Best popular movies like Evan Almighty:

Do you need specific genre & keyword selection to find films similar to Evan Almighty?
<< FIND THEM HERE! >>

Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Evan Almighty (2007)

Buffalo newsman Evan Baxter is elected to Congress with the slogan, "Change the world." He lucks into a huge house in a new Virginia suburb. His Capitol office is also fantastic, but there's a catch: he's tapped by the powerful Congressman Long to co-sponsor a bill to allow development in national p β€¦arks. In steps God, who appears to a disbelieving Evan and gently commands him to build an ark. Tools and wood arrive in Evan's yard, animal pairs follow, his beard and hair grow wildly, nomad's clothes and a staff appear. Long grows impatient, Evan starts building, his family leaves him, reporters gather, and drought grips D.C. Still, Evan believes. But will he change the world? (Read More)

Themes:
faithcorruptiondancepoliticsreligion
Mood:
rain
Locations:
military truckboatrestaurant
Characters:
secretarybiblereference to godpolicemanpolice officersoldierbrother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationship
Story:
noah's arkdam burstweather reportlong hairelection campaignnational parkfish tankcnn reporternews reporterboat buildingreal estate investmentu.s. house of representativestwo man sawwhite doveland development β€¦clock radiousa governmenthummer h2u.s. capitol buildingalpacagod as humanstray dogchief of staffrepresentativeyakconstruction cranecrossing guardpledge of allegiancebird poopmuttlionesssloganbuffalo new yorkanchormanwrecking balldepiction of godirrigationarklicense platetoolboxfrat packtoolshyenababoonbiblical quotebiblical referenceridiculefamily crisiscamping trippenis sizezebraostrichnew housewater fountaincongressexcrementworkaholicinterncongressmandroughtgiraffenewscastrainbowmoving inspitvirginiawarningkindnessrobedampolitical campaignchangetelevision newsgorillasuitwoodhikinghairprayingpetspittingcrowmarital problemalarm clockweatherinsultwisecrack humortigerlionaquariumprophecymiracleconstruction sitefloodpromisepicnicpress conferencefraudspiderbeardelephantlawfaintingloyaltywolfwaiterwashington d.c.monkeybearelectionthreatautomobilegiftamerican flagdisappearancescene during end creditsfired from the jobsuburbpublic nudityscreamingtreeparknews reportunderwater scenedinnerfishsnakebridgereporterprayersecond partcatdancingmale nuditycharacter name in titletwo word titlesequeldognudity (See All)

Life Of Pi (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Life Of Pi (2012)

In Canada, a writer visits the Indian storyteller Pi Patel and asks him to tell his life story. Pi tells the story of his childhood in Pondicherry, India, and the origin of his nickname. One day, his father, a zoo owner, explains that the municipality is no longer supporting the zoo and he has hence β€¦ decided to move to Canada, where the animals the family owns would also be sold. They board on a Japanese cargo ship with the animals and out of the blue, there is a storm, followed by a shipwrecking. Pi survives in a lifeboat with a zebra, an orangutan, a hyena and a male Bengal tiger nicknamed Richard Parker. They are adrift in the Pacific Ocean, with aggressive hyena and Richard Parker getting hungry. Pi needs to find a way to survive. (Read More)

Themes:
faithreligionfriendshiplonelinessdyingwritingcouragestarvationschool bullying
Mood:
rain
Locations:
hospitalbeachschoolswimming poolparis francewatershipjunglemexicoindiacatholic churchstorm at sea
Characters:
reference to godbrother brother relationshipfamily relationshipshusband wife relationshipmother son relationshipfather son relationshipteenage boyteacherstudentdancerchristianityjapanesecatholicmuslimuncle nephew relationship β€¦catholic priesthuman animal relationship (See All)
Period:
1970s
Story:
arkhyenazebraprayingspittingtigermiracleelephantmonkeybearunderwater scenesnakeprayerdancingcharacter name in title β€¦based on novelflashbackbare chested maleknifethree word titlevoice over narrationurinationvomitingislandreference to jesus christclassroomsubjective cameraswimmingsurvivalorphanflashlightaxemontageeatingmapapologyanimaljourneypainflash forwardbusinessmanfantasy sequencestorytellinglightningsplit screenloss of fatherratloss of mothermagical realismclasssubtitled scenesurvivortold in flashbackcookswimsuitsharkanimal attackgoatstreet lifebroken legfull moonbuddhistdivingnicknamewindthunderanimated sequence3 dimensionalzoohungernovelistdrummerbananabelief in godvegetariansailorloss of brothercamel12 year oldwhaleshipwreckstreet marketlizardmathematicstoronto ontario canadahinduwhistledrumfalling into waterflareteasingdolphinswimming underwaterreading a bookrespectkarma11 year oldloss of familyflare gunholy waterpacific oceanoverhead shothinduismtoothdance classmontreal quebecbucketarabicaspiring writerrhinocerosleopardorange juiceorangutanasian indianhippopotamusmotivationalanimal cagecastawayreference to allahsinking shiplifeboatsunken shipseasicknesscargo shipbotanistflamingofly the insectlost at sealife jacketzookeeperinjured animaloarreference to christopher columbusreflection in watercrossing oneselffreighterfishnetkrishnameerkatinsurance claimreference to albert camusanimal fightmale cryingrationalityashramfloating islandadriftfrench classflying fishmonitor lizardanimal companionpipraying handsreading a comic booksurvival guideeating a ratkilling a fishschool of fishbengal tigerecumenismrupeebotanical gardenpondicherry indiabharatanatyamcatching fish by handganeshgravyhanumanherpetologistthrown into a swimming poolgreek alphabetinsurance investigationreading under the coversreference to ganesha (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Salmon Fishing In The Yemen (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Salmon Fishing In The Yemen (2011)

A visionary sheik believes his passion for the peaceful pastime of salmon fishing can enrich the lives of his people, and he dreams of bringing the sport to the not so fish-friendly desert. Willing to spare no expense, he instructs his representative to turn the dream into reality, an extraordinary  β€¦feat that will require the involvement of Britain's leading fisheries expert who happens to think the project both absurd and unachievable. That is, until the Prime Minister's overzealous press secretary latches on to it as a 'good will' story. Now, this unlikely team will put it all on the line and embark on an upstream journey of faith and fish to prove the impossible, possible. (Read More)

Themes:
faithreligiondeathfriendshipmarriagemoneydrinkingobsessionterrorismgriefhopefalling in lovewealthjustice
Mood:
rain
Locations:
boatrestaurantchurchhelicopterairplanedesertlondon englandwatertaxicastleofficecampfirecanyon
Characters:
secretaryreference to godhusband wife relationshipmother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipchildrenboyphotographermuslimchinesefishermanengineer
Story:
representativeirrigationdamprayingmiraclefloodpress conferencethreatnews reportunderwater scenefishprayersexbased on novelbare chested male β€¦gunkisscigarette smokingtitle spoken by charactertelephone callcryingcell phoneunderwearfoodslow motion scenecomputercameradrinkundressingletterrifletearsanimal in titlerunningcafebritishreference to jesus christriversciencetelephonescientistf wordsubjective cameraswimmingnewspaperjournalistassassinwineterroristvideo cameramontageeatingmapapologyfishingumbrellamissiontentsplit screenreunionnewspaper headlinepickup trucktv newstraitoranswering machinecaptainteasabotagedestructioncountry name in titleassassination attemptreference to adolf hitlerpropagandaislammagazineculture clashorchestragoatwatching televisionmiddle eastbreakupboxer shortsministermobile phonescotlandpartnernewsreel footageafghanistanoilschool uniformarabvoice over lettertuxedomidlife crisisholding handsislamicprime ministertext messagingsaving a lifehandshakeshynesswar heroterritory name in titlenaivetylistening to a radioquitting a jobunhappinessgiving a toastcelloplaying a video gamepressdeath of boyfriendluckinternet chatsleeplessnessradio newsdeath by drowningprivate jetintercomcellistoverhead shotscientific researchfloodingbad luckpublic relationsarabickneelingsaying goodbyesalmonwatching someonecandelabrabeing watchedhead scarfjoke tellingvisionarydead fishgeologistdining halltalking to an animaldessertheadsetdreamerworryingfly fishinghusband wife estrangementcivil servantmissing in actionmandarinphdfish in titlelooking through a windowbureaucrattrombonefishing netreference to queen elizabeth iisheikhreflection in waterwading in waterhubrisbritish prime ministerbritish governmentshreddersharing a bedburkayemenreference to californiafisheryreference to mars the planet10 downing streetpress secretaryreference to ark of the covenanttrombone playerkoi pondrod and reelgravelfish farmmoment of truthlistening to classical musicreference to geneva switzerlandsport fishingdangling feet in waterreference to a nazisluicespawning (See All)

Fantasia 2000 (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fantasia 2000 (1999)

In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his  β€¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)

Subgenre:
fairy taledisneybiblical
Themes:
surrealismjealousyfearartmagicnatureangertheftunrequited lovehopeunemploymentfreedombook of magic
Mood:
rainarchive footagepoetic justice
Locations:
boatnew york citytrainswimming poolforesthotelcarsnownightclubdesertbicyclewatertaxielevatorwoods β€¦apartmentlakeshiptruckrooftopcaveoceansewerforest fire (See All)
Characters:
police officerfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteacherdancermusicianactorartistlittle girlbullywaitresscomedianfisherman
Period:
1930swinter
Story:
noah's arkarkzebraostrichgirafferainbowwoodweatherlionfloodelephantfaintingwolfmonkeybear β€¦treefishsnakecatdancingdogsequelnumber in titlekissknifechasefirecryinghorsemirrorremakerescuefalling from heightbooktearsrunningcafepianoriversubjective cameranewspaperaxemountainsubwaydream sequencedrawingfishingsearchanthologycoffeepainportraitumbrelladragondollrabbitlightningscreampianistsadnessratunderwaternewspaper headlinejazzicefireplacedestructionperformancemagicianmousetoyoverallsclassical musicfrogtennisrailway stationpart animationviolinmilkorchestragoatclockembarrassmentapplepresumed deadanthropomorphismtrappedthunderhypocrisymisunderstandingpet doganthropomorphic animalrejectionhungerdespairdrummerballlaughterbutterflyice skatingvolcanodaydreamshadowspyingdeerturtlecliffduckboxhorse and carriageflightcoinbatjoycamelspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainwhalefoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatortemptationbeeperformerpopcornfalling into waterseagulllavaquitting a jobjacketsorcerercloudhostgreat depressionballerinadisappointmentimmaturityeaglealligatorasheshammockcrabmeteorpart computer animationhonestymistakeapepart live actiondrillpolar bearclumsinessconductorgymnasticskangaroowindowmiseryspringabstractcourtshipdoormanapprenticelocketnoiseblanketdoverebirthunicornrevolving doordance lessonregenerationstreet vendorice rinkbroombaldnesspaperdance classfaunacity parkconformityflorasheet musicsignextinctionnetsubway trainbucketbubblecoatphonograph recordvasehornrhinoceroswheelbarrowabstract artmovementfloatingchestjazz clubfigure skatinghard hatleashvolcanic eruptioncartcollisionnoseorganisticebergskunksunlightcarrying someonehippopotamusimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonflamingopet storeelkiciclemarqueemilkmanfatiguehopscotchmusic lessonscubalife jacketramppuddlestooltripping and fallingashcauldronjazz combotubewhirlpoolcentral parkdizzinesssupernovaspellcastingbillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathsleeping in a chairbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionflower petalhenpecked husbandpantaloonwalnutlinebranchteardropflipperglowing eyestepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirdflooded roomtrampleddog bonetimingfruit cartlily padmagical hatseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All)

The Tree Of Life (2011) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Tree Of Life (2011)

The impressionistic story of a Texas family in the 1950s. The film follows the life journey of the eldest son, Jack, through the innocence of childhood to his disillusioned adult years as he tries to reconcile a complicated relationship with his father ('Brad Pitt' (qv)). Jack (played as an adult by β€¦ 'Sean Penn (I)' (qv)) finds himself a lost soul in the modern world, seeking answers to the origins and meaning of life while questioning the existence of faith. (Read More)

Subgenre:
independent filmcoming of ageepic
Themes:
faithreligiondeathmarriagejealousypregnancyfearmemorytheftdysfunctional familyguiltgriefbullyingeducationphotography β€¦hopecrueltychildhoodinheritanceafterliferegret (See All)
Mood:
rainavant gardemoving
Locations:
restaurantbeachschoolchurchswimming poolforestcemeterysmall townairplanebathtubdesertbicycleelevatorwoodsurban setting β€¦police carseacourtroombaseballouter spaceoceanchinatexasstormrunning into water (See All)
Characters:
reference to godpolicemanbrother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshippoliceafrican americanchildrenboymusicianbabypriestthief β€¦christianbullywaitresschristianitylittle boycatholicchinesegrandmother grandson relationshipengineeryounger version of characterpregnant wifecrying babydeath of boydeath wish (See All)
Period:
1950s
Story:
spittingmarital problempromisefaintingfired from the jobsuburbtreeunderwater scenefishsnakebridgeprayercatdancingdog β€¦flashbackbare chested malekissfightexplosiontelephone callfirevoice over narrationcryingcell phonefoodmirrorface slapslow motion scenearrestpaintingbooklietearsrunninglingeriedead bodycafepianoclassroomguitarriverswimminghalloweensurvivalnewspaperflashlightcandleeatinghousenonlinear timelinechild abuseapologyman with glassescoffinbathsearchjourneygraveyarddrowningpaingunshotflash forwardclownliarstorytellingreadingbaseball batflowerscourtdeath of brotherchildbirthdeath of songardenwaterfallflowerclasssleepingtrustkillingredheadhateblack americanrecord playermachismoeyeglassesdestinybreaking and enteringlooking at oneself in a mirrorlistening to musicrecordingvandalismguitariststealingplanetswimsuitsharkladderbirthfollowing someoneend of the worldambitiondinosaurwindsufferingthundermourningloss of sonchild protagonistkickinginsectcigarette lighterbible quotecard playingsibling rivalrysunbutterflyvolcanoatticshadowchoirswingbarbecueexistentialismgrowing uploss of brotherchildhood memoryfast motion sceneshamebeing followedpiano playersermongiving birthhandshake12 year oldgardeningnotebookbaptismhomecomingreading aloudstairwayescalatorlooking out a windowabandoned houselizardvery little dialogueskyscrapernaivetyseagullwhisperingenvylavabubble bathstrokebare chested boyelectric shocktrain tracksuniverseswimming underwaterbreaking a windowguitar playernewborn babyclimbing a treefailuremeteorprehistoric timestelegramreading a newspaperstarscar radiotreehousegrassdistrustdeath by drowningtoy gunsilhouettefetuswaveplant in titleexpectant motherdomineering fatheroverhead shotsaying gracecourthousedare19 year oldkneelingexpectant fatherwater hosewashing dishesice cubehand kissingplanet earthsnoopinghoselooking in a windowjigsaw puzzlejumping on a bedorganiststeamheartbeatstained glass windowtrashcanloss of innocencelaundry drying on clothes linecar repairpower plantschoolyardsparklerlawn sprinklercosmosplayingelectric fanthree brotherswind chimeembryochild as main charactersunflowerancestrylearning to readblessinglighting a candlebig bangblowing bubblessomersaultdeath in familybad newsplainplaying catchtarkovskyesquebb guncrossing oneselfwading in waterwalking on a beachstrict fatherdaily lifedestroying propertyholding head underwaterpatentpipe organwatering cantime capsulewanting to dieartificial respirationhand clapping gamebegins with a quoteresentment toward fatherlimping manreference to johannes brahmsschool bellstreetlightrolling down a hilltree swingplanting a treebegins with a quotationreference to jobhanging out washingtolling bellorigins of lifeveinair rifleelectrical shockfloating in the airglass elevatorhairbrushglass coffinpraying handswaco texaseye maskfertilizationkicking a canpineconeddtdirgejumping from a treepantheismreference to arturo toscaninisurvival of the fittestdeath notificationbirth of sonhit with a boardice traylearning to walkparents arguing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Election (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Election (1999)

Tracy Flick is running unopposed for this year's high school student election. But school civics teacher Jim McAllister has a different plan. Partly to establish a more democratic election, and partly to satisfy some deep personal anger toward Tracy, Jim talks popular varsity football player Paul Me β€¦tzler to run for president as well. Chaos ensues. (Read More)

Subgenre:
gay interestcoming of ageblack comedyteen moviepolitical satireteen romanceteen comedy
Themes:
corruptionpoliticsreligionmarriageinfidelitybetrayaljealousyadulterylesbianismextramarital affairdivorceunfaithfulnesscruelty
Mood:
satirehigh school
Locations:
new york cityschoolbicyclecatholic school
Characters:
husband wife relationshipmother son relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistteacherstudentlove triangleteacher student relationship β€¦gay teenagerself destructivenessteacher student sexlesbian daughterself absorption (See All)
Story:
election campaignridiculespitpolitical campaignwashington d.c.electionfired from the jobprayerf ratedbased on novelone word titleflashbacksex scene β€¦kisstitle spoken by characterpartylesbian kissshowervoice over narrationcryingurinationblondemanhattan new york cityconfessionlimousinekissing while having sexclass differencesteenage sexfreeze framedestinyteen angstathletejoggingoverallsbroken legapplemoralityjanitorcynicismhot tubswingposterfemale female kissgraduationteachingethicsteenage loveblonde womanmotel roombeeenvyteenage daughterteenage sexualitystatue of liberty new york cityjointjockpolitical candidateteenage crushsex with a minormarital infidelitygirls' schoolnebraska16mmhigh school athletepepsibracesbannerpower plantcampaigningclichedumped by girlfriendphotocopiermultiple narratorsbee stinglesbian teensprinkler systemteen lovehistory teacherlawn mowingasparaguspinpower lineapple treepower stationlesbian sisternarcissistic personality disorderchemistry classgirl girl relationshipomaha nebraskaoverachieverskiing accidentwipemathematics teacherfaculty loungehigh school electionlincoln memorial washington d.c.student council presidentmuseum guideteenage issuesparochial schoolschool administratorhigh school vice principalwide angle lensstudent governmentvote tampering (See All)

Bruce Almighty (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bruce Almighty (2003)

Bruce Nolan, a television reporter in Buffalo, N.Y., is discontented with almost everything in life despite his popularity and the love of his girlfriend Grace . At the end of the worst day of his life, Bruce angrily ridicules and rages against God and God responds. God appears in human form and, en β€¦dowing Bruce with divine powers, challenges Bruce to take on the big job to see if he can do it any better. (Read More)

Subgenre:
black comedy
Themes:
religionrevengejealousymagicsupernatural powerredemptionbreak up
Locations:
restauranthospital
Characters:
reference to godteacher
Period:
2000s
Story:
god as humanbuffalo new yorkdepiction of godtelevision newsmiraclemonkeyfired from the jobreporterprayercharacter name in titledogtitle spoken by characterpartypantiescomputer β€¦marijuanavideo cameradinertoiletrace against timemoaningmissing personpremarital sexfirst partobscene finger gesturemoonriotwarehouselifting someone into the airassaultblockbusterjanitorchaosthunderstormice hockeye mailsports carphoto albumbloopers during creditsstreet gangdefecationlegsselfishnesscoca colatraffic jammessagehit by a truckbakerycookiesoupresponsibilitymeteorspoonpleasuretsunamihoboanimal that acts humansexual pleasuretv stationdealwoman moaning from pleasurejob promotionwoman moaningmoaning womanwish fulfillmentniagara fallspagernews anchorreference to gandhidefibrillationworld recordelectricianlottery winnergenerositymount everestdivine interventionfile cabinetpost itwalking on waterblood donorbeadschocolate milkbreasts growingspontaneous orgasmplaying with own breaststalking with godanimal urinationchild day carechocolate chip cookienew automobilebroken electronic workssightseeing boat (See All)

Zootopia (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Zootopia (2016)

From the largest elephant to the smallest shrew, the city of Zootopia is a mammal metropolis where various animals live and thrive. When Judy Hopps becomes the first rabbit to join the police force, she quickly learns how tough it is to enforce the law. Determined to prove herself, Judy jumps at the β€¦ opportunity to solve a mysterious case. Unfortunately, that means working with Nick Wilde, a wily fox who makes her job even harder. (Read More)

Subgenre:
conspiracycgi animationallegorydisney
Themes:
dancerevengeweddingbullyingprejudiceforgiveness
Mood:
neo noirsavage
Locations:
trainlaboratorytrain stationwedding partylaboratory accident
Characters:
policefemale protagonistthiefbullysniperpregnantmysterious villain
Story:
yakgiraffenewscasttigerlionelephantlawwolfbearbridgef ratedone word titleexplosionchasecrying β€¦interrogationtelephonenewspaperapologyno opening creditspoisonproduct placementrabbitpigflowerstrong female charactericetv newshuggingheroineice creamvillainessvictimsheepfaked deathstrong female leadanthropomorphismguardyogareconciliationanthropomorphic animalcon artistdiscriminationwedding dressinjusticehysteriafoxstereotypedvdidealismpolice interrogationfemale herotrain ridefemale villaindisillusionmentiphonepolar bearcarrotignorancevillain arrestednudistangry mobbuffaloantidoteleopardipodchemistjaguaraudio recordingparking ticketfurryfiredanimal protagonistbadgersecret laboratoryscratchmammalsecret revealedonionanthropomorphic mousearmadillootterslothweaselcon gamerhinopolice womanmass hysteriahipponaturistracial relationsdonutsdepartment of motor vehiclesevil geniussocial exclusionblueberrymeter maidpoison ivyanthropomorphic bearanthropomorphic rabbitphone videovillainydistrictgazelleface scratchanthropomorphic elephantanthropomorphic foxelephant in the room (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dumbo (1941) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dumbo (1941)

The stork delivers a baby elephant to Mrs. Jumbo, veteran of the circus, but the newborn is ridiculed because of his truly enormous ears and dubbed "Dumbo". After being separated from his mother, Dumbo is relegated to the circus' clown acts; it is up to his only friend, a mouse, to assist Dumbo to a β€¦chieve his full potential. (Read More)

Subgenre:
2d animation
Themes:
surrealismdrunkennessgreedprejudice
Mood:
rainnightmarenightaffection
Locations:
train
Characters:
family relationshipsmother son relationshipbully
Period:
1940s
Story:
zebragiraffecrowtigerlionmiracleelephantbearcharacter name in titleone word titletitle spoken by charactersingingfiredreambed β€¦hallucinationanimalspankingclownfantasy sequencechampagnecircusflyinglifting someone into the airmousegossipfloridaparadeanthropomorphismsufferingwhipanthropomorphic animaltitle appears in writingmentorthunderstormparachutecameloutcastmisfitteasingfriends who live togetherfablefeetracial stereotypekangaroostudio logo segues into filmhippopotamuslifting an adult into the airhalf dressed cartoon animalballadeeranthropomorphic mousestorkbarefoot cartoon animalblack stereotypebubblespeanutringmasteranimal feettalking mousebaby elephantcharacter shaped holebig earscartoon tigerdumbowalking on a clouddelivery stork (See All)

Left Behind (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Left Behind (2014)

Subgenre:
suspensemelodramadystopia
Themes:
faithreligioninfidelityadulteryfearextramarital affairparanoiaunfaithfulnesspanicapocalypse
Locations:
hospitalnew york citychurchmotorcycleairplaneairportschool busairplane accidentairplane explosion
Characters:
biblepolice officerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipchristianchristianity
Story:
prophecyconstruction sitedisappearancesuburbnews reportbridgedogbased on novelexplosionpistolshowerfirecell phonecar accidentremake β€¦shotgunslow motion scenecameraheld at gunpointrunningbirthdaycar crashjournalistambulancesuicide attemptnecklacepilotdrug addictproduct placementbaseball batcollege studentriotpickup truckdisasteranswering machinewristwatchend of the worldpreacherstealing a carchaoscigarette lighterbible quoteaviationbookstorelipstickone daywedding ringalzheimer's diseasegasolinesouthern accentwalletabandoned housestewardessdepartment storeflight attendantpassengershrinerapturelootingjewelry storeenglishwomanbible prophecyconspiracy theoristlong island new yorkbreakdancingpurse snatchercockpitobese mantanker truckemergency landinginvestigative journalistrapture aftermathcar crashing through a windowairplane passengerno cell phone signaljewelry theftmid air collisionconcert ticketfilm ends with text (See All)

Exodus: Gods And Kings (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Exodus: Gods And Kings (2014)

Epic adventure Exodus: Gods and Kings is the story of one man's daring courage to take on the might of an empire. Using state of the art visual effects and 3D immersion, Scott brings new life to the story of the defiant leader Moses as he rises up against the Egyptian Pharaoh Ramses, setting 600,000 β€¦ slaves on a monumental journey of escape from Egypt and its terrifying cycle of deadly plagues. (Read More)

Subgenre:
black comedyepicchrist allegorybiblical
Themes:
faithpoliticsreligionmurderdeathrevengesurrealismfearescapeweddingfuneraldeath of fatherbrutalityparanoiagrief β€¦illnesshopecrueltypanicdyingfreedomcouragehuntingstarvationcooking over a campfire (See All)
Mood:
raindarkness
Locations:
boatbeachdesertvillagefarmshipcavecampfirestormship explosion
Characters:
biblereference to godsoldierbrother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboybrother sister relationshipsister sister relationshipthiefjewishinterracial relationship β€¦christianitylittle boyuncle nephew relationshipfishermanbaby boyfacial tattoo (See All)
Story:
prophecyconstruction sitepromisebeardthreatunderwater scenefishsnakedogbloodviolencebondagebare chested malekissfight β€¦explosionknifechasesurprise endingfirecryingcorpseshot to deathfoodhorseshot in the chestrescuebattleswordarrestfalling from heightshowdownliehand to hand combatrunninginterrogationhallucinationcombatshot in the backsubjective cameraspysurvivalassassincandlesword fightold manaxemountainmontageeatingarmyimpalementstabbed to deathstabbed in the chestapologyno opening creditskingsearchshot in the legdrowningpainflash forwardperson on fireattackliarrace against timestatuetentknocked outdeath of childlightninghangingpursuitdeath of sonthreatened with a knifechickengeneralwhippingcowtrustarsonbattlefieldprincerioteavesdroppingdestinysabotagedestructionbow and arrowkilling an animalspearassassination attemptmass murderheavy rainhelmetslaverydiseaseragehidingfrogsheepparadetorchanimal attackmilkgoatcrushed to deathbroken legslaveeaten aliveguardshieldsufferingthunderloss of sonstabbed in the throategyptironyshot in the facedelusionexilehit on the headsibling rivalrybelief in godarmorclifftribedead boydaggerpalacehorseback ridingcameltombsaving a lifebarking dogsunsetjudaismmummydead animaldoubttreasoncrocodileplagueshoutingstabbed in the armwelltornadoseagullhearing voicesflyfilm starts with textpyramidadopted sonsense of smellsword and sandalstabbed in the shoulderempireshot in the throatarcherhonestymaggotcaravanstabbed in the facefather son reunionwaking upmilitary trainingmonumentman on firehorse and wagonshepherdfloggingancient egyptvillain not really dead clichethronehebrewoverhead shotchantinglootingcatastrophemercylambfalling off a cliffcobraquarryflaming arrowrunning for your lifemessengerhusband wife reunionegyptiandead babyguerilla warfarepharaohgallowssandstormembroiderydead fishtidal wavebased on the bibleexodusomenkiss on the foreheadwalking in the rainmarriage ceremonysphinxgrapeanimal sacrificechariotclappingvenomemancipationlanceswarmencampmentbedouinpriestesscarrying a dead bodydivine interventionold testamentreference to abrahampassovertalking to godweavingeldermosesbuilding explosioncatfishinhumanityadvisorbolt upright after nightmarecavalry chargecovered wagonwading in watergiant wavereunited familylocustnile riverpublic hangingburning a dead bodyadopted brothercradleface paintinghaillandslideloomoxenmudslidered seaspinning wheelhorse drawn wagonshiveringmountain roadten commandmentstrampled to deathviceroycrocodile attackact of godboildeath of a horseescape from slaveryseditionvolley of arrowsbiblical plaguesburning bushcamp sitesword held to throatdead duckgrand vizierox cartcanaanwedding vowsbody soreswarm of insects (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Madagascar: Escape 2 Africa (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Madagascar: Escape 2 Africa (2008)

The sequel to 2005's "Madagascar", in which New York Zoo animals, Alex the Lion, Marty the Zebra, Melman the Giraffe and Gloria the Hippo, still stranded on Madagascar, start to leave the island. All of a sudden, they land in the wilderness of Africa, where Alex meets the rest of his family, but has β€¦ trouble communicating with them after spending so much time at the Central Park Zoo. (Read More)

Subgenre:
computer animationslapstick comedycgi animation
Themes:
dancefriendshipjealousyescape
Locations:
new york cityairplaneafricajungle
Characters:
father son relationshipwitch doctor
Story:
zebraostrichgiraffedamwisecrack humorlionspidersecond partsequelnumber in titletitle spoken by characterpunctuation in titledigit in titlehorsemanhattan new york city β€¦subjective camerasurvivalambushkingold womanmistaken identitysacrificecountry name in titlefarcetalking animalblockbustersharkanimal attackzoohungerplanevolcanoduct tapeworld trade center manhattan new york citychallengepenguinlavapredatorteamworkchimpanzeecarjackingintentionally misspelled titleanimated creditsnew yorkerpoacherbirthmarkstudio logo segues into filmcratebickeringhippopotamusstar died before releasecgi filmnew york city skylinesequel with unusual numbermadagascarinterspecies romancetropicallemurimax versionwaterway (See All)

Splash (1984) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Splash (1984)

Allen Bauer is rescued from drowning as a young boy off Cape Cod by a young mermaid. Years later, he returns to the same location, and once again manages to fall into the sea, and is rescued once more by the mermaid (Allen isn't sure what he has seen and what he has imagined). Using maps from a sunk β€¦en ship, the mermaid decides to search for Allen in New York City, sprouting legs when her tail dries. On finding Allen, they fall in love, but she has a secret, which will no longer be a secret if she gets her legs wet. (Read More)

Subgenre:
fish out of water
Themes:
drunkennessweddingvoyeurismmilitarysurveillancepanicfalling in love
Mood:
car chaseaffection
Locations:
boatrestaurantbarbeachchurchhelicopterbathtubwaterelevatorurban settingpolice stationpolice carmuseumsea food
Characters:
police officersoldierbrother brother relationshipfamily relationshipslittle girllittle boyself discoverymermaidpolice arrest
Story:
water fountainrobeaquariumpublic nudityunderwater scenedinnerfishreporterdancingfemale nudityone word titlebare breastsflashbacksex scenefemale rear nudity β€¦singingchasepantiestelephone callfoodblondeface slaprescuewatching tvcamerabare butttearsvoyeurtelevisionscientistbracandlemapmarriage proposalnecklacetransformationbartenderbinocularsu.s. presidentspeechkissing while having sexnewspaper headlineapplausehypodermic needlebuttocksblockbusterimpersonationnaked womantowelfull moondentistboxer shortsice skatingsexy womanturtletuxedobroken armmusic bandviolinistt shirthappy endinginvestigatorsecret servicefountainnudesubtitleswalletshipwreckbrooklyn bridgerear nudityfemale genitaliadepartment storehead injurystatue of liberty new york cityscuba divingmotorboatpresschick flicklobsterstatue of libertyrevolving doorvillain turns goodnew york city new yorkswedishprotestorjugglingwater hoselong blonde hairexaminationbutt nakedcmnfnaked buttwoman's bare buttstruck by lightningpokieslanguage learningclothed male naked femalecmnf scenecinderella storyfish marketbullhornarm castsunken shipbare butt womanpenthouse magazinewater tankracquetballcharacter appears in newspapermedical testsiren the alarmporterlearning englishplacardcape cod massachusettsfood marketskating rinkreference to the new york yankeeslifesaverpeking chinahair covering breastsnovocainereference to the new york knicksfish factoryhypodermic needle attack (See All)

King Arthur: Legend Of The Sword (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history
Themes:
murderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneralmonsterdeception β€¦magicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All)
Mood:
rainnightmaredarkness
Locations:
boatforestlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer
Characters:
soldierbrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother sister relationshipprostitutehostagethieftough guywarrioraction herolittle boy β€¦maidwitchuncle nephew relationshipmermaidself doubt (See All)
Story:
wrecking ballwisecrack humorprophecybeardelephantfaintingwolfscreamingunderwater scenesnakebridgecharacter name in titledogbloodviolence β€¦flashbackbare chested malefighttitle spoken by characterexplosionknifechasesurprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingarmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapnonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualkingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagedestructionbow and arrowburned alivehead buttspearassassination attemptscene during opening creditshelmetslaveryroyaltyjail cellmagiciansergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeondisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dogma (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dogma (1999)

An abortion clinic worker with a special heritage is enlisted to prevent two angels from reentering Heaven and thus undoing the fabric of the universe. Along the way, she is aided by two prophets, Jay and Silent Bob. With the help of Rufus, the 13th Apostle, they must stop those who stand in their w β€¦ay and prevent the angels from entering Heaven. (Read More)

Subgenre:
independent filmcult filmblack comedyalternate historychrist allegory
Themes:
faithreligionmurderfriendshiprevengemonsterangerpsychopathobsessionredemptionapocalypseabortionforgivenessdevilunlikely hero β€¦religious faithcatholic guilt (See All)
Mood:
goresatire
Locations:
hospitalbartrainchurchbusairportroad tripcatholic church
Characters:
biblereference to godpriestchristianitycatholichomeless manreligious zealot
Period:
1990s
Story:
news reportergod as humandepiction of godwarningkindnessmiraclenews reportsequelsexbloodviolencekisstitle spoken by charactershootoutblood splatter β€¦machine gunshot in the chestbeddead bodydemonreference to jesus christstripperf wordgood versus evilnewspaperbedroomgangstabbingdrug dealertoiletnunanti herocontroversybartenderracial slurgunshotwritten and directed by cast membermissionon the roadangeltragic eventneck breakinghandgunstrong female charactertv newsuziheroinemass murderstrong female leadcompassionnew jerseymutebroken glasssex talkdespairreference to satanexileexploding headwedding ringsexual humorarmorswearingnewspaper clippingirreverencesindesert eagleanniversaryhistorical fictionmolotov cocktailcrisisgolf clubfast foodcliniccatholicismnewspaper articlereluctant herotrain ridewrathillinoismurder by gunshotcapital punishmenttequilafart jokescatological humorhomosexual subtextfemale bartenderprophetmarital infidelityoff screen murderwisconsinchosen onebroken bottleholy waterandrogynyprotestortragic villainbegins with textpenis jokemusemoral ambiguitycardinal the priestfalse namecar keysstabbed in the sidemass killingsequel mentioned during end creditsspit takevoodoo dollloss of faithfallen angelclergyabortion cliniccrisis of faitherotic dancinginside jokewalking on waterdogmaapostlearchangelblack stereotypejewish womanancient historyroller bladesvoice of godfast talkerlapsed catholictripletindulgenceskee balldoctrinegay referencetriple teen murderapocryphaview askewidolatryjay and silent bobshermer illinoisseraphimgolden calf (See All)

Southland Tales (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Southland Tales (2006)

Southland Tales is an ensemble piece set in the futuristic landscape of Los Angeles on July 4, 2008, as it stands on the brink of social, economic and environmental disaster. Boxer Santaros is an action star who's stricken with amnesia. His life intertwines with Krysta Now, an adult film star develo β€¦ping her own reality television project, and Ronald Taverner, a Hermosa Beach police officer who holds the key to a vast conspiracy. (Read More)

Subgenre:
independent filmmusic videocult filmblack comedyexperimental filmconspiracyabsurdismdystopiacyberpunkfuturisticallegoryalternate historychrist allegorydystopian futurefuture noir
Themes:
corruptiondancepoliticsmurderdeathfriendshipsurrealismsuicidekidnappingdrugsbetrayalpregnancydrinkingfearescape β€¦deceptionmilitarymemoryextramarital affairbrutalityterrorismparanoiablackmailtime traveldrug usesurveillancepanicapocalypseabortionamnesiaforgivenessself sacrificepolice brutalitypolice corruption (See All)
Mood:
raingoresatireneo noirambiguous ending
Locations:
barbeachchurchhelicopterlos angeles californiadesertelevatorpolice carofficeouter spaceoceantexascar fire
Characters:
biblepolicemanpolice officersoldierbrother brother relationshiphusband wife relationshipmother son relationshippolicefather daughter relationshipafrican americantattoosingerboygirldancer β€¦actorhostageinterracial relationshipchristianityjapanesesniperfilm directorpolice shootoutsniper riflepimpparent child relationship (See All)
Period:
2000sfuturenear futureyear 2008year 2005
Story:
news reporterprophecypicnicpress conferencemonkeyelectionamerican flagdisappearancenews reportdancingtwo word titledogsequelbloodviolence β€¦flashbackbare chested malegunkissfightcigarette smokingexplosionsingingpartyknifechasesurprise endingpistoltelephone callfirevoice over narrationcell phonesongshootoutbeatingdreamcorpseshot to deathblood splatterfistfighttesticlesmachine guncar accidentmirrorshot in the chestshot in the headshotgunslow motion scenepunched in the facewatching tvcomputerwritten by directordrinkgunfightbrawlfalling from heightshootingbookvomitingrifleheld at gunpointbeersunglassesplace name in titlecar crashdead bodyrevolverguitartelevisionscientistshot in the backf wordsubjective cameraspyfoot chaseambushcaliforniaterroristvideo cameradisguiseambulancemansiondeath of frienddrug dealermontagesuicide attemptpoliticiantoilettied to a chairinternetno opening creditsanti herodisarming someonecoffinhit by a carfictional wardouble crosspolice officer killedsearchfemme fataleshot in the legracial slurflash forwardlimousinedrug addictcharacter repeating someone else's dialoguedangerprologuespiritualityprotestkeyelectrocutionbuxomchampagnecharacter's point of view camera shotundercoverproduct placementcover upevil manknocked outreadinglightningtankstreet shootoutshot in the shoulderlong takemanipulationscarfishnet stockingsbodyguardinjectiontragic eventsplit screenfilm within a filmgovernmentlaptopmercenaryshot in the armhandgunsilencertwinfireworkscorrupt copriotak 47disastertv newsuzidestinypot smokingsyringedestructionballoonelectronic music scoremass murderbeer drinkinghypodermic needleheavy rainsecurity cameramad scientisthidingboxerkicked in the stomachswat teamjumping from heightsevered handtv showparadeviolinend of the worldfatefalse identitymexican standoffschizophreniasocial commentarybar fightiraqrealityearthquakegas maskiranpump action shotgunmiddle eastlandscapetelescopesevered fingeru.s. armydual wieldinventorhatredsmugglingpower outagechaosporn starevacuationm 16environmentalafghanistanoilenvironmental issuebible quotesenatorpunched in the chestbookstoreaccidental killingaerial shotfogmusical numberblood on shirtundercover agentrainstormalternate realityscreenwriterwedding dressbulletproof vestraised middle fingertuxedopierpolice raidextortionstadiumchainethnic slurterrorist plotenvironmental issueslightsports cargovernment agentviolinistmedia coveragesouthern accentprime ministermemory losssatellitedesert eagleimpersonating a police officermarijuana jointdoppelgangerbazookabisexualityspecial effectsterrorist groupbongtaserplastic surgeryvomitwebsitearmored carfake identityeconomicsdvdtv commercialarms dealercomputer crackerportalstandofffilm in filmglockmegalomaniacarcadeskyscraperreality showfemale spysplit personalitytwin brothershot in the eyeanarchystretcherelectric guitarbased on graphic novelferris wheelbusiness cardman kills a womancdsurfboardpalm treen wordkarmacorrupt policefight the systemsole black character dies clicheexperiment gone wrongcamcordersitting on a toiletnuclear waroverturning carnervousnesshomeless personwoman fights a mantragic endingaircraft carriernevadafourth of julynorth korearadio newssyriamolemass graveprophetcheckpointnuclear explosionrepublican partyscreenplayfreedom fighterbow tiefingerprintexploding airplanebride and groomreference to george w. bushsocial decayfake accentu.s. senatorinner title cardkicked in the groinhostile takeoverleg woundwedding cakebudweisertotalitarianismfilm starlootingmartininuclear weaponloss of memoryalternate timelinemegacorporationtalk show hostgovernment corruptionice cream truckmessiahdoomsdaymetaphysicsmushroom cloudnewscasterwoman punches a mantv camerabritish actor playing american charactermicrochipperformance artistautomated teller machinecigarette holderporn actorflying carmysterious pastvideo arcadeworld war threeevil scientistfire fightreference to karl marxtattoo parloranimal sexcivil libertiesmarxismquantum physicsshot in the sidesouthern californiamohawk haircutadult film starrun over by a carboardwalkfictional talk showfingerprintsparadoxtime travelerstar spangled bannerfriendly fireheadsetblow up dollanti conformitynight cityscapesubliminal messagesuicide contemplationdemocratic partymissile launchertroubled productionenvironmental disastermass deathlynchiansibling relationshipzeppelinblimpsphereextremismmilitary draftcantinavenice beach californiahand bandagejumping off a buildingbook of revelationi.d.paranoid schizophreniaescalationtime paradoxsanta monica californiaalternative energyrollerbladingelixirnuclear attackbowel movementamnesiacnobel prize winneranimated scenechorus lineroller bladestv newscasterduplicatefictional drugsevered thumbbig corporationadult filmracist copblade runnerpatriot actsports arenahydroelectric powerrevelationsreference to henry david thoreauroller bladerextremist groupiraq war veteranopening creditsroadsterchihuahua dogfourth dimensionpsychedelic imagesanta monica pierperpetual motiondraft noticeeverybody diespsychadelic imagetv advertface scarholding a gun to someone's headribbon cuttingwriting a checkbook of revelationsenergy shortagegun hidden under tablequantum entanglementreading from biblebud lightreality televisionreality tv starworld war iiibeach umbrellafirst placehermosa beach californiahors d'oeuvresreference to uncle sam (See All)

The Holy Mountain (1973) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Holy Mountain (1973)

A Christlike figure wanders through bizarre, grotesque scenarios filled with religious and sacrilegious imagery. He meets a mystical guide who introduces him to seven wealthy and powerful people, each representing a planet in the Solar system. These seven, along with the protagonist, the guide and t β€¦he guide's assistant, divest themselves of their worldly goods and form a group of nine who will seek the Holy Mountain, in order to displace the gods who live there and become immortal. (Read More)

Subgenre:
cult filmexperimental filmabsurdismabsurd comedycult classic
Themes:
dancereligiondeathsurrealismdrugsmoneylesbianismdrinkingfeardrunkennesstheftbrutalitydrug usepoetryexecution β€¦greedblindnessrevolution (See All)
Mood:
goresatireavant gardebreaking the fourth wall
Locations:
boatbarhelicoptersnowcemeterybathtubbuswheelchairshipmexicotunnelsex in car
Characters:
secretaryreference to godsoldierhusband wife relationshipfather son relationshipmother son relationshiphomosexualpolicechildrentattooprostitutealiendancerbabypriest β€¦thiefchristianityhomosexualityjewcatholicwriter directordeafnessactor director writerreligious iconreligious statueself delusionsex robot (See All)
Story:
biblical referenceexcrementrainbowtigerspiderelephantpublic nuditytreesnakedancingmale nuditydognuditysexfemale nudity β€¦bloodviolencebare breaststhreesomefemale frontal nuditymale frontal nuditymasturbationmale rear nuditybare chested malegunkissfightfemale full frontal nuditymale full frontal nudityexplosionpartyknifethree word titlefirevoice over narrationlickingbeatingcorpsetesticlesfoodhorsemirrorurinationshotguncomputercameradrinkswordundressingbare buttmaskshootingvomitingriflebombbedmarijuanabathroompianodemonislandreference to jesus christmale pubic hairguitaralcoholstripperold manaxemassacremountaincocainetoiletfemale pubic hairweaponnunbirdcoffinfictional wargarter beltritualjourneygraveyardcigar smokingdrowningtransformationlimousineclownspiritualitystripteasefactorywritten and directed by cast membermassagestatuedirected by starbodyguardpresidentcrossgovernmentrock 'n' rollhorse ridingpigchickensevered armflowerpoetwhippingdismembermentfull frontal nuditytransvestitecircusoccultgoldgrenadenipples visible through clothingwarehouseballoonlooking at oneself in a mirrorcakequesttouristarchitecturecomic bookhelmetmagicianmousecrucifixdemonstrationtoyplanetbarefoot malefrogproduced by directorskullgoatfemale warriorgas maskguarddwarfabsurd humorpillshippiedrummerimmortalityrowboatscissorssculpturedead childbathingmeditationfascismcanecastrationbarefoot femaleexistentialismsevered legchaintripwritten by starsymbolismmannequinteleportationchauffeurcamelceremonymale objectificationearphonescandycrucifixionjudaismapparitionmysticismmummyfountaindead animalmusclemantowercrutchesvery little dialoguefemale genitaliaamputeebroken mirrordrumseagullgoldfishlsdtaking a bathnihilismfactory workercellobayonetfinger cut offmushroommanuscriptperuchimpanzeefeathersitting on a toiletpolygamydance sceneritedead birdknittingfiring squadsurrendertoy gundogfightenlightenmentmattresspsychotronic filmaltardicephobiagurumountain climbingbanquetbreaking a mirrorcasketmars the planetthronedovevulturepilgrimageblasphemybody paintbuddhaloinclothmodern arttoadinitiationgold cointarantulatarotlambtumorsolar systemsanta claus suitcrossing selfzenhermaphroditehand kissingcadaverprocessionray gunanimal sexmarchingalchemygreen hairmohawk haircutcarrying someoneeunuchfalconleg bracegas chamberhippopotamusstrong sexual contentburning moneymidnight moviejaguarman dancing with manglass eyepsychedeliapythongeeseproduced by actorlaxativehair dyeice sculptureroman soldierstarfishmale bare butthead shavingpelicanseven deadly sinschameleoninvented languagemarketplacestoningalchemistmayanoverweight manchrist figurechief of policeslideshowmagic actwashing someonejupiter the planetspiritual journeywashing feetlima perusex in limousinemenorahsaturn the planetprosthetic body partbook of the deadhall of mirrorsoxboa constrictorlederhosencracked mirrorpeg legtoy factoryperuviantoy horsechamber potvenus the planetgold nuggetmale star appears nudepluto the planetexplicit nuditymale secretarynothingnessfan dancerpantheonfrontal nudityexotic animalneptune the planetwashing someone's feetmultiple amputeeuranus the planetman in a bathtubmating animalsmouse costumebreathing tubeglyphlever action rifle (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Night At The Museum (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Night At The Museum (2006)

In New York, unemployed and divorced Larry Daley is a complete loser. His son Nick is very disappointed with his father who is going to be evicted. Larry accepts the job of night watchman in the Museum of Natural History and takes the place of three old security guards that have just retired in orde β€¦r to raise some money and pay his bills. On his first shift, Larry soon realizes that everything at the museum is not as it seems as the statues begin to come to life after the sun sets. The Museum transforms into complete chaos with the inexperienced Larry in charge as he learns that an old Egyptian stone that came to the Museum in 1950 brings these statues to life until dawn. When Larry brings his son to spend a night with him, the three old guards break into the Museum to try to steal the magical stone. Larry organizes all the historic characters to help him stop the criminals and save the museum. (Read More)

Subgenre:
slapstick comedy
Themes:
divorce
Locations:
new york citytrainschooltaxielevatormuseummuseum of natural history
Characters:
soldierfather son relationshipnative americansecurity guardsingle father
Story:
frat packzebraostrichtelevision newslionelephantmonkeyscene during end creditsfired from the jobsnakedancingexplosionchasefirehorse β€¦car accidenturinationface slapbattlemanhattan new york citykeyperson on firecowboystatueu.s. presidentskeletonfirst partgeneralcivil warrome italylifting someone into the airassaultblockbusterbrooklyn new york cityanimal attackburglaryjob interviewchaosbookstoreice hockeydeceitarrowflat tiretorso cut in halfnew jobmagic trickfire extinguishermummywhalecentral park manhattan new york citysunrisechild custodytour guidetyrannosaurus rexcavemanbonebitingstagecoachcustodynight watchmanbubble gumpharaohcatapultstockbrokermultiple cameospilgrimfigurinemayamodel trainemployment agencyblowgunmammothdivorced fatherwatchmanstatue comes to liferemote control carchristopher columbuswoolly mammothcenturiondioramatheodore rooseveltanimate skeletonhistoric figures as charactersfaceless manmodel cardrinking fountainpathfinderwax statueegyptian curselewis and clarkwax figuremuseum of natural history manhattan new york cityroman centurionhunold man beats up young man (See All)

Anchorman 2: The Legend Continues (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Anchorman 2: The Legend Continues (2013)

Having left San Diego for New York City, Ron Burgundy is living the high life with his wife Veronica Corningstone and son Walter Burgundy. However, when the boss decides to promote Veronica to full time lead anchor and fire Ron, everything changes. Now heading back to San Diego, Ron is washed up and β€¦ working part time at Sea World. His shot at redemption though comes in the form of a man named Freddie Schapp, who's an executive producer at the Global News Network, the world's first 24 hour round the clock news channel. He hires Ron, who proceeds to reunite the news team of Champ, Brick, and Brian, and head back to New York City. While there Ron and his news team are given the graveyard shift and a challenge. Ron comes up with a radical new idea to transform the news and that puts him at the top of the game once again. But how long will Ron's newfound fame last? And will Brick finally find true love? (Read More)

Subgenre:
absurdism
Themes:
friendshipghostjealousyweddingfuneralsupernatural powerrivalryblindness
Mood:
car chase
Locations:
restaurantbarbeachmotorcyclecemeteryapartmentroad trip
Characters:
husband wife relationshipmother son relationshipfather son relationshipafrican americanphotographerinterracial relationshipaustraliancanadianemployer employee relationship
Period:
year 1980year 1979
Story:
news reporteranchormannewscasttelevision newsfired from the jobnews reportunderwater scenesecond partcatsequeldoginterviewflashbackbare chested maleinterracial sex β€¦explosionsingingslow motion scenewritten by directorcondombrawlpaintinglingeriecar crashmanhattan new york cityjournalistaxesuicide attemptnonlinear timelinetransformationcharacter repeating someone else's dialoguecharacter's point of view camera shotcharacter says i love youpsychicsubtitled scenefreeze framewerewolftv newsfamescene during opening creditssevered handsharkjournalismcommercialstupiditycameohit in the crotchscene after end creditsice skatingsoulbetfamily dinnerwritten by starhit with a baseball batbatclose up of eyeslighthouseflutepiano playingtelling someone to shut updolphininterracial kisskittenscorpionhanged mantv studiosan diego californiacrack cocainereference to michael jacksonwoman slaps a manignoranceshark attackcamera focus on female butttv stationjob promotionnewscastertv cameranews anchorray guntv broadcastbowling ballminotaurname changegreen screennewsroomtridentknife in the headreference to margaret thatcherbuttereye surgeryreference to cherreference to mtvreference to o.j. simpsontv journalistwinnebagopiano recitaltv journalismbroadcast journalismnews spoofreference to the brady bunchsea worldreference to espn (See All)

Jumanji (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jumanji (1995)

After being trapped in a jungle board game for 26 years, a Man-Child wins his release from the game. But, no sooner has he arrived that he is forced to play again, and this time sets the creatures of the jungle loose on the city. Now it is up to him to stop them.

Subgenre:
fish out of water
Themes:
friendshipsurrealismmagictime travelcouragefirst lovemissing child
Mood:
breaking the fourth wall
Locations:
beachforestmotorcyclecemeterysmall townjungleabandoned factorybicycle chase
Characters:
police officerfamily relationshipsfather son relationshipmother son relationshipmother daughter relationshipbrother sister relationshipbullypsychiatrist
Period:
1990s1960s19th century20th centurychristmas party1860syear 1969
Story:
zebralionconstruction sitefloodelephantmonkeyunderwater scenebridgeone word titletitle spoken by charactersurprise endingcar accidentshotgunarrestrifle β€¦held at gunpointhandcuffsrevolverriverorphanaxemansionapologyno opening creditschild in perilhit by a carconfessionlibraryprologuefactoryactor playing multiple rolesconvertiblesubtitled scenefireplaceheavy rainlifting someone into the airhunteroverallsblockbustercgianimal attackearthquakepresumed deadrampagestealing a carchaostime lapse photographyatticrefrigeratormutationbullet timebatimpersonating a police officerhiding in a closetcrocodiletween girlshoefriends who live togetherboard gamefather son reunionmotorcycle coprecluseimprovised weaponbased on children's bookanimal killingloss of parentsrainforestlootinggiant spiderhuman becoming an animalrhinocerossanta claus suitauto theftmosquitogiant insectchestexterminatorvortexnew hampshirequicksandstampedegun storetailconveyor beltaltering historypelicaninvestment bankertrailer narrated by hal douglasmonsoonsporting goods storepoison ivybig game hunterinsect attackcarnivorous plantyear 1869dybbuk boxcar through wallanimal driving a cartrailer narrated by nick tate (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Brand New Testament (2015) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brand New Testament (2015)

God lives in human form as a cynical writer with his young opinionated daughter in present-day Brussels, Belgium. She concludes that her dad is doing a terrible job and decides to rewrite the world, descending to earth in search of her own 6 messengers to write a brand new testament and change the s β€¦tatus quo. (Read More)

Subgenre:
martial artsblack comedydark comedyabsurdism
Themes:
religionmurderdeathfriendshipinfidelitymoneyadulteryescapememoryangertheftinsanityunfaithfulnessillnesssadism β€¦homelessnessfalling in lovephilosophy (See All)
Mood:
rainsatiresurreal
Locations:
hospitalbeachchurchairplanebathtubbicycleelevatorapartmentseacampfiretunnelearth
Characters:
biblereference to godpolice officerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboybrother sister relationshipprostituteserial killernursebaby β€¦priestchristianitysnipercousin cousin relationshipgermandaughterolder woman younger man relationshiphomeless mandancing girlboy girl kiss (See All)
Story:
changetelevision newsgorillatigermiraclelawpublic nudityfishdancingnuditysexbloodbare breastsfemale frontal nuditybare chested male β€¦fightcigarette smokingtitle spoken by charactersingingtelephone calltopless female nudityvoice over narrationcryingcell phonesongbeatingdreamunderwearblood splattercar accidentmirrorwatching tvcomputerbikinikissingbare buttfalling from heightpaintingriflebeerrunningbedneighborreference to jesus christclassroomstripperf wordsubjective camerafoot chasecandleaxemontagesuicide attemptfemale pubic hairchild abusecoffinbathvanlooking at the cameratalking to the cameralibraryprologuekeydollreadinglightningscreamshot in the shoulderinjectionpursuitcrossbasementsadnesschickenshot in the armfreeze framestrong female characterrecord playersurgerycircuseyeglassesapplausetv newsbulletkilling an animaldresslooking at oneself in a mirrorcakescene during opening creditshathappinesscowboy hatmousecrucifixwatching a movieswimsuitimprovisationladderstrong female leadhomefatedead womanmilkwatching televisionmovie theatrebarefootmale prostituteadventurerbra and pantiesgrocery storenicknametrappedboxer shortscynicismblood on facebackpackhatredkickinginsectshovelmakeupthunderstormheavenbutterflyairplane crashbalconyrefrigeratorbriefcaserecording studiobriefsinjusticearrowbrushing teethglobal warmingtelekinesisholding handsirreverencelaundryrunning awaydead animalepisodic structurereading aloudname callingvacuum cleanertrailer homefalling into waterbare chested boylocked doorpark benchapewashing machinechapter headingssick childgodbreaking a mirrorsleeping on a couchoverhead shotgospeljumping out a windowevangelistred light districthair dryerwatching someonebeing watchedmodel airplanehead bandagepeep showhula hoopdining halldisembodied handbrussels belgiumpenis slurwoman in a bathtubreference to allaharm castslip the undergarmentringing phoneringing telephonefile cabinetsuntan lotionadam and eveelderly manlocked uptext on screengarbage binjumping from a windowhit in the stomachwalking on waterarchitectural modelsiren the alarmliving alonesoup kitchenapostledestroying propertyempty swimming poolpregnant manwaiting in linesex maniacreference to franz schubertreference to the titanicreference to johann sebastian bachanimated sceneboy dressed as a girlshopping centerwall clockreference to marcel proustarctic circlecartoon chickentesticles slursleeping on a benchvomiting in a toiletboy dressed as girlmace spraydistorted soundreference to jean claude van dammeview through rifle scopeeye maskfield hockeyreference to baalsmall apartmentcartoon fishtouching handsmissing toothreflection in a windowromance subplotartificial armman in a bathtubmentally challenged malereference to pokemonamputated armapostlesbreaking a dishdefecation slurstolen keylast supper painting (See All)

Bedknobs And Broomsticks (1971)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bedknobs And Broomsticks (1971)

During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β€¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)

Subgenre:
live action and animation
Themes:
dancedeathfearmagicmilitaryangerpanic
Locations:
beachmotorcyclesmall townlondon englandbicyclevillageenglandcastlejunglemuseumtrain stationsubmarine
Characters:
soldierbrother brother relationshipchildrensingerboydancermusicianpriestlittle girllittle boywitchgermanhuman animal relationship
Period:
world war two1940syear 1940
Story:
hyenaostrichgiraffegorillalionfraudelephantwaitermonkeybearfishdancingfightexplosionsinging β€¦knifepistolfirecryingbased on booksongmachine gunmirrorpunched in the facebattleswordletterbookriflebombrunningbedbritishislandcompetitioncombatorphansoccerflashlightcandleold manchilddream sequencefishingkingcigar smokingnecklacetransformationgunshotlibrarybinocularsuniformfantasy sequencetentrabbitscreampianistpursuitcountrysideunderwaterapplauseropecaptainentertainmentgrenadebow and arrowathleteflyingspearperformancelifting someone into the airragemagiciancaptivemousetoyenemywitchcraftaudiencepart animationparadecolonelfull moonanthropomorphismshieldexplosiveinvasionanthropomorphic animalevacuationdrummerballcon artistlaughterarmorcliffraidsailortrophypigeoncrowdmusic bandposterrefereeplaying cardsimprisonmentspellauntmagic tricknotebookchoreographystreet marketbicyclingperformertween girlwhistlecrowndrummedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiometamorphosisunsubtitled foreign languagepotionpalm treealligatortrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentkangarooapprenticeliquidpet catanimal that acts humanlockballroomvulturehookmarchstreet vendorbroomretreatscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerleopardlongingvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelineincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingroarcalypsochorinegoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All)

Borat: Cultural Learnings Of America For Make Benefit Glorious Nation Of Kazakhstan (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Borat: Cultural Learnings Of America For Make Benefit Glorious Nation Of Kazakhstan (2006)

Borat Sagdiyev is a TV reporter of a popular show in Kazakhstan as Kazakhstan's sixth most famous man and a leading journalist. He is sent from his home to America by his government to make a documentary about American society and culture. Borat takes a course in New York City to understand American β€¦ humor. While watching Baywatch on TV, Borat discovers how beautiful their women are in the form of C. J. Parker, who was played by actress Pamela Anderson who hails from Malibu, California. He decides to go on a cross-country road trip to California in a quest to make her his wife and take her back to his country. On his journey Borat and his producer encounter a country full of strange and wonderful Americans, real people in real chaotic situations with hysterical consequences. (Read More)

Subgenre:
fish out of water
Themes:
religionfriendshiprapemoneydrinkingdrunkennessweddingincesttravelobsessionparanoiahumiliationgamblinghomophobiadeath of wife β€¦abortion (See All)
Mood:
rainsatire
Locations:
boatnew york citybarchurchswimming poolhotelcarsmall townairplanelos angeles californiabathtubbusdesertairportelevator β€¦villageroad tripcitytruckrussiacampfiretexasbrotheltownused car (See All)
Characters:
reference to godbrother brother relationshiphusband wife relationshipmother son relationshipfather son relationshiphomosexualfriendchildrensingerbrother sister relationshipprostitutedancerchristianjewish β€¦security guardjewsheriffmuslimmother in law son in law relationship (See All)
Story:
weather reportclock radiofaintingwashington d.c.bearamerican flagpublic nuditysnakereporterprayerdancingmale nuditybloodinterviewmale frontal nudity β€¦masturbationmale rear nuditygunphotographmale full frontal nuditysingingknifechasetelephone callsongunderweartesticlesfoodmachine gunhorseurinationwatching tvdrinkarrestthongbare buttpaintingbeerbombrunning69 sex positionbathroomneighborhandcuffsreference to jesus christmanhattan new york cityalcoholtelevisioncaliforniaterroristwomaneatingtoiletsubwaymapman with glassesbathcontroversyold womanmarriage proposallooking at the cameragravemicrophonevirgincostumepay phonepoisonon the roadsuitcasedollreadingflowerspursuithairy chestcrosspigfeminismchickenitaliantv newspornographyreference to adolf hitlerwoman with glassesspin offmousecrucifiximpersonationculture clashhitchhikerpreacherembarrassmentiraqpassportmechanicstupidityredneckgypsyremote controlanti semitismministermisunderstandingobesityfeministdespairhighwaysexual humormustachepastortrophymisogynypajamascrowdsunbathingphoto albumshamevideo tapeporn magazinegamblerdinner partycar drivingcentral park manhattan new york citymisogynistcockroachescalatormental retardationlizardtv reporteranimal crueltyunited states of americaembassydisappointmenttravelingcheesealabamarodeoawkwardnesstimes square manhattan new york citytv studiofirst gay sexual experiencecrotch grabruntelegramcultural differencedallas texaspitchforkcross countrydigging a gravereference to michael jacksonignoranceclumsinessping pongbanquethummervcramerican southcar salesmanchopping woodice cream truckrunning out of gasantique shopbig citybook signingchevroletdriving lessonhair dryerhigh fivetv producertable tennisipodwhite horsebed and breakfaststar spangled bannerbreast milkpublic urinationbarbie dollmalibu californiatortoisewar on terrorgun storetelevision studiohomoerotic fightslangone armed manmotor homemale chauvinismnude fightstreakingbear attacketiquettekazakhstanwhite male pretending to be blackfalling off horseline dancingamerican midwestpixilated nudityweathermancoprophiliacultural conflictincest jokenewspaper adcrucifix pendantdriving instructorgay pride paradereference to laurel and hardysardonichorse and carthospitalitybroken dishgarage salegun shopabortionistattempted kidnappingcultural misunderstandingjewish stereotypereference to pearl harborspeaking in tonguesdesk clerkmechanical bullbooingplowrunning nakedu.s. congressmanjfk international airport queens new york cityrevival meetingporno video911 conspiracy theorypentecostalgiant eggsex with mother in lawfraternity brotherreference to pamela andersontable mannerskazakhmasturbation in publicreference to david hasselhoffweather mapabortion jokedrinking while drivingintentional mistranslationtv weather show911 jokechubby sexdriving against trafficmortgage brokerpotassium (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Mr. Smith Goes To Washington (1939)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mr. Smith Goes To Washington (1939)

Naive and idealistic Jefferson Smith, leader of the Boy Rangers, is appointed on a lark by the spineless governor of his state. He is reunited with the state's senior senator--presidential hopeful and childhood hero, Senator Joseph Paine. In Washington, however, Smith discovers many of the shortcomi β€¦ngs of the political process as his earnest goal of a national boys' camp leads to a conflict with the state political boss, Jim Taylor. Taylor first tries to corrupt Smith and then later attempts to destroy Smith through a scandal. (Read More)

Subgenre:
political drama
Themes:
corruptionpoliticsmurderdeathdrunkennessamerican politics
Locations:
office
Characters:
secretarymother son relationshipfather daughter relationshiplawyeramerican
Period:
1930s
Story:
congressdamfaintingwashington d.c.giftdinnerreportercharacter name in titlephotographpunctuation in titlecar accidentlieplace name in titletelephonenewspaper β€¦bandsuicide attemptmarriage proposalgunshotcity name in titlespeechnewspaper headlineclaim in titlehatcampcrushrailway stationframe upsenatorbriefcasepunchpigeonpolitical corruptionpatriotismethicsdead fathereditorgovernornaivetyidealismframedconservativemarching bandrespectconsciencetelegrammonumentbanquetu.s. senatorpolitical protestgovernment corruptionmedia manipulationsenatecreekdonationu.s. congressguilty conscienceprinting presssightseeingdistractionu.s. vice presidentcoin tossexpulsionpolitical rallysleep deprivationslanderu.s. senatecharacter appears on front page of a newspaperappointmentbilllincoln memorialgraftmedia tycoongovernment hearinglost causefilibusteru.s. capitol building washington d.c.aidestoogeyouth camp (See All)

Groundhog Day (1993) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Groundhog Day (1993)

A weather man is reluctantly sent to cover a story about a weather forecasting "rat" (as he calls it). This is his fourth year on the story, and he makes no effort to hide his frustration. On awaking the 'following' day he discovers that it's Groundhog Day again, and again, and again. First he uses  β€¦this to his advantage, then comes the realisation that he is doomed to spend the rest of eternity in the same place, seeing the same people do the same thing EVERY day. (Read More)

Subgenre:
cult filmfish out of wateralternate historychrist allegorytime travel comedy
Themes:
deathfriendshipsurrealismsuicidekidnappingdrunkennesstime travelredemptionhopehomelessness
Mood:
car chasenight
Locations:
restauranthospitalbartraincarsnowsmall townbathtubwaterpolice carusapennsylvania
Characters:
policemusicianwaitressmayorpolice chaseself discoveryinsurance agent
Period:
1990swinter
Story:
weather reportclock radionewscastkindnessalarm clockweatherwaiterautomobilescreamingdancingtwo word titlekisscigarette smokingtitle spoken by characterexplosion β€¦singingchaseshowerfiresongcorpsefoodcar accidentface slapslow motion scenewatching tvdrinkfalling from heightsunglassesanimal in titlebeddead bodypianoalcoholtelevisionvideo camerawomandinerexploding carmarriage proposalcoffeemicrophonedangercostumeelectrocutiondatecharacter says i love youmagical realismjazzholidaypickup truckchainsaweyeglassestv newshuggingsabotagecagescene during opening creditslifting someone into the airhathappinessmorguemovie theaterfestivalcompassionclockstealing a cartrappedattempted suicidecynicismshovelimmortalityfrustrationdead manalternate realityprison cellsnowingchairexistentialismlaughinglyingflat tireirreverenceceremonyhappy endingbag of moneyyellingdirector cameogaterepeated sceneglovesidealismcameramanmaking outhit by a truckblizzardday in titlebumtv studiohit with a shovellighting a cigarettepsychotherapysnowmanwoman slaps mantime looppencilpolice sirencocktailtop hatpittsburgh pennsylvaniamusical instrumentsittingdeja vualternate timelinenewscasterprovincial lifestealing moneymultiple outcomesauto theftrepeated eventblack glovesdinner datemaid uniformwearing sunglasses insidecold weathersnowball fighttv broadcastneon signtime warpfreight trainlifting a female into the airbed and breakfastlifting an adult into the airjazz bandgluttonyrepetitionpiano lessonmouth to mouth resuscitationkissing in publicice sculpturedying repeatedlyweathermanreference to anton chekhovdeadpanrodentheimlich maneuverpuddlegratitudechroma keyfrench maid costumegood deedsiren the alarmwhite glovesfemale slaps maleflashing lightblue screenbox officelighting a cigarette for a womanlighting someone's cigaretteweather forecastertrapped in a time loopmemorizationweather forecastingidentifying a dead bodywhiskey bottlemale musiciandrinking whiskyearly morninglighting cigarette for womanweather mapdirndl dressgroundhoglifting a woman into the aireternal recurrencefriendlinessgroundhog day (See All)

The Jungle Book (1967)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Jungle Book (1967)

Abandoned after an accident, baby Mowgli is taken and raised by a family of wolves. As the boy grows older, the wise panther Bagheera realizes he must be returned to his own kind in the nearby man-village. Baloo the bear however thinks differently taking the young Mowgli under his wing and teaching  β€¦that living in the jungle is the best life there is. Bagheera realizes that Mowgli is in danger, particularly from Shere Khan the tiger who hates all people. When Baloo finally comes around, Mowgli runs off into the jungle where he survives a second encounter with Kaa the snake and finally, with Shere Khan. It's the sight of a pretty girl however that gets Mowgli to go the nearby man-village. (Read More)

Subgenre:
2d animationdisneybuddy comedyhand drawn animationtraditional animation
Themes:
friendshipsurrealismkidnappingabductionadoption
Mood:
rainnight
Locations:
villagejungleindiajungle book
Characters:
friendsingerboygirlhuman animal relationshipbaby boy
Period:
19th century1890s
Story:
tigerelephantwolfmonkeybeartreesnakedancingdogbased on novelfighttitle spoken by charactersingingthree word titlefire β€¦voice over narrationrescueriverorphanstrangulationdisguiseanimalnarrationkingactor playing multiple rolesfirst partwildlifecross dressingtalking animallifting someone into the airblockbusterfaked deathcolonelanthropomorphismbarefootticklingchild protagonistanthropomorphic animalhypnosisthunderstormblack eyebananamusical numberdeerhappy endingrunning awayjazz musicfruitbare chested boyanthypnotismmale protagonistcactusfriends who live togetherfamous scoretitle same as book10 year oldanimal that acts humanvultureyoung boyabandoned babysong and danceorangutanpantherwild animalcastle thundersurrogate familyorphan boycartoon bearwolf packtalking birdferal childlead singerblack pantherwild childcroonersinging animalancient ruinshuman animal friendshipbackup singerstorybook in opening shotcartoon wolfinterspecies friendshiptalking bearroaringcartoon elephanthappy go luckywolf cubanimal licking someonecartoon monkeyspiraling eyescartoon tiger10 year old boyhuman bear relationshiptalking snaketalking wolf (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ghostbusters (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ghostbusters (2016)

Subgenre:
supernaturalparanormalslapstick comedyparanormal phenomenaparanormal investigation
Themes:
friendshipsurrealismsuicideghostfearescapemonsterinvestigationdeceptionsupernatural powerparanoiasurveillancepanicapocalypsenear death experience β€¦unlikely hero (See All)
Locations:
restaurantnew york citybarhotelmotorcycletaxipolice carrooftoptaxi driverlaboratorytunnelfire truckchinese restaurantfire station
Characters:
secretarypolice officerpoliceafrican americanfemale protagonistsecurity guardprofessoraustralianmayorengineerfemale scientist
Period:
2010s
Story:
fish tanknewscastwisecrack humoraquariumpress conferencescene during end creditsfired from the jobscreamingnews reportreporterdancingf ratedone word titleflashbackbare chested male β€¦fightphotographtitle spoken by characterexplosionknifechasesurprise endingpistoltelephone callfirecell phonefistfightmachine guncar accidentface slapremakerescueslow motion scenepunched in the facebattlebrawlfalling from heightbookvomitingshowdownbombrock musiccollegemanhattan new york citycombattelephonescientistgood versus evilflashlightnew yorkconcertmansionmontagearmydinersubwaymapexploding carman with glassesno opening creditsdrawingdouble crosscontroversycreaturevantransformationcoffeeracial slurone against manylibraryauthorcharacter repeating someone else's dialoguedangerelectrocutionuniformpossessionproduct placementdragonrace against timecover upknocked outopening action sceneexploding bodybasementtraphauntingfeminismhaunted houseobscene finger gesturebased on filmgraffitibattlefieldpizzaocculttv newsanswering machinefalling down stairsgrenadeflyingballoonwoman with glassessociopathgroup of friendswalkie talkiemad scientistexploding buildingeccentricwristwatchgiantyoutubeflatulenceimprovisationmind controllasercgiend of the worldaction heroineinterracial friendshipblack womanrampagecameojanitorstealing a cartarget practicerock concertinvasionmisunderstandinginventorjob interviewpower outage3 dimensionalevacuationmentorscene after end creditsthrown through a windowassault rifleaerial shotbody landing on a carraised middle fingerdressing roomgadgetethnic slurgovernment agenttelekinesisexorcismunclegrenade launchersurprise after end creditsmedia coveragefirefighteralleyfinal showdownfire extinguishertimebombvomitsubway stationarmored cargiant monsterevil spiritfriendship between womenportalworld dominationmegalomaniaccheering crowdcameo appearancereceptionistinternet videohearsecollege professortour guiderunning gagfinal battletimes square manhattan new york cityteamworkcamcorderreference to googledance scenerealtorcrowbarfart jokeimprovised weapondelivery manspray paintalternate dimensionreference to batmanglowing eyesslimepoltergeistrevolving doorhit by a trainslow motion action scenephysicistgadgetryportrait paintingsurprise during end creditsnypdfemale vomitingmob of reportershot dog standphone ringingweaponrycollapsing buildingblowtorchexploding motorcyclecharacter appears on tvgiant creaturegrandfather clockvortexrebootspit takenational guardaudio recordingclichelogosecret laboratoryhaunted mansiondisco dancingparanormal investigatorringing phoneskepticreference to peter panhit in the groinghostbusterman wearing a tuxedogongcharacter appears on front page of a newspaperdisbelieving adultlovecraftiancollege deanghostbustersemployee dismissalparanormal phenomenonresearch facilitywhite hairappeared on tv newsfour friendsoccultismprojectile vomitingreboot of seriescareer changereference to the titanicsubway tunnelcrowd surfinginanimate object comes to lifeexperimental technologychinese takeoutswiss army knifedisaster in new yorkguided tourauthoresswoman slaps a womanmannequin comes to lifeparanormal expertreference to clark kentreference to p.t. barnumsmashing a guitarmale secretaryproton packbelief in ghostsgrafittifull bodied apparitionmaking coffeeparanormal investigation teamreference to amazon.comstage divingback hand slapcompany logofemale inventorreference to patrick swayzethrown through the airyear 1894fartingghost hunting equipmentenergy beamfaraday cagefemale business ownerfemale engineerkilled by ghostselfie stickpopping a balloon (See All)

Dave (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dave (1993)

Bill Mitchell is the philandering and distant President of the United States. Dave Kovic is a sweet-natured and caring Temp Agency operator, who by a staggering coincidence looks exactly like the President. As such, when Mitchell wants to escape an official luncheon, the Secret Service hires Dave to β€¦ stand in for him. Unfortunately, Mitchell suffers a severe stroke whilst having sex with one of his aides, and Dave finds himself stuck in the role indefinitely. The corrupt and manipulative Chief of Staff, Bob Alexander, plans to use Dave to elevate himself to the White House - but unfortunately, he doesn't count on Dave enjoying himself in office, using his luck to make the country a better place, and falling in love with the beautiful First Lady... (Read More)

Subgenre:
conspiracypolitical satirepolitical conspiracypolitical comedypresidential comedy
Themes:
corruptionpoliticsunemploymentaffair
Mood:
satire
Locations:
bicyclesinging in the shower
Characters:
husband wife relationship
Period:
1990s20th centuryyear 1993
Story:
election campaignchief of staffcongresspolitical campaignpress conferencewashington d.c.fired from the jobcharacter name in titledogtitle spoken by charactershowerpoliticianman with glasseslimousinelocker room β€¦cover upu.s. presidentspeechbodyguardpresidentpigcomasex on floordysfunctional marriageimpersonationwhite houseimpostoramerican presidentpolitical corruptionmale in showerdoppelgangerforename as titlemagic trickdirector cameosandwichsecret servicedual rolebarberstrokepolitical candidatetour guidelook alikefirst ladyoval officepenu.s. senatorscrapbookloveless marriagesocial activismdoublegovernment corruptionimpersonatorbody doublepressuresupreme courtdoughnutcar dealeru.s. vice presidentpolitical cover uptwentieth centuryemployment agencyreference to lyndon johnsonbudgetairforce onereference to franklin d rooseveltintensive caresubstitutionu.s. congressmantelepromptertemporary workerimpeachmentcorgicampaign headquarterscabinet meetingnational mallportrait of george washington (See All)

Madagascar 3: Europe's Most Wanted (2012) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Madagascar 3: Europe's Most Wanted (2012)

Alex, Marty, Gloria and Melman are still trying to get back to the Big Apple and their beloved Central Park zoo, but first they need to find the penguins. When they travel to Monte Carlo, they attract the attention of Animal Control after gate crashing a party and are joined by the penguins, King Ju β€¦lian and Co., and the monkeys. How do a lion, zebra, hippo, giraffe, four penguins, two monkeys, three lemurs travel through Europe without attracting attention and get back to New York? They join a traveling circus. Their attempts to get back to New York are consistently hampered by the Captain of Animal Control who wants to make Alex part of her collection. Once they make it back to New York Marty, Alex, Gloria and Melman realize that they want to be part of the traveling circus. (Read More)

Subgenre:
cgi animation
Themes:
moneygambling
Mood:
nightmare
Locations:
trainmotorcyclelondon englandafricasinging on airplane
Characters:
childrenlittle girllittle boylatino
Story:
zebragiraffetigerlionbeardancingsequeldognumber in titleexplosionfiredigit in titlehorselienumbered sequel β€¦animalthird partattempted murderfireworkscircuscountry name in titletalking animalrome italyzoodynamiteknife throwingwilhelm screambullet timepenguintrain ridepoacheratlantic oceanseal the animalnumber 3 in titlehippopotamusjaguarrussian accentafromonte carlocontinent in titleisland name in titletrapeze artisttightropeitalian accentlemursentimental (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Fantastic 4: Rise Of The Silver Surfer (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fantastic 4: Rise Of The Silver Surfer (2007)

Everything seems to be going great for the Fantastic Four. Reed and Sue are finally getting married, and things couldn't seem better. However, when the mysterious Silver Surfer crashes things, they learn that they will have to deal with an old foe, and the powerful planet eating Galactus.

Subgenre:
superhero
Themes:
murderkidnappingmarriagetortureescapeweddingmilitarytheftsupernatural powerblindness
Locations:
new york citybarforesthelicopterairplanelos angeles californianightclubdesertlondon englandairportjapanouter spacespacechinagermany β€¦tunnelfishing boatairshiphelicopter accident (See All)
Characters:
soldierbrother sister relationshipalienpriesthostagejapanese
Period:
2000s
Story:
television newswashington d.c.bearscene during end creditspublic nuditynews reportreportersecond partdancingcharacter name in titlesequelnumber in titleexplosionchasepunctuation in title β€¦digit in titlerescuewatching tvfalling from heightmaskinterrogationscientistgood versus evilbased on comic bookarmystabbed in the chestdouble crosstransformationperson on firegeneralnewspaper headlinestrong female charactermissilecaptainflyingtouristmutantplanetstrong female leadu.s. armyresurrectionsuper villainscene after end creditsmarvel comicssuperheroinehologramgeniussatellitedjfemale soldierfianceeinvisibilitypyramidstatue of liberty new york cityuniversesuperhero teamsurfboardasteroidkimonopressmercedes benzsiberiasuper powerford mustangsuperhuman strengthbachelor partyglacierforce fieldbaseball stadiumcanceled weddingshanghaigreenlandstudio logo segues into filmclubbingwashington monumentcranesilvermarvel entertainmentsphinxshanghai chinad.j.cratergreat wall of chinapyrokinesisexploding planetlondon eyeriver thameselasticityford motor companyinvisible womanfantastic fourabsorbing powerdartboardcosmicearth in perilmoleculenokiagiza egyptscientist heroblack foresthuman torchloss of fianceesuperhero couple (See All)

The Brothers Grimsby (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brothers Grimsby (2016)

MI6's top assassin (Mark Strong) has a brother. Unfortunately for him, he's a football hooligan (Sacha Baron Cohen) from the town of Grimsby. Nobby has everything a man from the poor English fishing town of Grimsby could want - 9 children and the most attractive girlfriend in northern England (Rebel β€¦ Wilson). There's only one thing missing in his life: his little brother, Sebastian. After they were adopted by different families as children, Nobby spent 28 years searching for him. Upon hearing of his location, Nobby sets off to reunite with his brother, unaware that not only is his brother an MI6 agent, but he's just uncovered a plot that puts the world in danger. On the run and wrongfully accused, Sebastian realizes that if he is going to save the world, he will need the help of its biggest idiot. (Read More)

Subgenre:
martial artsblack comedyconspiracyabsurdismslapstick comedyfish out of waterbuddy comedygross out comedyspy spoof
Themes:
murderdeathfriendshiprevengekidnappingdrugsbetrayaltorturedrunkennessescapedeceptionseductiontheftbrutalityterrorism β€¦dysfunctional familyredemptionsurveillanceadoptionpanicunemploymentaids (See All)
Mood:
goresatirecar chasejames bond spoof
Locations:
boathospitalbartrainhotelhelicoptermotorcyclesmall townairplanebathtubbuslondon englandbicyclewheelchairpolice car β€¦englandshipmuseumtrain stationsex in publiccar in watertwo in a bathtubboy in wheelchairboy in a wheelchairfishing town (See All)
Characters:
policemanpolice officerbrother brother relationshiphusband wife relationshipmother son relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshiphostagetough guyactress β€¦warrioraction herohitmansecurity guardalcoholicmaidsnipersniper riflepolice chase (See All)
Period:
2010szip line
Story:
zebrawisecrack humortigerfloodpress conferenceelephantscene during end creditspublic nuditynews reportunderwater scenefishbridgecharacter name in titledogblood β€¦violenceone word titlebare breastsflashbackmale rear nuditybare chested malegunfightcigarette smokingejaculationphotographtitle spoken by characterexplosionknifechasesurprise endingerectionpantiespistoltopless female nuditycell phoneshootoutbeatingcorpseshot to deathblood splatterfistfighttesticlesmachine guncar accidentshot in the chesturinationshot in the headshotgunrescueslow motion scenepunched in the facewatching tvcameracondomarrestgunfightbrawlbare buttfalling from heightshowdownheld at gunpointbeerhand to hand combatsunglassesplace name in titlecar crashinterrogationbritishmale pubic hairscientistshot in the backf wordsubjective cameradecapitationspyfoot chasegay slurorphansoccerassassinambushterroriststrangulationvideo cameradisguisedrug dealermontageimpalementmixed martial artstoiletstabbed in the chestfemale pubic hairmapwhite pantiesexploding carfalse accusationsevered headscantily clad femaledisarming someoneone man armychild in perilhit by a cardouble crossfemme fataleshot in the legshot in the foreheadon the runflash forwardlimousineone against manybinocularscharacter repeating someone else's dialoguebeaten to deathdangerperson on firefugitivepoisoncharacter's point of view camera shotmissionundercovermistaken identityrace against timecover upknocked outkicked in the faceopening action scenestreet shootoutshot in the shoulderbodyguardinjectionexploding bodyneck breakingmercenaryprofanitysecret agentsilencerfireworksbare chested male bondageclass differencesespionagepubheroinfreeze framestylized violencehenchmangirl in pantiesriotak 47eavesdroppingmissilefalling down stairsburned aliverevelationhead buttassassination attemptwarehousefarcehypodermic needlescene during opening creditsviruswalkie talkieworking classexploding buildingkicked in the stomachvillainessswat teamjumping from heightculture clashsouth africaorphanagerocket launchermexican standoffcrushed to deathsocial commentarymasked manstupidityreverse footagehaunted by the paststealing a carface paintobesityimpostorchaospool tableevacuationkicked in the crotchescape attemptscene after end creditspunched in the chestjumping through a windowassault rifleinfectionaccidental killingaerial shotundercover agentbulletproof vestbody landing on a carraised middle fingerstadiumgadgetlasersightterrorist plotburned to deathcrude humorwritten by stargrenade launchersurprise after end creditsfast motion scenebullet timerockettracking deviceenglishman abroadsatellitedesert eagleshot through a windowmale objectificationabandoned buildingbazookaterrorist groupalleycartoon on tvfinal showdownpromiscuous womantasershot in the neckdrug smugglingdefecationpistol whipassumed identityarmored carfake identityparkourarms dealertwo man armydronevulgaritymegalomaniacyoung version of characterbunkercommandercheering crowdflarehired killerexploding truckreference to donald trumpmooningman kills a womanhiv aidssaving the worldnymphomaniactop secretfilmed killingshot in the throatmetal detectorsoccer ballsoccer matchspaexploding housefart jokecamera phonescatological humorfundraiserimprovised weaponshot in the crotchwrongful arrestassassination plotbreaking a bottle over someone's headsocial decayvillain arrestedfake accentinnocent person killedfirecrackerticketthrown from a cartoilet humorhidden gunchild swearinggross out humorantidotegadgetryreference to harry pottersexual innuendopenis jokedouble entendrehooligansurprise during end creditswater hosegadget carbiological weaponugandaodd couplethick accentchambermaidsantiago chileanimal sexblack opsfirst personshipping containerbritish secret servicegay jokebritish intelligenceover the topthrown from heightcontact lensukrainiansibling relationshipsouth africanbleeped dialoguecoastal townnorthern englandsex jokecontroversialbroken anklediving suitpoison dartpool ballsideburnsmi6drug smugglerestranged brotherphilanthropistchavgreen dresscriminal organizationjakarta indonesiaman in bathtubhit squadbioterrorismreference to ben affleckbrother brother incestbiochemistjumping from a bridgereference to sharon stoneblood sprayreference to vin dieselsuperspyvulgarblood streamlow brow humorsoccer hooligantwo males in bathtub (See All)

Willow (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Willow (1988)

A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village β€¦ council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)

Subgenre:
martial artscult filmfairy talesword and sorcerydark fantasysword and fantasychrist allegory
Themes:
friendshiprevengesurrealismkidnappingbetrayaladulteryescapemonsterheromagicredemptionsadismcourageforgivenessbook of magic
Mood:
rainpoetic justice
Locations:
boatforestsnowvillagefarmlakecastlecampfireroad movie
Characters:
soldierfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrenbabywarriorbest friendlittle girllittle boyvillainwitch β€¦self discoverycrying babybaby girl (See All)
Story:
bird poopostrichkindnesscrowtigerprophecyloyaltycatdancingcharacter name in titledogbloodone word titlekissfight β€¦title spoken by characterknifechasecryinghorsepunched in the facebattleswordfalling from heightmaskbookshowdownhand to hand combatislandrivercombatsubjective cameragood versus evilsword fightmountaindisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualjourneyold womanprincesstransformationcursemissiondragontentkicked in the facelightningskeletonfarmerbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyspearheroineheavy raintalking animalcagequestcatfightlifting someone into the airloss of friendhidingvillainessanimal attackgoatapplefemale warrioradventurerdwarfshieldfairywizardrowboatexiledungeonpassionate kisskingdomblack magicwilhelm screamsmokedaggerhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingpotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Adam's Apples (2005) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Adam's Apples (2005)

Ivan is a priest in a rural church known for the apples that grow on a large tree in front. He's odd: seeing the world through rose-colored glasses, in denial about personal facts, and convinced he's at war with Satan. The rectory is a half-way house for recently paroled convicts. Adam arrives for 1 β€¦2 weeks, a large, tough neo-Nazi, first baffled by Ivan's thick-headed optimism, then angry. He vows to break Ivan's faith. Meanwhile, in exasperation at Ivan's insistence, Adam sets a personal goal: to bake an apple pie. All goes awry for the tree: crows, worms, lightening. The Book of Job gives Adam perverse insight, and his hooligan mates provide the resolution's spring. (Read More)

Subgenre:
black comedydark comedyallegoryparable
Themes:
faithpoliticsreligionmurderdeathlovesuicidemoneypregnancydrinkingfeardrunkennessfuneralmemoryrobbery β€¦angertheftdeath of mothercancerredemptionillnessdeath of wifedyingabortionforgivenessdeath in childbirth (See All)
Mood:
rainsatire
Locations:
hospitalchurchbusbicyclerural settingwheelchairgas stationstorm
Characters:
biblereference to godfather son relationshipdoctortattoosingerbrother sister relationshippriestthiefchristianlittle boyalcoholicpregnant woman
Story:
crowmiraclefaintingtreecatcharacter name in titlebloodviolencebare chested maleguncigarette smokingsingingpistolfirecrying β€¦cell phonesongbeatingunderwearshot in the chesturinationface slapshot in the headdrinkshootingbooklierifletearsbirthdaytelephoneshot in the backgood versus evilgay slurflashlightcookinggangold manweaponchild abusebirdvanshot in the legracial slurwidowerlightningattempted rapetragic eventcrossgardenex convictterminal illnesskilling an animalhead buttreference to adolf hitlerlistening to musiccrucifixstealingdenmarkaccidental deathpart of trilogytenniscommunityrapistapplemale underwearkickinggunshot woundarabdeath of sisterconvictpastorsexual assaultsermonparalysisbandagebaptismwalletskinheadneo nazishot in the eyelistening to radiowormindonesiapiereverendsense of smellbeliefscarecrowmercedes benzdown syndromefilling stationparoledead catdead wifegodhymnpakistanichild rapedragging a bodybakingblasphemybrain tumoroptimismovenchurch bellbloody facemental disorderhostilitytennis playerthird in trilogysaudi arabiacerebral palsyshot in the kneeorchardtennis racketneo nazismcommunity servicekilling a catapple piecynicear bleedinghalfway houseapple treesuicide of wifeiron crosslightning strikeparishconsidering abortioneggplantreformed alcoholicdaneblackbirdbook of jobm&m'snose bandagereference to goebbelsburning treecough syrupspasticrectoryworm in foodburning oneselfcookerface bandagebaking a pie (See All)

Thor: Ragnarok (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thor: Ragnarok (2017)

Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.

Subgenre:
martial artssuperheroabsurdismepicslapstick comedydark fantasyscience fantasylive action and animation
Themes:
murderdeathrevengesurrealismkidnappingbetrayalfeardrunkennessescapemonsterdeceptionbrutalitysupernatural powerredemptioncelebrity β€¦sadismalcoholismpanicapocalypsedisabilitycouragerevolutionself sacrificespace travelprison escapenorse mythology (See All)
Locations:
new york citybarchurchforestelevatorvillagewoodsouter space
Characters:
soldierbrother brother relationshipfather son relationshiptattoobrother sister relationshipzombiealienhostagetough guywarrioraction heroalcoholicvillaincousin cousin relationshipfather β€¦alien monster (See All)
Story:
long hairwisecrack humorprophecybeardwolfthreatscene during end creditsscreamingunderwater scenebridgecharacter name in titletwo word titlesequelviolenceflashback β€¦bare chested malefighttitle spoken by characterexplosionknifechasesurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facebattleswordgunfightbrawlfalling from heightbookbased on comicshowdownheld at gunpointbeerhand to hand combatdemonriverfightingcombatdecapitationgood versus evilsurvivalfoot chasesword fightbased on comic bookambushname in titleaxemassacremountainbasketballarmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestweapontied to a chairsevered headdisarming someoneone man armyfictional wardouble crossspaceshipcreaturefemme fatalethird parttransformationtalking to the cameraon the runduelattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facetough girllightningopening action sceneskeletonbraceletmanipulationspeechexploding bodybrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadbattlefieldprincestylized violencestrong female characterhenchmanapplausedestinydestructionbow and arrowflyingracehead buttspearelectronic music scoresociopathhelmethammerspacecraftexploding buildingkicked in the stomachvillainessplanetblockbustereccentriccamprebeljumping from heightclubskullrebellionknightlaserhomeaction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footageshieldcameohaunted by the pastvisionbootsbraveryfight to the deathdual wieldimpostorsonmercilessnesschaosresurrectiondeath threatevacuationescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault rifleknife fighthologrambounty huntereye gougingcapturearmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fightergiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemfinal battlecrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwoman murders a manwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All)

Valentine's Day (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Valentine's Day (2010)

More than a dozen Angelenos navigate Valentine's Day from early morning until midnight. Three couples awake together, but each relationship will sputter; are any worth saving? A grade-school boy wants flowers for his first true love; two high school seniors plan first-time sex at noon; a TV sports r β€¦eporter gets the assignment to find romance in LA; a star quarterback contemplates his future; two strangers meet on a plane; grandparents, together for years, face a crisis; and, an "I Hate Valentine's Day" dinner beckons the lonely and the lied to. Can Cupid finish his work by midnight? (Read More)

Subgenre:
romantic comedy
Themes:
loveinfidelitytravelloneliness
Mood:
high school
Locations:
restaurantschoolcarcemeteryairplanelos angeles californiaairportelevatorofficeusaschool boy
Characters:
mother son relationshiphomosexualafrican americanboyfriend girlfriend relationshipdoctorboyteenage girlteenage boybest friendinterracial relationshipemployer employee relationshipgay relationshipgrandfather grandson relationshipgrandmother grandson relationship
Period:
future
Story:
news reporterpress conferencegiftpublic nuditynews reportdinnerreporterdancingmale nuditydogsexf ratedbare chested malekisstelephone call β€¦punctuation in titlecell phoneunderwearcar accidentundressingbikinibedapostrophe in titleclassroomsoccernunvanmarriage proposalblack pantiesvirginproduct placementflowershigh school studentcharacter says i love youflowersleepinggay couplehateitaliancloseted homosexualbabysittermale bondingbarefoot maleteddy bearcheating husbandplanefootball playerensemble castyoung loveflightadolescentengagement ringtext messagingmexican americangay manbloopers during creditsreference to facebookpolaroidtrue lovestewardesselementary schoolphone sexmarried couplepush upsinterracial kissholiday in titleflight attendanthollywood signschoolteachermetal detectorchick flickvalentine's dayawkward situationsinglepolaroid cameramarital infidelitymotor scooterman wearing towelvolkswagen beetletv stationbeverly hills californiabroken engagementensemble filmtalent agenttrack and fieldflower shopbouquet of flowersfloristfear of commitmentdate in titlesouthern californiareference to muhammad alipinatastudent athleteairport securitygay athleteblonde stereotypepublicistvalentineteen lovevespaportmanteaugrade schoolreference to orson wellesreference to chersportscasterteacher crusharmy captaincardiologistfender benderwind up toyphone sex operatorcamera mangrandparent grandchild relationshipman wrapped in a towelchildhood crushromantic rejectioncaught nakedlow riderindian weddingindian restauranttraveling shotfootball starreference to lucille ballbest friends in lovesports reportertwo timingearly morningreference to frank zappaboyfriend girlfriend reconciliationcoming out of the closetgrammar schoolmultiple storylinessexy legsreference to jackie robinsonboston terrierdelivery vangroup singingtv news showflower deliveryromantic break uprunning track (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Underground (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underground (1995)

The story follows an underground weapons manufacturer in Belgrade during WWII and evolves into fairly surreal situations. A black marketeer who smuggles the weapons to partisans doesn't mention to the workers that the war is over, and they keep producing. Years later, they break out of their undergr β€¦ound "shelter" --- only to convince themselves that the war is still going on. (Read More)

Subgenre:
black comedyepicpolitical satire
Themes:
politicsmurderdeathlovefriendshiprevengesurrealismmarriagepregnancydrinkingtorturedrunkennessweddingfilmmakingmemory β€¦theftdeath of mothertheatreexploitationhopedeath of wifecommunismfreedomrevolutiondeath in childbirth (See All)
Mood:
rainsatirebreaking the fourth wall
Locations:
helicopterbathtubbicyclewheelchairshipsewer
Characters:
soldierbrother brother relationshipfamily relationshipshusband wife relationshipfather son relationshipfriendbrother sister relationshipprostitutedancerphotographerbabythiefactressfilm director β€¦germanuncle nephew relationshipgrandfather grandson relationshipgirlfriend (See All)
Period:
world war two1990s1960s1940syear 1941
Story:
tigerelephantmonkeyunderwater scenefishcatdancingsexfemale nuditybased on novelone word titlemasturbationgunkiss β€¦female rear nudityfightexplosionpartybased on playfireunderwearhorsemirrorurinationdrinkshootingvomitinglieriflebirthdayislandswimmingbandstrangulationweaponbirdradioanimalcoffintalking to the cameraliartankhangingchildbirthbasementflowermagical realismrefugeeeuropehatecoupleberlin germanycivil wareyeglassestraitorgoldhead buttcrucifixstealingcommunistclockbombingresistancezoonewsreel footagetheatre audiencefascismdeerhorse and carriagecellarparrotposterjoypost world war twodead animalfascistyugoslaviamarching bandchimpanzeepartisanresistance fighterwanted postersheltergestaporewardponyhooliganreference to noahbalkanelectricianmelonanti fascismarms dealcommunist partyhappy new yearanti fascistflying machineelectro shockturntablefreight elevatortied togetherbridal gownfloating islandzagreb croatiaelectrical generatorbelgrade serbiathrown down a wellljubljana sloveniareference to marshal tito (See All)

10,000 Bc (2008) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

10,000 Bc (2008)

A prehistoric epic that follows a young mammoth hunter named D'Leh's journey through uncharted territory to secure the future of his tribe. When a band of mysterious horse-riding warlords raid the Yaghal camp and kidnaps his heart's desire - the beautiful Evolet along with many others, D'Leh is forc β€¦ed to lead a small group of hunters south to pursue the warlords to the end of the world to save her. Driven by destiny, the unlikely band of warriors must battle saber-toothed cats and terror birds in the Levant. (Read More)

Subgenre:
epic
Themes:
dancemurderdeathlovefriendshipkidnappingbetrayalprisonmonstermagicdeath of motherabusedyingblindnessself sacrifice β€¦huntingdeath in childbirthmurder of motherfight for freedom (See All)
Mood:
rain
Locations:
boatsnowdesertvillagelakejunglecampfire
Characters:
reference to godmother son relationshipfather son relationshipfriendboygirldancerpriestwarriorwitch
Story:
construction cranespittingprophecyconstruction sitefloodpromisegifttreedancingnumber in titlebloodkissfightknifechase β€¦firevoice over narrationcryingbeatingcorpsefoodhorserescuepunched in the facebattlefalling from heightmasklietearshand to hand combatdead bodyjailhallucinationrivercombatorphanmassacremountainstabbingdeath of friendeatingarmyprisonerbirdacronym in titlefictional warritualsearchjourneyflash forwardlegendstabbed in the backprologuespiritualityliartentlightningskeletonscarpursuitstalkingtrapwhippingsubtitled scenemoongolddestinybow and arrowspearwoundinjuryquestslaveryjail cellcaptivehuntertempletorchburialanimal attackdinosaurslaveshieldface painttarget practicetelescopewhiprejectionresurrectionfalling to deathbutcherfather figureabsent fathersuperstitionaerial shotfallrainstormtriberaidsmokeheroismsunsetmysticismagriculturemeathuman sacrificesailboatshot with an arrowarcherywhistledrumhuntstretcherpyramidpremonitionblizzardprehistoric timesdeath of familyrevoltstealthritescoldingcavalryuprisingbonedreadlocksnegotiationpitrebirthvulturesailing shiploinclothchantingspiritualismcustomfloodingsnowstormnetmessiahhornanimal rescuefuneral pyrepharaohnorth africaexhaustionethnographytalking to an animaltrekcaught in a netseedstar gazingstone agecollapsestampedechantseparation from familythrown from heighttrackingpriestessblessingwar paintherdmammothancient cultureseerallycave womanstabbed with a spearcave drawinggiant birdwoolly mammothdying in someone's armsfalling objectmanaclesancient citydragged along the groundslave revoltlong fingernailssabertooth tigertrampledtransferencetribal warfarearmbandcauterizing a woundcheerprimitive artbuilding a firefalse godclub the weaponmedicine womansabre toothed catwhipping a slave10000 b.c.arrow in one's backrising from the gravethatched roofthe onewalking in circleshearthimpaled on a spearmurder of a kingslave uprising (See All)

The Wolf Of Wall Street (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wolf Of Wall Street (2013)

Jordan Belfort is a Long Island penny stockbroker who served 22 months in prison for defrauding investors in a massive 1990s securities scam that involved widespread corruption on Wall Street and in the corporate banking world, including shoe designer Steve Madden.

Subgenre:
black comedyconspiracy
Themes:
corruptionlovefriendshipsuicidemarriageinfidelitydrugsrapemoneyadulteryprisonpregnancydrinkingfeardrunkenness β€¦weddinginvestigationincestextramarital affairdivorcetheftdrug useguiltunfaithfulnesshomophobiaalcoholismgreeddrug addictionwealth (See All)
Mood:
satirebreaking the fourth wall
Locations:
boatrestaurantnew york citybarswimming poolhelicopterairplanebathtublondon englandelevatorpolice carcourtroomitalyshipstrip club β€¦yachtsex in publicsex in officestorm at seajapanese restaurantsex in an elevatorsex in an airplane (See All)
Characters:
reference to godpolicemanpolice officerbrother brother relationshiphusband wife relationshipfather son relationshipfriendprostituteteachergay sexdancerlawyerthieflittle girl β€¦single motherlustmaidcousin cousin relationshipfrenchamerican abroadaunt niece relationshipaunt nephew relationshipex policemansex with prostitute (See All)
Period:
1990syear 1983year 1987
Story:
fish tankinternaquariumpromisefraudwolfamerican flagfired from the jobreporterdancingnuditydogfemale nudity β€¦bloodbare breaststhreesomefemale frontal nudityinterviewflashbackmale frontal nuditymasturbationmale rear nuditybare chested malegunsex scenekissfemale rear nudityfightfemale full frontal nuditycigarette smokingphotographtitle spoken by charactermale full frontal nuditypartyleg spreadingerectionpantiesbased on true storytelephone calltopless female nudityvoice over narrationbased on bookbeatingunderwearblood splattertesticlesfoodhorsecar accidentmirrorurinationrescueslow motion scenepunched in the facewatching tvdrinkcondomarrestbikinisex in bedthongbare buttvomitingliebeersunglassesanimal in titlerunninglingeriecar crashinterrogationcafemarijuanasex standing upprostitutionjailhandcuffsbritishreference to jesus christorgymanhattan new york citycriminalstrippertelephonef wordsubjective cameragay slurnewspapercandlemansiondrug dealerwomanmontageeatingcocainefemale pubic hairsubwaynonlinear timelinewhite pantiesjudgeapologyno opening creditsmarriage proposaltalking to the cameralimousinedrug addictcharacter repeating someone else's dialoguemicrophonebusinessmanstripteasefbipay phonechampagnedebtdomestic violenceprankcourtbusinessfemale removes her clotheshorse ridingmanagerratprofanitylas vegas nevadaobscene finger gesturenewspaper headlineheart attackfreeze framemachismosex toyeyeglassesapplauseanswering machinegolffalling down stairsteadiscono pantieslooking at oneself in a mirrortold in flashbacksecurity camerafbi agentmediadysfunctional marriagewristwatchgossipvictimtennisbrooklyn new york cityskateboardchokingcelebrationpassportbuddhistwhiskeybloody noseattorneypillssurveillance cameraboxer shortsblood on facesmugglingkickingmillionairepunched in the stomachanxietytitle appears in writingmiami floridabribementorbutlerdrunkevidencesalesmantitle at the endraised middle fingermustachemale male kissbriefcaseswitzerlandsports carreckless drivingswearingsunbathingprivate investigatorengagement ringinterrupted sexbriberyvillain played by lead actornarrated by characterbag of moneyharassmentjewelrycartoon on tvteachingpromiscuous womanhit in the facerepeated sceneevictionmen's bathroomspiral staircasesnorting cocainesuit and tiegolf clubtv commercialshipwreckname callingbrooklyn bridgehangoverselfishnessdrunk drivingweightliftingidealismno title at beginninggoldfishbankercredit cardquitting a jobnewspaper articlemegaphoneyuppiestrong languageman punching a womanmarching bandsense of smellpool partychild custodyn wordgolf coursemoney launderingrags to richeslucksecond chancewoman in lingerieforgerysushireading a newspaperbachelor partymugshotreference to james bondcrack cocainebutt slaphypocritefirst person narrationmorphinepole dancerwhite bramovie cameratailorpenhedonismexploding airplanebride and groomtreadmillvillain arrestedpremature ejaculationpublicityfinanceoverhead shotstock marketchantinggestapotennis courtcourthousehelicopter pilotjet skifake commercialcustomstroubled marriagepassing outmortgagebailinfantwall street manhattan new york cityamishgolf cartlas vegasmoral ambiguitysex addicthundred dollar billbritish accentlong island new yorkdebaucherymanic depressionmedia frenzyscrewdriverlaw studentorange juicefemale judgetoupeemediterranean seadrink thrown into someone's facereference to george washingtonbahamascrawlingsexually transmitted diseasesedativeboiler roomgeneva switzerlandmotivational speakerstockbrokeridealistpenis slurpublic urinationcheatincompetencesuperstarenforcerlifting weightsbriefcase of moneymanagementmouth to mouth resuscitationslovenianlamborghinipep talktalking during sexfalling into a swimming poolpythonshaving headconfettireference to tarzanduchessbrass bandmarital rapetestosteronereference to robin hoodmile high clubsex with multiple partnerssteam roomwoman wearing a thongvalium22 year oldolivesecond wifebusiness ethicscaviarreference to moby dickeurocopter as350 squirrelreference to wolfgang amadeus mozartstdstrip jointnemesisphone tapplaying tenniscommissionspoken inner thoughts24 year oldwedding videofeng shuimorning afterchauffeured limousinereference to london englanddiamond necklacepaying for sexwhite collar crimebeer pongcardiopulmonary resuscitationjustificationpile of moneycareer changehigh on drugsnear drowningexercyclemaniavagina slurconference roomround tablesubpoenafinancial ruinreference to the mona lisaspeaking spanish26 year oldfalling into a poolspeaking frenchspousal abuseboat captainlatvianreference to aidsreference to popeyedartboardgay orgyjaguar the carjewish slurwearing a wirewedding photographair conditioningexcessfictional tv commercialreference to the tooth fairywife slaps husbandxanax35 year oldfish bowljob applicantnapkinafrican liondriving under the influencehair piecemarriage between cousinsattempted briberyauckland new zealandcrawling on the floormanic behaviorpellet gunquaaludereference to disneykodakmoney counterankle monitorbitch slapeurocopter as355 twin squirrelgrenadaimitating fellationanny camswiss bankbullseyegold coasthome gymmaydaymug shotnewspaper photoreference to the wall street journalstrip mallswiss bank accountfast pacedhands held in the airmale african lionsweatpantsu.s. justice departmentankle bracelethot candle wax during sexitalian rivierajaguar e typejasminereference to coco chanelreference to don johnsonreference to goldman sachsreference to microsoftreference to pbsrestitutiondiamond braceletreference to gianni versacereference to moby dick the novelsashimistudent loandumb blondefellatio slurfixforbes magazinefurniture salesmanheart bypass surgerykissing someone's breastsreference to giorgio armanivideo monitorbacchanalbusiness associateconference tabledouchebagfirst wifereference to geneva switzerlandreference to ibmreference to jimmy buffettreference to the rothschildsrunning a businesssecurities exchange commissionsex in a limousinetestifybento boxdesktop computerlobster as foodreference to israelreference to kodakreference to warren buffettreference to yves saint laurentscene told from more than one perspectivesex with first cousinswallowing a goldfishworrying about a friend (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wag The Dog (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wag The Dog (1997)

After being caught in a scandalous situation days before the election, the president does not seem to have much of a chance of being re-elected. One of his advisers contacts a top Hollywood producer in order to manufacture a war in Albania that the president can heroically end, all through mass medi β€¦a. (Read More)

Subgenre:
independent filmblack comedyconspiracypolitical satirepolitical conspiracypolitical comedypresidential comedy
Themes:
corruptionmurderdeathrapemilitaryhollywood
Mood:
satire
Locations:
airplane accident
Story:
election campaignpolitical campaignpress conferencewashington d.c.electioncatdogbased on novelthree word titlebased on bookanimal in titlemansionprisonerman with glassescover up β€¦u.s. presidentpresidentciascandalrapistwhite housesurveillance camerasenatoramerican presidentpolitical corruptionmental patientsecret serviceimperative in titlemovie producerplane crashkittenshoepolitical candidatepresidential electionreference to john f. kennedyreference to ronald reaganpresidential candidatepresidential campaignpolitical assassinationmedia manipulationmovie makingillegal alienreference to platotheme songalbaniareference to arnold schwarzeneggerpolitical cover upmedia hypetanning bedstretch limousinereference to jfk assassinationreference to king kongspin doctorvideo manipulationvoterreference to cecil b. demillepolitical consultantpress secretaryproducingreal life parallelcomputer generated imageryreference to davy crockettsneakerreference to john belushireference to howdy doody (See All)

The Happening (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Happening (2008)

Elliot Moore is a high school science teacher who quizzes his class one day about an article in the New York Times. It's about the sudden, mysterious disappearance of bees. Yet again Nature is doing something inexplicable, and whatever science has to say about it will be, in the end, only a theory.  β€¦Scientists will bring out more theories, but no explanations, when a more urgent dilemma hits the planet. It begins in Central Park. Suddenly and inexplicably, the behavior of everyone in the park changes in a most bizarre and horrible way. Soon, the strange behavior spreads throughout the city and beyond. Elliot, his wife, Alma, and Jess, the young daughter of a friend, will only have theories to guide them where to run and where to hide. But theories may not be enough. (Read More)

Subgenre:
eco horror
Themes:
deathlovesuicidefearnatureparanoiapanic
Mood:
gore
Locations:
new york citytrainschoolparis francebathtubtaxirural settingurban settingpolice carfranceroad movielaboratoryschool bus
Characters:
police officersoldierfamily relationshipsfather daughter relationshipteachergirlstudentlittle girlself mutilationsuicide by hangingself inflicted gunshot wound
Story:
television newslionamerican flagdisappearancetreeparknews reportdinnerdogbloodphotographsurprise endingpistolcell phonecorpse β€¦shot to deathblood splattershot in the chestshot in the headshotgunslow motion scenewatching tvfalling from heightcar crashdead bodyclassroommanhattan new york citysurvivalimpalementmapman with glassesradiochild in perilpolice officer killedold womanshot in the foreheadbinocularswritten and directed by cast memberdollreadingscreamhanginglong takeloss of fathergardensemiautomatic pistolchild murderdisasterhuggingbulletjeepsurvivorloss of friendfloridaclassical musicladderrailway stationcrushed to deathbroken leggas maskbloody nosewindnew jerseybackpackboston massachusettspower outagegash in the facestabbed in the neckzoofalling to deathbutterflyswingphiladelphia pennsylvaniabroken armdead boysirenplantdirector cameoconstruction workercentral park manhattan new york cityepidemicgerman shepherdcrisisbeepregnancy testabandonmenthot dogcornfieldcloudgreenhousewrist slittingbloody body of childhanged mannatural disastershockslappingsushipark benchknittingcut into piecesradio newsenvironmentalisthummerpolice officer shot in the headticketframed photographrocking chairarm ripped offcity parkchild killedemergencypower failurelawn mowernuclear power plantlawnmowernebraskapassenger traintrain conductorostracismtv broadcastwest virginiahanged womannurserythrown through a windshieldestranged couplehanged by the neckmass suicidecrossroadsboy killedbotanistjumping off a roofchild shotchild shot in the headbotanymaulingscience teacherstrange behaviortoxinviolent behaviorweird behaviorcar horndisorientationmath teacheralbert einsteinchild shot in the chestpositive pregnancy testman vs naturesitting on a park benchtrain tickethairpinpolice officer shot in the foreheadwalking backwardswalking the doghand slapbutterfly collectionconstruction crewact of godchild shot through the chestjacksonville floridacough syrupfemale slaps femaleplant lifeprincetonbocci ballframed butterflykiller treegarden swinghitchhikemood ringscreen doorcar crash into treemodel homecooling tower (See All)

The Many Adventures Of Winnie The Pooh (1977) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Many Adventures Of Winnie The Pooh (1977)

Pooh, a bear of very little brain, and all his friends in the Hundred Acre Wood sing their way through adventures that encompass honey, bees, bouncing, balloons, Eeyore's birthday, floods, and Pooh sticks.

Subgenre:
disney
Themes:
friendshipsurrealism
Mood:
rainbreaking the fourth wall
Locations:
forestsnowenglandstorm
Characters:
mother son relationshipboy
Story:
weathertigerfloodelephantbeartreecharacter name in titlepartyvoice over narrationdreamrescuedream sequencecreatureanthologyfirst of series β€¦umbrellarabbitpigballoonheavy rainwindbutterflyice skatingrainstormnoteowldonkeybeetreehousekangaroobased on children's bookfootprintyoung boyhoneygluttonytoy comes to lifebeehivehalf dressed cartoon animalwinnie the poohpigletweaselvegetable gardengopherhybrid animalstorybook in opening shotspiraling eyes (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Hologram For The King (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Hologram For The King (2016)

Themes:
infidelityadulterydrinkingfeardrunkennessmemoryextramarital affairdivorcedepressiondrug useunfaithfulnesswealthtechnologyhuntingcamping
Mood:
nightmare
Locations:
restaurantswimming poolhotelhelicoptersnowdesertbicycletaxielevatorvillagewoodstaxi driverusa
Characters:
reference to godfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipdancerlittle girlwaitresslittle boymuslimemployer employee relationship β€¦americanuncle nephew relationshipamerican abroadgrandfather grandson relationshipdriveryounger version of characterbaby girlasking for forgiveness (See All)
Story:
national parkprayingconstruction sitepromisewolfbearunderwater scenebridgedancingsexbased on novelbloodbare breastsflashbackbare chested male β€¦gunkissfightcigarette smokingpartyshowertelephone callunderwearmirrorwatching tvcomputerdrinkundressingpaintingvomitingriflebeersunglassesbombneighborhallucinationreference to jesus christalcoholtelephonef wordswimmingmontagearmycocainedrivingapologykingtalking to the cameracoffeeflash forwardconfessionhotel roomprologuebusinessmansuitcasedolltentcollege studentbusinessinjectionhairy chestlaptopgardensleepingtrustfreeze frameprincehenchmanpickup trucksurgeryeyeglassesshavingteahypodermic needlelooking at oneself in a mirrorlistening to musicscene during opening creditsarchitectcrying womanswimsuitculture clashsheepguardwhiskeymiddle eastanimated sequenceinfectione mailhologramsalesmanvoice over lettercellphonebalconyfemale doctorcorporationduct tapesurgeonbrushing teethsports carchauffeurvodkacamelreference to elvis presleyhandshakenew job12 year oldbandageconstruction workereconomymen's bathroomstairwayname callinghangoverroller coaster14 year oldtraffic jamknocking on a doorparamedicjacket15 year oldstethoscopereceptionistscalpelstrokebeach houseswimming underwaterreading a bookmosquetour guidegurneysexual frustrationmetal detectorpark bench11 year oldsleeplessnesscocaine snortingintercomsex on the floorstory tellingfictional cityoverhead shotselfiehijabsleeping bagarabictumorstrobe lightdivorced manbottled waterdanishtradejoke tellingsaudi arabiaworrying21 year oldcold the temperatureanxiety attackband aidslip the undergarmentauto repairmotorscootercar rentalreference to new york citybowingarchitectural modeloversleepinganesthesiaelectric razorlong underwearsnorkelinghot wiring a carolive oilblufflesionfalling to the groundreference to starbucksair conditioningcomputer techniciananalogyreggae musicstranger in a strange landreference to texasunderwater kissflip phonereference to chicago illinoisreference to englandmeccareference to new jerseyjet lagreference to boston massachusettsreference to chinareference to the ciareference to kentucky fried chickensaudibiopsyreference to soren kierkegaardmedical operationreading a book to a childteleconferencingviking helmetbuilding a sheltercystneedle and threadcloakroomcollapsing chair (See All)

Big Fish (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Big Fish (2003)

United Press International journalist Will Bloom and his French freelance photojournalist wife Josephine Bloom, who is pregnant with their first child, leave their Paris base to return to Will's hometown of Ashton, Alabama on the news that his father, Edward Bloom, stricken with cancer, will soon di β€¦e, he being taken off chemotherapy treatment. Although connected indirectly through Will's mother/Edward's wife, Sandra Bloom, Will has been estranged from his father for three years since his and Josephine's wedding. Will's issue with his father is the fanciful tales Edward has told of his life all his life, not only to Will but the whole world. As a child when Edward was largely absent as a traveling salesman, Will believed those stories, but now realizes that he does not know his father, who, as he continues to tell these stories, he will never get to know unless Edward comes clean with the truth before he dies. On the brink of his own family life beginning, Will does not want to be the kind of father Edward has been to him. One of those stories from Edward's childhood - that he saw his own death in the glass eye of a witch - led to him embracing life since he would not have to fear death knowing when and how it would eventually come. The question is whether Will will be able to reconcile Edward's stories against his real life, either directly from Edward before he dies and/or from other sources, and thus allow Will to come to a new understanding of himself and his life, past, p… (Read More)

Subgenre:
fairy tale
Themes:
religiondeathlovesurrealisminfidelitymoneyadulterypregnancyescapeweddingfuneralmonsterherorobberyextramarital affair β€¦lonelinesstheftdeath of fatherunfaithfulnessillnessdyingfalling in loveutopia (See All)
Mood:
raindarkness
Locations:
boathospitalchurchswimming poolforestcarmotorcyclecemeterysmall townairplanebathtubwaterwoodsrural settingwheelchair β€¦lakebaseballrussiacavejunglecampfiretexasstorm (See All)
Characters:
family relationshipshusband wife relationshipmother son relationshipfather son relationshipdoctorsingerboyteenage boyteachergirlnursestudentdancerphotographerbaby β€¦writerthiefwitchfrenchself discoverymermaidpregnant wifeu.s. soldierolder man younger man relationshipmother in law daughter in law relationship (See All)
Period:
1980s1970s1960s1940s2000s1950s1930s
Story:
crowspiderwolfautomobiletreeunderwater scenefishsnakereportercatdancingdognudityfemale nuditybased on novel β€¦bloodflashbackgunkissfemale rear nudityphotographtitle spoken by charactersingingpartychasepistolvoice over narrationcryingbeatingdreamfistfightslow motion scenecomputerbare buttsecretlettershootinglierifletearsanimal in titlebedpianoclassroomrevolverrivercriminalswimmingbandbasketballarmyfootballhousejokechildcoffinfishingjourneygraveyardpainflash forwardlegendkarateclownkeyliaron the roadstorytellingtentringpursuitchildbirthdeath of husbandloss of fatherbank robberyflowermagical realismclasspoettwinsacrificeheart attackcircuswerewolfpoemgoldbuttocksaccidental deatheccentricgiantmobstrangersheepparadecarnivalembarrassmentambitionpresumed deadbarefootgypsyshoesu.s. armyhungerco workerimmortalitymiami floridaoillostswampthunderstormfat manparachutecubashadowsalesmanwedding ringcaneeye patchgrowing uploss of husbandwedding receptionpiano playernude swimmingstage performancemetaphortv commercialbeerear nudityyoung version of characterbank robberbeastsororitystrokemoroccounsubtitled foreign languagemarching bandswimming underwaterbankruptcyhearsealabamaidentical twinsmarriage engagementromantic rivalrytelegramfather son estrangementestrangementfather son reunionsecret missionhouse firemob violenceold housebonenight vision gogglesfamily feudfamily historykorean warvulturespotlightchemotherapyrocking chairfather in law daughter in law relationshipleaving homecongofootball gamebanjobrief female nudityventriloquistbutt nakedstudio logo segues into filmarmy lifeone eyed mannaked buttwoman's bare buttstorytellerparatroopericebergleechlifting an adult into the airdictionaryquicksandpower plantsiamese twinsspider webtraveling salesmanglass eyecircus performerterminal cancermultiple narratorslycanthropymilitary draftkorean war veteranbare butt womanlifting a male into the airfly the insectfire eatermilkmantrailer housesideburnssorority housecatfishreference to bob hopeconjoined twinsscience fairfalling off a ladderrefusing to eattall taleanimate treewichita kansassearch for truthwoolly mammothunreliable flashbackringmasterroses are red poemunreliable narrationbuickforced perspectivecarnydaffodilamazing grace the hymnlandscaperparallel montagechicken poxgold ringmechanical handskywritingnewsweek magazinewhite picket fencecongenital heart defecthuman cannonballcar in a treecircus wagonpoet laureateshrinerwork in progress (See All)

Arthur And The Invisibles (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Arthur And The Invisibles (2006)

Arthur is a spirited ten-year old whose parents are away looking for work, whose eccentric grandfather has been missing for several years, and who lives with his grandmother in a country house that, in two days, will be repossessed, torn down, and turned into a block of flats unless Arthur's grandfa β€¦ther returns to sign some papers and pay off the family debt. Arthur discovers that the key to success lies in his own descent into the land of the Minimoys, creatures no larger than a tooth, whom his grandfather helped relocate to their garden. Somewhere among them is hidden a pile of rubies, too. Can Arthur be of stout heart and save the day? Romance beckons as well, and a villain lurks. (Read More)

Subgenre:
music videolive action and animationhigh fantasy
Themes:
politicsmarriageheromagicfreedomfirst lovefear of water
Mood:
car chase
Locations:
boatbarwatervillagerural settingfarmpolice carafricatunnel
Characters:
policemanfamily relationshipshusband wife relationshipfather son relationshipmother son relationshippolicefather daughter relationshipboybrother sister relationshipdancerwarriorvillaingrandfather grandson relationshipgrandmother grandson relationshipengineer β€¦the familyboy hero (See All)
Period:
1960s
Story:
irrigationtoolsmiracleflooddisappearancedancingcharacter name in titledogbased on novelchasetelephone callvoice over narrationfoodcar accidentsword β€¦maskbirthdayriverflashlightsword fighteatinghouseapologyfictional warkingprincesskeypay phonestorytellingdebtmissing personspeechfirst partgardenwaterfallflowersleepingreference to william shakespearegrandmotherprincerecord playerafricanchainsawbirthday cakeapplauserecordingmousetreasureeccentricphone boothimaginationtelescopechild's point of viewgrandfatherinventorinsectballheartdungeonboarding schoolalternate realitylanternwishdictatorelfinvisibilitylocal blockbusterevictionportalinventionbeefantasy worldfallingtreasure huntexplorercountry houseopen endedpart live actionmagnifying glassracial stereotypelive actionbased on children's bookphonographsnoringtotalitarianismscrapbookbeetletoy carminiaturizationbedtime storymidnightforeclosurebubbleconnecticuthusband wife reunionbreaking down a doorwater towerchild herowaspdebt collectormagical swordchimneylandownertreasure hunterbare midriffchild driving a carnative tribeblock of flatsrubyyin and yanglooking for workgarden gnomedrinking strawsequel baitinggrandparent grandchild relationshipsudden change in sizevillain escapeswalnutpoppychanging sizereference to king arthurskull and crossboneschild warriorsword in stoneinvisible inkafrican maskafrican tribesmansleeping dropssubterranean worldwooden mask (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Sword In The Stone (1963) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sword In The Stone (1963)

Arthur (aka Wart) is a young boy who aspires to be a knight's squire. On a hunting trip he falls in on Merlin, a powerful but amnesiac wizard who has plans for Wart beyond mere squiredom. He starts by trying to give Wart an education (whatever that is), believing that once one has an education, one  β€¦can go anywhere. Needless to say, it doesn't quite work out that way. (Read More)

Subgenre:
sword and sorcery2d animationdisney
Themes:
surrealismmonstermagic
Locations:
forestsnowlondon englandwoodsenglandcastle
Characters:
boywitchmerlin
Story:
prophecyelephantwolftreeunderwater scenefishsnakecatdogbased on noveltitle spoken by characterhorseswordorphanbird β€¦ritualtransformationfive word titledueldragonrabbitchickenbow and arrowtalking animalmouseblockbusterfrogknighttournamentgoatdivingwizardmedieval timesfalldeerturtlekingdomowlcrocodilecrownsquirrelblackboardfriends who live togethercrabrattlesnakecoldhawkthronetitle appears in songminiaturizationhuman becoming an animalrhinocerosmagic wandwashing dishesdisobeying ordersfire breathing dragonking arthuranvilplatewalrustalking birdexcaliburarthurian legenddisobediencethermometertalking fishround tablesquirestorybook in opening shot6th centurychicken poxgiantesssword in stonecharacter turns greenanimal licking someonewizards' dueldirty dishesrefusing to believe (See All)

The Lake House (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lake House (2006)

When two people "connect" the bond between them can be so pure and simple as to stir hearts in heaven. When they connect in all the right places at all the wrong times, heaven weeps for broken hearts. To heal these broken hearts, heaven breaks time.

Themes:
deathdrinkingdeath of fathertime travelwriting
Mood:
rain
Locations:
restauranthospitalbartrainsnowbuslakechicago illinoistrain stationbus accidentrunning after a train
Characters:
brother brother relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorgirldancerwriterlawyerlittle girllove letter
Story:
stray dogconstruction sitegifttreebridgedancingdogkisspartythree word titlesurprise endingcryingcell phonecar accidentmirror β€¦slow motion scenewatching tvcomputerdrinkletterpaintingbookbeertearsbirthdaycafewinehousedrawingbirthday partycoffeekeydeath of brotherstalkingsplit screenfireworksgraffitiblack americanheart attackchesspickup truckscene during opening creditsarchitecturepatientarchitectattorneypet dogshovelsculptureice skatingatticvoice over letterfemale doctorbrushing teethbenchglobal warmingpigeonbarking dogcartoon on tvconstruction workerpaintsailboathospital roomhospital bedmailmailboxroad accidentgurneystation wagonford mustangvalentine's daytenantwriting a letterpackingtalking to oneselfreading a letternew year's eve partyreference to friedrich nietzschehit by a bushospital visittalking to a dogsurprise birthday partywatching a movie on tvringing telephonereference to dostoyevskyreference to clark gableparty invitationplumbingreference to jane austenparallel timeremake of asian filmskating rinklake michiganlove across timefloorboardreference to frank lloyd wrightglass houseanimal trackreference to jack kerouaceating a sandwichvalentine's cardreference to barcelona spainshouting surprisewriting memoirschevrolet pickup truckremake of korean filmhospital cafeteriastood up for dinnerreference to budweiserrunning on a bridgehand delivered letterreference to crime and punishment the novelstartled by phone (See All)

Superhero Movie (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Superhero Movie (2008)

Subgenre:
superheroslapstick comedysuperhero spoof
Themes:
murderfuneralherodepressiondrug use
Mood:
spoofhigh schoolparody
Locations:
hospitalhelicoptercemeterywheelchairurban settingrooftoplaboratoryschool bus
Characters:
father son relationshipteenagerdancer
Story:
fish tankexcrementtelevision newsmonkeyscene during end creditspublic nuditysnakeprayerflashbackbare chested malevoice over narrationurinationrescuebrawlfalling from height β€¦maskvomitingmarijuananeighborvoyeurscientistnewspaperorphancandletoiletbirdcoffinhit by a carperson on fireproduct placementbankringbank robberynewspaper headlineterminal illnessexperimentpot smokingflyingcatfightloss of wifeflatulenceabsurd humorexplosivehit in the crotchsuper villainawardyoung loverainstormblind mantrophysecret identityunclethanksgivingauntinvisibilityalleystabbed in the handbonghead blown offwebsitesuper strengthweedbeebillionairehanging upside downaccidental shootingelectric shockgenetic engineeringconventionmovie in titlemuggingpotbestialityreference to googlereading a newspaperscatological humorcoughing bloodsnailsmoking marijuanabanquetloss of parentsmale vomitingaward ceremonysaying graceturkey the birdnail gungrave side ceremonybreakdancingwoman in a wheelchairhourglasscaught in the rainman carrying a womankissing in publicelectric fencegag humorpsychokinesisdragonflyman wearing a tuxedoalternate endingbeastialityscience fairspontaneous combustionsegwaycomical female deathrapid agingclimbing a walllaser visionloan officercrashing through a wallmarijuana pipeself injectioninvisible womanscience projectwoodchipperreference to celine dionman wearing boxer shortssoaking wetglass pipehome aquariumbreak door indrinking fountaininsect stingbody in a woodchipperflashbulbreference to paula abdulerlenmeyer flaskinsect bitesuperhero originunveilingflash photographyreference to rosie o'donnellsupervillian origindizzyelectrified fencegraveside ceremonyinvisible doglife force sucked outpicking nosecockatielstuffing a turkeywoman wearing blue lingerie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Witches (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witches (1990)

A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.

Subgenre:
conspiracyabsurdism
Themes:
kidnappingmoneyfearescapemagicangerdeath of fathersupernatural powerdeath of motherabductioncrueltypanicmissing child
Locations:
restaurantbeachschoolhotelsnowsmall townbicycletaxielevatorkitchenpolice carenglandocean
Characters:
policemanpolice officerfamily relationshipshusband wife relationshipmother son relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipdoctorgirlbabylittle girllittle boymaid β€¦witchgrandmother grandson relationship (See All)
Story:
petfaintinggiftdisappearancesnakecatbased on novelsingingsurprise endingcryingbased on bookunderwearrescuemaskpainting β€¦tearsrunningbirthdaysubjective cameragood versus evilfoot chaseorphanbedroomcandlemountaindisguisechildradiodrawingchild in perilsearchcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationmissing personscreamspeechpursuitwigexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeeyeglassesapplauseeavesdroppingtalking animalcakecagecomic booklifting someone into the airhatcookmousehidingwitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatehysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleaverhandtreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalyoung boyrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childtree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All)

Anchorman: The Legend Of Ron Burgundy (2004) is one of the best movies like Evan Almighty (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Anchorman: The Legend Of Ron Burgundy (2004)

In 1970s San Diego, journalism was a well respected profession and people actually cared about what they saw on TV. And the top rated anchor man in the city is Ron Burgundy. He enjoys his run at the top, and has for the last five years. And his news team is equally as good as he is. Professional joc β€¦k and former professional baseball player Champ Kind handles the sports, the curiously dim witted Brick Tamland - who's a few channels short of a cable subscription - handles the weather, and ladies' man Brian Fantana - whose collection of fine scents would be in the Guinness Book Of Records - handles the on-field reporting. But now all that is about to change forever. The TV station Burgundy works for, Channel 4, has embraced diversity and has hired a beautiful new female anchor named Veronica Corningstone. While Ron Burgundy and the rest of the Channel 4 news team enjoys fighting with competitors, drinking, and flirting with the ladies, Veronica quietly climbs her way to the top. And Veronica's success drives Ron Burgundy crazy. So much that Veronica's meddling causes Ron to get demoted and ultimately lose his job with Channel 6. Now left with nothing, Ron must find a way to get back to the top - and that involves a story about a rare Chinese panda giving birth on US soil. Will Ron be the one to report the story on a national level? (Read More)

Subgenre:
cult filmnews satire
Themes:
friendshipdrunkennessdepressionrivalry
Mood:
satirebreaking the fourth wall
Locations:
restaurantbarswimming poolkitchenofficemotorcycle accident
Period:
1970s
Story:
anchormanfrat packnewscastchangetelevision newsweatherinsultbearfired from the jobbridgecatcharacter name in titledogcigarette smokingsinging β€¦erectionvoice over narrationface slaprescueslow motion scenebrawlfalling from heightf wordgay slurjournalistman with glassesperson on firefantasy sequencesplit screenpremarital sexsix word titlesevered armtypewriternewspaper headlinefreeze frameflirtingtv newshand grenadewhat happened to epiloguefarcecowboy hatmale bondingphone boothjumping from heightimprovisationjournalismladderanimal attackmilkbikerhaircutbreakupanimated sequencehit in the crotchzoosexismhousewifelove at first sightbananamustachefemale reporternervous breakdownwilhelm screampipe smokingsurprise after end creditspractical jokevideo tapenew jobloss of jobbloopers during creditsmisogynistfirst dateflutemental retardationsquirrelanimal abusepool partyfashion showtv studiovanitysan diego californiacomebackriding a biketelevision reportervcrsex on first datetv stationdental bracesnewscasterpandatv camerarubik's cubetv show in filmnews anchorreference to bob dylanopening narrationtv broadcasttalking to an animalcolognegang warfaremultiple cameosoffice romanceseashellbleeped dialoguerepressed homosexualmale chauvinismsex with coworkercatch phrasenewsroompillow talktridentweathermanprank callloss of petdental headgearcomedic sex scenepick up linetv journalistanchorwomanhibernationweight trainingdouble amputeelocal newstelepromptermace the repellenttongue twistertv journalismbroadcast journalismlitteringfondueman fighting womannews spooftrading insultsfictional tv network (See All)

Hair (1979)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hair (1979)

This movie, based on the cult Broadway musical of the 60s, tells a story about Claude, a young man from Oklahoma who comes to New York City. There he strikes up a friendship with a group of hippies, led by Berger, and falls in love with Sheila, a girl from a rich family. However, their happiness is  β€¦short because Claude must go to the Vietnam war. (Read More)

Subgenre:
cult filmrock musical
Themes:
dancedeathlovefriendshipdrugsmoneypregnancydrinkingdrunkennessweddingdrug usefalling in lovecar sex
Locations:
new york citybarchurchsnowairplanebusdeserttaxicourtroomgas stationmilitary cemetery
Characters:
reference to godpolicemanfather son relationshipmother son relationshiphomosexualpolicefather daughter relationshipmother daughter relationshipafrican americanfriendsingerdancerinterracial relationshiplittle boy β€¦u.s. soldiermilitary police (See All)
Period:
1960ssummer of love
Story:
hairwashington d.c.american flagpublic nudityparkdancingmale nuditydognudityfemale nudityone word titlebare breastsflashbackmale frontal nuditymasturbation β€¦male rear nuditybare chested malecigarette smokingtitle spoken by charactermale full frontal nudityexplosionsingingpartypantiescryingsongunderwearfoodhorseurinationslow motion scenedrinkundressingbare buttvomitingrifletearssunglassesrunningmarijuanajailhallucinationreference to jesus christmanhattan new york citysubjective cameracandlebasketballeatingwhite pantiesjudgejourneyskinny dippingmicrophonepuppetprotestfantasy sequencecowboymistaken identitytankflowershairy chesthorse ridingclass differencestrustblack americanfreeze framepickup truckpot smokingballoonjeepscene during opening creditscowboy hatjail celldemonstrationsergeantvietnam warimpersonationfollowing someonegas maskhaircutface paintu.s. armyboxer shortshippielove at first sightmedical examinationtuxedosodomycoinbeing followedlevitationanti warset upcentral park manhattan new york citydoubtnaivetyharmonicafalling into waterlsdcowboy bootsstonedbunk bedchandeliermilitary uniformn wordurinatingpark benchnevadaopiummilitary trainingbeggingreference to the virgin marycounter culturereference to richard nixonbride and groompolitical activismloudspeakeroklahomahigh societybarracksbailvietnameseboot campnecktiemanchester englandpretending to be someone elsehashishsockswoman dressed as manphone bookpoison gaswhite bra and pantiesbased on stage musicalshooting starauthoritypublic urinationpacifismdebutantewatchtowerduffel bagmale with long hairreference to mick jaggermilitary drafthare krishnaanti war protestdrunk driverreference to lyndon johnson360 degree well shotreflection in watermounted policedrafttitle sung by characterabsent without leaveblack stereotypewhite house washington d.c.tricksterlincoln continentalreference to federico felliniafrican american stereotypepederastysmoking a jointgonorrheablack american stereotypereference to mars the planetbandstandbell bottomshair clippersreference to the grateful deadsecurity checkpointswitching clothesdancing on a tablereference to roman polanskistanding on a tableinterracial affairlawn partyblind lovemilitary salutepeace symbolhappeningreference to jupiter the planetsmoke inhalationblowing smoke ringsdraft cardex army officersex harassmentu.s. army basereference to little black sambo (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Evan Almighty?
<< FIND THEM HERE! >>