Deputy Director Irene Kennedy as a black ops recruit. Kennedy then assigns Cold War veteran Stan Hu β¦rley to train Mitch. Together they will later on investigate a wave of apparently random attacks on military and civilian targets. The discovery of a pattern in the violence leads them to a joint mission with a lethal Turkish agent to stop a mysterious operative intent on starting a world war in the Middle East. (Read More)
Subgenre: | suspense |
Themes: | deceptionbetrayalmurderrevengedeath |
Mood: | car chase |
Locations: | restaurantbar |
Characters: | military policetough guyboyfriend girlfriend relationship |
Story: | british actor playing american charactershot in the footarms dealerbruisetitle at the endjumping through a windowassault riflestabbed in the legspecial forcesstealing a carmercenarysuspicionlaptopshot in the shouldercharacter repeating someone else's dialogue β¦stabbed in the backone against manyshot in the foreheadbartendershot in the legdouble crossone man armyno opening creditsstabbed in the cheststabbed to deathstrangulationflashlightsubjective camerashot in the backf wordcar crashbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingknifeexplosionphotographcigarette smokingbare chested malebare breastsbloodviolence (See All) |
Bill Pope (Ryan Reynolds) is a CIA agent on a mission in London tracking down a shadowy hacker nicknamed "The Dutchman." When he gets mysteriously ambushed and killed, an experimental procedure is used to transfer his memories into dangerous convict Jericho Stewart (Kevin Costner). When he wakes up β¦with the CIA agent's memories, his mission is to find The Dutchman and make the deal with him before the hacker launches ICBM's and starts World War III. But complications soon arise and the mission turns personal. (Read More)
Subgenre: | suspenseblack comedyindependent film |
Themes: | death of fatherpsychopathdeceptionbetrayalmurderrevengedeath |
Mood: | car chase |
Locations: | fire truckrestaurant |
Characters: | tough guyfather daughter relationshipmother daughter relationshiphusband wife relationship |
Story: | british actor playing american charactershot through a windowassault riflespecial forcesstealing a carelectronic music scoremercenarylaptopshot in the shoulderone against manyshot in the foreheadshot in the legdouble crossone man armyno opening credits β¦stabbed in the cheststabbed to deathambulancestrangulationsubjective camerashot in the backf wordcar crashbrawlarrestpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographcigarette smokingbare chested maleviolenceblood (See All) |
In an innocent heartland city, five are shot dead by an expert sniper. The police quickly identify and arrest the culprit, and build a slam-dunk case. But instead of confessing, the accused man writes the words, "Get Jack Reacher." Reacher himself sees the news report and turns up in the city. The d β¦efense is immensely relieved, but Reacher has come to bury the guy. Shocked at the accused's request, Reacher sets out to confirm for himself the absolute certainty of the man's guilt, but comes up with more than he bargained for. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | deceptionbetrayalmurderdeath |
Mood: | car chase |
Locations: | bar |
Characters: | ex soldiertough guyfather daughter relationship |
Story: | bar fightbritish actor playing american characterquarryoverhead camera shotframed for murdermysterious manassault riflestealing a carbroken legshot in the shouldercharacter repeating someone else's dialogueone against manyshot in the foreheadone man armydiner β¦subjective camerashot in the backcar crashbrawlarrestpunched in the faceshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingknifebare chested malebloodviolence (See All) |
Christian Wolff is a math savant with more affinity for numbers than people. Behind the cover of a small-town CPA office, he works as a freelance accountant for some of the world's most dangerous criminal organizations. With the Treasury Department's Crime Enforcement Division, run by Ray King, star β¦ting to close in, Christian takes on a legitimate client: a state-of-the-art robotics company where an accounting clerk has discovered a discrepancy involving millions of dollars. But as Christian uncooks the books and gets closer to the truth, it is the body count that starts to rise. (Read More)
Subgenre: | suspense |
Themes: | death of motherblackmaildeath of fatherdeceptionbetrayaldeathrevengemurder |
Locations: | farmsmall townrestaurantbar |
Characters: | ex soldiertough guybrother sister relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationships |
Story: | shot through a wallhundred dollar billman with no namemysterious manshot through a windowbloody nosefollowing someonenosebleedpickup truckmercenarycharacter repeating someone else's dialoguestabbed in the backone against manyshot in the foreheadshot in the leg β¦double crossone man armyno opening creditsstabbed in the chestdeath of friendshot in the backf wordbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingphotographbare chested malebloodviolence (See All) |
John Milton is up against the clock: Jonah King, the leader of a Satanic cult, has murdered Milton's daughter and kidnapped her baby. In three days, King and his followers will sacrifice the child at midnight. Milton picks up the trail in Oklahoma as well as rescuing a waitress named Piper from her β¦brutal, two-timing fiance. There are odd things about Milton: his driver's license is out of date, he has a very strange gun, and he's being pursued by a man in a suit who carries FBI ID and calls himself the Accountant. Piper, who's lived a life on the sidelines, has to piece things together on the fly as they close in on King. (Read More)
Subgenre: | black comedy |
Themes: | psychopathdeceptiondeathmurderrevenge |
Mood: | car chase |
Locations: | bar |
Characters: | waitresstough guy |
Story: | shot in the footshot through a windowjumping through a windowcellphonestabbed in the legfaked deathpot smokingpickup truckcharacter repeating someone else's dialoguestabbed in the backshot in the foreheadbartendershot in the legone man armyno opening credits β¦stabbed in the chestdinerthroat slittingstrangulationshot in the backf wordrevolvercar crashbeerbrawlwatching tvpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingwoman on topshootoutpistolknifebare chested malebare breastssex scenebloodviolence (See All) |
On April 15, 2013 Boston, Massachusetts, Police Sgt, Tommy Saunders is pulling security duty on the annual Boston Marathon when the Tsarnaev brothers strike with their homemade bombs in an act of terrorism. In the resulting chaos as the wounded are cared for, Saunders and his comrades join forces wi β¦th the FBI to get to the bottom of this attack. As the investigation continues, the Tsarnaev brothers realize that the authorities are close to identifying them and attempt to flee the city to continue their fanatical mayhem. To stop them, a police manhunt is performed that would have bloody confrontations and a massive dragnet shutting down the City of Boston to make sure there is no escape from the law. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | deceptiondeathmurder |
Mood: | car chase |
Locations: | fire truckrestaurantbar |
Characters: | boyfriend girlfriend relationshiphusband wife relationship |
Story: | shot through a windowfirefightertitle at the endspecial forcesstealing a carbroken legjoggingelectronic music scorepot smokinggrenadepickup trucknewspaper headlinedeath of brotherlaptopdouble cross β¦no opening creditsdinerdrug dealerambulanceflashlightf wordcar crashbeerbrawlarrestwatching tvpunched in the faceslow motion sceneshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographcigarette smokingbare chested maleviolenceblood (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
Subgenre: | suspenseindependent film |
Themes: | deceptionbetrayalfriendshipmurderrevengedeath |
Locations: | rural settingrestaurantbar |
Characters: | tough guyboyfriend girlfriend relationship |
Story: | shot in the neckcellphonestabbed in the neckstealing a carstabbed in the backshot in the foreheadbartendershot in the legno opening creditsstabbed in the cheststabbed to deathdeath of frienddinerthroat slittingdrug dealer β¦strangulationflashlightgay slurshot in the backf wordrevolverbeerbrawlslow motion sceneshot in the headshotgunshot in the chestblood splattershot to deathcorpseshootoutpistolsurprise endingknifephotographcigarette smokingviolenceblood (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t β¦he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | psychopathdeceptionbetrayalrevengedeathmurderfriendship |
Characters: | tough guyafrican american |
Story: | shot in the neckshot through a windowassault riflespecial forcesstabbed in the neckmercenarylaptopshot in the shouldercharacter repeating someone else's dialoguestabbed in the backshot in the foreheadshot in the legone man armyno opening creditsstabbed in the chest β¦stabbed to deathdeath of friendambulanceflashlightshot in the backf wordrevolvercar crashbeerbrawlpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolknifeexplosionphotographbare chested maleviolenceblood (See All) |
When the White House (Secret Service Code: "Olympus") is captured by a terrorist mastermind and the President is kidnapped, disgraced former Presidential Secret Service Agent Mike Banning finds himself trapped within the building. As our national security team scrambles to respond, they are forced t β¦o rely on Banning's inside knowledge to help retake the White House, save the President and avert an even bigger disaster. (Read More)
Themes: | death of motherdeceptionbetrayaldeathmurder |
Characters: | tough guyhusband wife relationshipfather son relationship |
Story: | shot through a wallshot in the footshot through a windowassault riflestabbed in the legspecial forcesstabbed in the neckfaked deathmercenaryshot in the shouldercharacter repeating someone else's dialoguestabbed in the backone against manyshot in the foreheadshot in the leg β¦one man armystabbed in the cheststabbed to deaththroat slittingambulancestrangulationsubjective camerashot in the backf wordcar crashbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolknifeexplosioncigarette smokingbare chested maleviolenceblood (See All) |
In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra β¦nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)
Subgenre: | suspense |
Themes: | deceptionbetrayalmurderrevengedeath |
Mood: | car chase |
Locations: | fire truckfarmbar |
Characters: | bullytough guyhusband wife relationshipfather son relationshipmother son relationship |
Story: | bully comeuppancedog tagexperiment gone wrongshot in the footshot in the neckshot through a windowkilling spreeassault riflestabbed in the legspecial forcesstabbed in the neckstealing a carstrangerpickup trucknewspaper headline β¦mercenaryshot in the shouldercharacter repeating someone else's dialoguestabbed in the backone against manyshot in the foreheadshot in the legdouble crossone man armystabbed in the cheststabbed to deaththroat slittingstrangulationflashlightsubjective camerashot in the backf wordrevolvercar crashbrawlwatching tvpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingfirepistolsurprise endingknifeexplosionphotographbare chested malebare breastsbloodviolence (See All) |
Set within a year after the events of Batman Begins, Batman, Lieutenant James Gordon, and new district attorney Harvey Dent successfully begin to round up the criminals that plague Gotham City until a mysterious and sadistic criminal mastermind known only as the Joker appears in Gotham, creating a n β¦ew wave of chaos. Batman's struggle against the Joker becomes deeply personal, forcing him to "confront everything he believes" and improve his technology to stop him. A love triangle develops between Bruce Wayne, Dent and Rachel Dawes. (Read More)
Subgenre: | suspense |
Themes: | blackmailpsychopathdeceptionbetrayalrevengedeathmurderfriendship |
Mood: | car chase |
Locations: | fire truckrestaurantbar |
Characters: | ex soldiertough guyboyfriend girlfriend relationshipafrican americanfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationship |
Story: | british actor playing american characterjob promotionescaped mental patientman with no namecrashing through a windowscarecrowmysterious manshot through a windowkilling spreebruisetitle at the endjumping through a windowassault riflefaked deathbroken leg β¦electronic music scoregrenadenewspaper headlinecharacter repeating someone else's dialogueone against manybartenderdouble crossone man armyno opening creditsdeath of frienddrug dealerambulanceflashlightsubjective camerashot in the backrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshotgunshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifepartyexplosionbare chested malekissviolenceblood (See All) |
Arthur Bishop, the master assassin who faked his death in hopes of putting that part of his ;life behind him, now lives a quiet life in Rio. But someone who knows who he is shows up and tells him, that if he wants to continue living this life, he will do three jobs for someone. Bishop tries to tell β¦them he has the wrong man but they know who he is and if he won't do the job, they will take him but he gets away. He then goes to a resort in Thailand run by a friend, Mae, where he tries to find out who is looking for him. Later a woman named Gina shows up looking for medical assistance and Mae can't help but notice bruises all over her body. Mae deduces she's a battered woman and when Mae hears her being beaten, Mae asks Bishop to help her. He goes and kills the guy she's with. He kills the man and then sets fire to the boat he's on. But he sees that Gina has a photo of him. He deduces that they one who wants him, sent her. He confronts her and she admits that she works at a children's shelter in Cambodia and that someone told her if she didn't do what he said, the children would be endanger. While waiting for the man to come, they get close. And when the man's people comes, they grab them. Bishop is brought to the man who wants him to do the jobs and he tells Bishop that if he doesn't do it, Gina will be killed. So Bishop has no choice but to do it. (Read More)
Subgenre: | independent film |
Themes: | blackmaildeceptionbetrayalfriendshipmurderdeathrevenge |
Locations: | restaurantbar |
Characters: | ex soldiertough guy |
Story: | crashing through a windowarms dealershot in the neckbruisestabbed in the legstabbed in the neckfaked deathfalse identitymercenarypremarital sexsuspicionlaptopshot in the shoulderstabbed in the backone against many β¦shot in the foreheadbartendershot in the legdouble crossone man armystabbed in the cheststabbed to deaththroat slittingambulancestrangulationflashlightshot in the backf wordbeerbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographcigarette smokingbare chested malebloodkissviolence (See All) |
Subgenre: | suspense |
Themes: | psychopathdeceptionbetrayalfriendshipdeathmurder |
Mood: | car chase |
Locations: | bar |
Characters: | tough guyboyfriend girlfriend relationshipfather daughter relationshiphusband wife relationshipteenager |
Story: | hall of mirrorsescaped mental patientcrashing through a windowframed for murdershot through a windowtitle at the endbloody nosenosebleedjogginggrenadenewspaper headlinepremarital sexone against manyshot in the foreheaddouble cross β¦one man armyno opening creditsambulanceflashlightgay slursubjective camerarevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographcigarette smokingbare chested malebloodviolencekiss (See All) |
In the US-government's special ops, Scott is a shooter, not a planner, doing the job without regard to quaint or obsolete convention. When a Harvard undergrad goes missing (the daughter of a US leader), it's Scott who applies the pressure, first to her boyfriend, then to a madam whose cathouse is th β¦e initial stop en route to a white slavery auction in Dubai. The abductors may not know the girl's identity, but once they figure it out, she's doomed. Deadly double crosses force Scott to become a planner. Through it all, earnest TV newscasters read the drivel they're handed. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | deceptionbetrayaldeathmurder |
Locations: | restaurantbar |
Characters: | tough guyboyfriend girlfriend relationshipafrican americanmother daughter relationshipfather daughter relationship |
Story: | dog tagscarecrowshot in the neckshot through a windowbeing followedassault riflespecial forcesstabbed in the neckstealing a carfaked deathfollowing someonenewspaper headlinemercenarycharacter repeating someone else's dialoguebartender β¦double crossone man armyno opening creditsthroat slittingflashlightgay slurshot in the backf wordcar crashbrawlpunched in the faceshot in the headshotgunshot in the chestmachine gunfistfightshot to deathbeatingshootoutpistolsurprise endingknifephotographcigarette smokingbare chested malebloodviolence (See All) |
As a toxin begins to turn the residents of Ogden Marsh, Iowa into violent psychopaths, sheriff David Dutton tries to make sense of the situation while he, his wife, and two other unaffected townspeople band together in a fight for survival.
Themes: | death of fatherdeathmurderfriendshiprevenge |
Mood: | high school |
Locations: | fire truckfarmrural settingsmall town |
Characters: | boyfriend girlfriend relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsteenager |
Story: | high school principalshot through a windowfirefighterassault riflenosebleedshot in the foreheadno opening creditsstabbed in the cheststabbed to deathdeath of frienddinerambulancestrangulationshot in the backf word β¦revolverpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutfirepistolsurprise endingknifeexplosionbare chested maleviolenceblood (See All) |
Iconoclastic, take-no-prisoners cop John McClane, for the first time, finds himself on foreign soil after traveling to Moscow to help his wayward son Jack - unaware that Jack is really a highly-trained CIA operative out to stop a nuclear weapons heist. With the Russian underworld in pursuit, and bat β¦tling a countdown to war, the two McClanes discover that their opposing methods make them unstoppable heroes. (Read More)
Themes: | death of fatherdeceptionbetrayalrevengemurder |
Mood: | car chase |
Characters: | tough guyfather daughter relationshipfather son relationship |
Story: | shot in the footcrashing through a windowarms dealershot through a windowjumping through a windowassault riflestabbed in the legcharacter says i love youmercenaryshot in the shouldercharacter repeating someone else's dialogueshot in the legdouble crossone man armystrangulation β¦flashlightshot in the backcar crashpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splattershot to deathbeatingshootoutpistolsurprise endingknifeexplosionphotographbare chested male (See All) |
Matt Scudder is a former cop now a private eye. He is asked by a drug dealer to find the men who kidnapped his wife. It seems like they killed her even after he paid them. Scudder refuses. But the man later goes to see him and tells him how his wife was killed. Scudder takes the job. He does some re β¦search and thinks the men he is looking for have done this more than once. And that everyone they grabbed is connected to a drug dealer. He was about to give up when they grab another girl and Scudder tries make sure she's returned alive. (Read More)
Subgenre: | suspenseindependent film |
Themes: | psychopathdeceptionrevengemurderdeath |
Locations: | bar |
Characters: | ex soldierwaitresstough guymother daughter relationshipfather daughter relationshiphusband wife relationship |
Story: | shot through a windowbeing followedfaked deathnewspaper headlinecharacter says i love youdeath of brothercharacter repeating someone else's dialoguebartendershot in the legstabbed to deathdinerdrug dealerstrangulationgay slursubjective camera β¦shot in the backf wordrevolvercar crashbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolknifephotographcigarette smokingviolenceblood (See All) |
Orin Boyd (Seagal) is a Detroit cop who doesn't follow rules. After he saved the Vice President by violating every order he received he is transferred to one of the worst precincts in the city. There he quickly encounters some corrupt cops selling heroin to drug dealers. The problem is, it's very di β¦fficult to tell who is the bad guy and who you can trust. (Read More)
Subgenre: | black comedy |
Themes: | deceptionbetrayaldeathmurder |
Mood: | car chase |
Locations: | restaurantbar |
Characters: | tough guyafrican american |
Story: | bar fightbalisongframed for murdershot in the neckshot through a windowjumping through a windowstabbed in the legstabbed in the neckstealing a carshot in the shouldershot in the foreheadbartendershot in the legdouble crossone man army β¦no opening creditsdinerdrug dealerambulanceshot in the backf wordcar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathbeatingshootoutfirepistolknifeexplosionviolenceblood (See All) |
Four waves of increasingly deadly attacks have left most of Earth in ruin. Against a backdrop of fear and distrust, Cassie is on the run, desperately trying to save her younger brother. As she prepares for the inevitable and lethal fifth wave, Cassie teams up with a young man who may become her fina β¦l hope - if she can only trust him. (Read More)
Subgenre: | suspense |
Themes: | death of motherdeath of fatherdeceptionbetrayalmurderfriendshipdeath |
Mood: | high school |
Characters: | tough guyteenage boybrother sister relationshipmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenager |
Story: | dog tagassault rifleunderage drinkingbroken legfollowing someonegrenadepremarital sexsuspicionhigh school studentcharacter repeating someone else's dialogueshot in the legdouble crossno opening creditsstrangulationsubjective camera β¦shot in the backrevolvercar crashbrawlpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifepartyexplosionphotographbare chested malekissviolenceblood (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized β¦ city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | deceptionbetrayalmurderdeathrevenge |
Mood: | car chase |
Locations: | restaurantbar |
Characters: | father daughter relationshipmother daughter relationshiphusband wife relationship |
Story: | breaking a bottle over someone's headarms dealerbruiseassault riflestabbed in the legstealing a carfollowing someoneelectronic music scorepremarital sexsuspicioncharacter repeating someone else's dialoguestabbed in the backone against manyshot in the foreheadbartender β¦shot in the legdouble crossstabbed in the cheststabbed to deaththroat slittingstrangulationshot in the backf wordrevolvercar crashbeerbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifepartyexplosionphotographcigarette smokingbare chested malebare breastssex sceneviolenceblood (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | black comedyindependent film |
Themes: | deceptionbetrayaldeathrevengemurder |
Locations: | bar |
Characters: | brother sister relationshipboyfriend girlfriend relationshipfather daughter relationship |
Story: | breaking a bottle over someone's headvillain not really dead clichekilling spreestabbed in the legfaked deathpremarital sexsuspicionshot in the shouldercharacter repeating someone else's dialoguestabbed in the backshot in the foreheadshot in the legdouble crossno opening creditsstabbed in the chest β¦stabbed to deaththroat slittingambulancestrangulationflashlightshot in the backf wordrevolvercar crashbrawlwatching tvpunched in the faceshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingpistolsurprise endingknifepartyphotographcigarette smokingbare chested maleviolenceblood (See All) |
A young man named Eggsy whose father died when he was a young boy, is dealing with living with the creep his mother is with now, who mistreats her and him. He goes out and does something to one of the creep's friends. He gets arrested and he calls a number a man gave him around the time his father d β¦ied, to call if he needs help. A man named Harry approaches him and tells him he's the one who helped him. He tells him that he knew his father. When the man Eggsy slighted wants some payback, Harry takes care of him and his companions single handed. Harry then tells Eggsy that he's part of a secret organization called the Kingsman and his father was also part of it. He died trying to make the world safe. Harry offers Eggsy the opportunity to be a Kingsman and he takes it. He undergoes a grueling training course. Harry is looking into the demise of another Kingsman and the trail leads him to tech billionaire named Valentine aka V who is also curious about the group following him, the Kingsman. (Read More)
Subgenre: | black comedy |
Themes: | death of fatherdeceptionbetrayalmurderrevengedeath |
Mood: | car chase |
Characters: | ex soldiertough guyboyfriend girlfriend relationshipafrican americanmother son relationshipteenager |
Story: | bar fightcrashing through a windowmedalhomagejumping through a windowassault riflestealing a carelectronic music scoregrenadenewspaper headlinemercenarylaptopcharacter repeating someone else's dialoguestabbed in the backone against many β¦shot in the foreheadshot in the legone man armyno opening creditsstabbed in the cheststabbed to deathdeath of friendthroat slittinggay slursubjective camerashot in the backf wordrevolvercar crashbrawlarrestpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingknifeexplosionphotographbare chested malesex sceneviolenceblood (See All) |
After witnessing the brutal murders of a convenience store owner and his son, firefighter Jeremy Coleman barely escapes with his life. As he is forced to testify against the crime lord, Hagan, he is placed in the witness protection program under the watch of the U.S. Marshals. When his new identity β¦becomes compromised Jeremy is forced to take an unexpected course of action in order to get his life back and save the lives of those he loves. (Read More)
Subgenre: | suspenseindependent film |
Themes: | deceptionbetrayaldeathrevengemurder |
Mood: | car chase |
Locations: | fire truck |
Characters: | tough guyboyfriend girlfriend relationshipafrican american |
Story: | running for your lifeshot in the footarms dealershot through a windowfirefighterstabbed in the legelectronic music scorekissing while having sexpremarital sexlaptopshot in the foreheaddouble crossone man armyambulanceshot in the back β¦f wordrevolverbeerbrawlpunched in the faceslow motion sceneshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolknifeexplosionphotographbare chested malesex sceneviolencekissblood (See All) |
After the British Prime Minister has passed away under mysterious circumstances, all leaders of the Western world must attend his funeral. But what starts out as the most protected event on earth, turns into a deadly plot to kill the world's most powerful leaders and unleash a terrifying vision of t β¦he future. The President of the United States, his formidable secret service head and a British MI-6 agent who trusts no one are the only people that have any hope of stopping it. (Read More)
Subgenre: | black comedy |
Themes: | deceptionbetrayalrevengemurderfriendshipdeath |
Mood: | car chase |
Characters: | tough guymother daughter relationshiphusband wife relationship |
Story: | british actor playing american charactershot through a wallarms dealershot through a windowkilling spreeassault riflestabbed in the legspecial forcesjoggingmercenarylaptopshot in the shouldercharacter repeating someone else's dialoguestabbed in the backone against many β¦shot in the foreheadshot in the legone man armystabbed in the cheststabbed to deaththroat slittingstrangulationsubjective camerashot in the backf wordcar crashbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionviolence (See All) |
In Jakarta, Indonesia, Lieutenant Wahyu organizes the invasion of an apartment building that is the safe house of the powerful and cruel drug lord Tama and his gang. The SWAT team breaks in the building but one lookout sees and warns the gangsters and the police force is trapped on the seventh floor β¦. They learn that Lt. Wahyu has not informed his superiors about the operation. Now the police officers have to fight with limited ammunition against the armed and dangerous gangsters. (Read More)
Subgenre: | suspense |
Themes: | betrayalmurderdeath |
Characters: | tough guyhusband wife relationship |
Story: | shot in the neckshot through a windowtitle at the endjumping through a windowassault riflestabbed in the legstabbed in the neckgrenadecharacter says i love youshot in the shouldercharacter repeating someone else's dialogueshot in the legone man armystabbed in the cheststabbed to death β¦throat slittingstrangulationbrawlarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingknifeexplosionbare chested maleviolenceblood (See All) |
Arthur Bishop (Jason Statham) is a 'mechanic' - an elite assassin with a strict code and unique talent for cleanly eliminating targets. It's a job that requires professional perfection and total detachment, and Bishop is the best in the business. But when his mentor and close friend Harry (Donald Su β¦therland) is murdered, Bishop is anything but detached. His next assignment is self-imposed - he wants those responsible dead. His mission grows complicated when Harry's son Steve (Ben Foster) approaches him with the same vengeful goal and a determination to learn Bishop's trade. Bishop has always acted alone but he can't turn his back on Harry's son. A methodical hit man takes an impulsive student deep into his world and a deadly partnership is born. But while in pursuit of their ultimate mark, deceptions threaten to surface and those hired to fix problems become problems themselves. (Read More)
Themes: | death of fatherdeceptionbetrayaldeathrevengemurder |
Mood: | car chase |
Locations: | restaurantbar |
Characters: | tough guy |
Story: | hundred dollar billoverhead camera shotarms dealervillain played by lead actorjumping through a windowstabbed in the legjoggingnewspaper headlinekissing while having sexpremarital sexcharacter repeating someone else's dialogueshot in the foreheadshot in the legno opening creditsstabbed in the chest β¦stabbed to deathdeath of friendstrangulationcar crashbrawlpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingwoman on topshootoutpistolsurprise endingphotographcigarette smokingbare chested malesex sceneviolenceblood (See All) |
After accomplishing the assignment of dismantling a human trafficking organization, the former military and drifter Jack Reacher goes to Washington to invite his liaison, Major Susan Turner, to have dinner with him. However, he meets her substitute, Colonel Sam Morgan, who explains that Major Turner β¦ has been arrested and accused of espionage. Jack seeks out her veteran lawyer, Colonel Bob Moorcroft, who explains that Major Turner has also been accused of the murders of two soldiers in Afghanistan. Further, he also tells Jack he is being sued, accused by a woman of being the father of her fifteen year-old daughter, Samantha. When Moorcroft is murdered, Jack is accused of being the killer and sent to a prison. He sees that Turner and he have been framed and also that Turner will be killed by two assassins. However, he rescues her and they flee. Soon, they realize that there is a conspiracy involving military people from the army and a government contractor that is a powerful arms dealer. Jack also learns that Samantha is in danger and Turner and he rescue her. They decide to protect her since a skilled assassin is hunting them down while they try to find the motive of the conspiracy. Who can be trusted? (Read More)
Subgenre: | suspenseblack comedy |
Themes: | deceptionbetrayalrevengemurderdeath |
Mood: | car chase |
Locations: | restaurant |
Characters: | military policeex soldierwaitresstough guyteenager |
Story: | arms dealermajorframed for murdershot in the neckshot through a windowbruiseassault riflestealing a carbroken legfollowing someonepickup truckmercenarysuspicionlaptopcharacter repeating someone else's dialogue β¦one against manyshot in the legdouble crossone man armydinerstrangulationflashlightgay slurhalloweenshot in the backcar crashbrawlarrestwatching tvpunched in the faceslow motion sceneshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographbare chested maleviolenceblood (See All) |
Two petty if violent criminals kidnap a girl being paid $1m to be a surrogate mother. As the baby is for a gangster the pair's demand for money sees several henchmen and assorted other ruthless characters head after them to Mexico. Bullets rather than talking are always going to settle this one.
Subgenre: | suspenseblack comedyindependent film |
Themes: | deceptionbetrayalrevengefriendshipmurderdeath |
Mood: | car chase |
Locations: | bar |
Characters: | tough guyhusband wife relationshipfather son relationship |
Story: | shot through a wallshot in the footshot in the neckshot through a windowstealing a carshot in the shouldercharacter repeating someone else's dialogueone against manyshot in the legdouble crossdinerambulancegay slurshot in the backf word β¦revolvercar crashbrawlarrestpunched in the faceshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingcigarette smokingbare chested maleviolenceblood (See All) |