Please wait - finding best movies...
In Canada, a writer visits the Indian storyteller Pi Patel and asks him to tell his life story. Pi tells the story of his childhood in Pondicherry, India, and the origin of his nickname. One day, his father, a zoo owner, explains that the municipality is no longer supporting the zoo and he has hence … decided to move to Canada, where the animals the family owns would also be sold. They board on a Japanese cargo ship with the animals and out of the blue, there is a storm, followed by a shipwrecking. Pi survives in a lifeboat with a zebra, an orangutan, a hyena and a male Bengal tiger nicknamed Richard Parker. They are adrift in the Pacific Ocean, with aggressive hyena and Richard Parker getting hungry. Pi needs to find a way to survive. (Read More)
| Themes: | school bullyingstarvationcouragewritingdyingfaithlonelinessreligionfriendship |
| Mood: | rain |
| Locations: | catholic churchswimming poolstorm at seaindiamexicojungleshipwaterparis franceschoolbeachhospital |
| Characters: | human animal relationshipcatholic priestuncle nephew relationshipmuslimcatholicjapanesechristianityreference to goddancerstudentteacherteenage boybrother brother relationshiphusband wife relationshipmother son relationship …father son relationshipfamily relationships (See All) |
| Period: | 1970s |
| Story: | eating a ratmonitor lizardpraying handsflare gunbengal tigerfrench classdance classpondicherry indiaanimal companionanimal fightinjured animalanimal cagecargo shipsunken shipsinking ship …thrown into a swimming poolsurvival guideanimal attackfloating islandswimming underwaterreflection in waterholy waterfalling into waterschool of fishinsurance investigationreading under the coversreference to ganeshacatching fish by handbotanical gardengreek alphabetreading a comic bookreference to albert camuskilling a fishreference to christopher columbusflying fishinsurance claimgravybharatanatyamganeshhanumanherpetologistmale cryingrupeeecumenismpiadriftashramcrossing oneselfrationalitykrishnameerkatfishnetlife jacketfly the insectfreighterlost at seaarkoarzookeeperreference to allahhyenabotanistflamingoseasicknesslifeboatasian indiancastawayorange juicemotivationalhippopotamusorangutanaspiring writerzebramontreal quebecleopardrhinocerosoverhead shotarabicpacific oceanbuckettoothhinduismloss of family11 year oldreading a bookkarmarespectdolphintoronto ontario canadateasingflaredrumstreet marketwhistlehindumathematicslizardshipwreckwhale12 year oldprayingspittingcamelloss of brothersailortigerbelief in godvegetarianbananadrummernovelist3 dimensionalanimated sequencemiraclehungerzoothunderwindnicknamedivingfull moonbuddhistbroken legstreet lifegoattold in flashbacksharkswimsuitelephantcooksurvivorsubtitled scenemonkeymagical realismloss of motherbearclassloss of fatherratsplit screenfantasy sequencelightningstorytellingbusinessmanflash forwardpainunderwater scenejourneyanimalapologysnakemapeatingmontageaxeflashlightorphansubjective camerasurvivalswimmingreference to jesus christprayerclassroomislandvomitingurinationvoice over narrationthree word titleknifedancingcharacter name in titlebare chested malebased on novelflashback (See All) |
Nim Rusoe is a girl who joins her father, a scientist, when he does research on marine life on an island. It's just the two of them but she spends her time making friends with all the animals she encounters, chatting on the computer and reading the adventure books of Alex Rover. When her father goes … to do some research but when a storm strikes the island he doesn't come back, she gets worried and frightened. She then e-mails Alex Rover hoping that he will come but what she doesn't know is that Alex Rover is a woman who is agoraphobic and germaphobic. But her creation comes to life and eggs her to go. Unfortunately she has never gone anywhere before and is denied her necessities like her sanitary gel by the customs officer at the airport. In the meantime, Nim tries to be strong while waiting for Alex to arrive. (Read More)
| Subgenre: | coming of ageabsurdismslapstick comedyfish out of water |
| Themes: | couragesurrealismfearescapeheromemorytravelparanoiapanicnear death experienceobsessive compulsive disorder |
| Mood: | rainnightmare |
| Locations: | storm at seajungleshipwaterbeachforesthelicopterairplaneboatbathtubdeserttaxiairportwoodssea …rooftopoceantaxi drivercampfirestormsan francisco californiaboat accident (See All) |
| Characters: | human animal relationshipdancerhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipboygirlwritersecurity guardaustralianamerican abroadsingle father …ship captain (See All) |
| Story: | lost at sealifeboatlizardshipwreckwhalecamelsailornovelistanimated sequencefull moonsharksurvivorloss of motherfantasy sequencelightning …storytellingunderwater scenemapeatingmontageflashlightsubjective camerasurvivalswimmingislandvomitingvoice over narrationdancingcharacter name in titlebased on novelflashbackf ratedfightphotographchasesurprise endingtelephone callfirecryingcell phonefoodrescueslow motion scenecomputercamerafalling from heightletterbooktearsbedhallucinationtelephonescientistsoccercookingmountainvideo camerainternetfishradiofishingchild in perilbathtreeauthordangerelectrocutioncharacter's point of view camera shotactor playing multiple rolesproduct placementrace against timesuitcasemissing personreadingisolationsingle parentpirateanswering machinefarceheavy raineggmachetequesttouristlifting someone into the aircaptivespiderflatulencehome movietorchpresumed deadpassportreverse footagefloodtelescopechild's point of viewbraveryinvasionfanmisunderstandingobesitypower outageevacuationrowboatlostvolcanoaerial shote mailrainstormcaptureturtlecliffbarbecuelanterndead motherbonfirenewspaper clippingfast motion sceneexplorationnoveleditorsailboattween girlsailingfish tankimaginary friendseagullhurricanelavawormsouppalm treemotorboatcruise shipclimbing a treesurrogate mothermicroscopewet t shirtmetal detectortreehousegame playingrescue from drowninganimated creditsgolden gate bridgereclusemountain climbingrock climbingtreadmillagoraphobialeg injuryfemale writertropical islandscottish accenthelicopter pilotcoconutseal the animalrole modelvolcanic eruptioncatapultpinatatidal wavealternate worldqueenslandbelchingsatellite dishcratersouth pacificwet jeansspyglasswater pumpstarfishpelicansea lionsolar powertug of warclosing credits sequencetoolswindsurfingsea turtleashwading in watertropicssinking boatcalling parent by first nameport a pottymarine biologistarachnophobiaanimated scenecall for helpmonsoonhomeschoolinghiding in a treeman versus naturespear fishingnational geographic magazineroasted pigsatellite phonecan openerdesolate islandplanktonsecurity checkpointalonenessboatmanbuccaneerhula danceroverboardoceanographerair hostessamerican expatriatesextantflossing one's teethtropical stormfear of spidershand sanitizersatellite telephonewoman girl relationship (See All) |
The impressionistic story of a Texas family in the 1950s. The film follows the life journey of the eldest son, Jack, through the innocence of childhood to his disillusioned adult years as he tries to reconcile a complicated relationship with his father ('Brad Pitt' (qv)). Jack (played as an adult by … 'Sean Penn (I)' (qv)) finds himself a lost soul in the modern world, seeking answers to the origins and meaning of life while questioning the existence of faith. (Read More)
| Subgenre: | independent filmcoming of ageepic |
| Themes: | faithreligiondeathmarriagejealousypregnancyfearmemorytheftdysfunctional familyguiltgriefbullyingeducationphotography …hopecrueltychildhoodinheritanceafterliferegret (See All) |
| Mood: | rainavant gardemoving |
| Locations: | swimming poolschoolbeachrestaurantchurchforestcemeterysmall townairplanebathtubdesertbicycleelevatorwoodsurban setting …police carseacourtroombaseballouter spaceoceanchinatexasstormrunning into water (See All) |
| Characters: | catholicchristianityreference to godbrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspoliceafrican americanchildrenboypolicemanmusicianbaby …priestthiefchristianbullywaitresslittle boychinesegrandmother grandson relationshipengineeryounger version of characterpregnant wifecrying babydeath of boydeath wish (See All) |
| Period: | 1950s |
| Story: | praying handsswimming underwatercrossing oneselfoverhead shotlizard12 year oldspittingloss of brotherthunderwindsharkswimsuitclassstorytellingflash forward …painunderwater scenejourneyapologysnakeeatingflashlightsurvivalswimmingprayerclassroomvoice over narrationdancingbare chested maleflashbackdogkissfightexplosiontelephone callfirecryingcell phonefoodmirrorface slapslow motion scenecatarrestpaintingbooklietearsrunninglingeriedead bodycafepianoguitarriverhalloweennewspapercandlebridgehousefishnonlinear timelinechild abuseman with glassescoffinbathsearchgraveyarddrowninggunshottreeclownsuburbfired from the jobliarreadingbaseball batflowerscourtdeath of brotherchildbirthdeath of songardenwaterfallflowersleepingtrustkillingredheadhateblack americanrecord playermachismoeyeglassesdestinybreaking and enteringlooking at oneself in a mirrorlistening to musicfaintingrecordingvandalismguitariststealingplanetladderbirthfollowing someoneend of the worldambitiondinosaurpromisesufferingmourningloss of sonchild protagonistkickinginsectcigarette lighterbible quotecard playingsibling rivalrysunbutterflyvolcanoatticshadowchoirswingbarbecueexistentialismgrowing upmarital problemchildhood memoryfast motion sceneshamebeing followedpiano playersermongiving birthhandshakegardeningnotebookbaptismhomecomingreading aloudstairwayescalatorlooking out a windowabandoned housevery little dialogueskyscrapernaivetyseagullwhisperingenvylavabubble bathstrokebare chested boyelectric shocktrain tracksuniversebreaking a windowguitar playernewborn babyclimbing a treefailuremeteorprehistoric timestelegramreading a newspaperstarscar radiotreehousegrassdistrustdeath by drowningtoy gunsilhouettefetuswaveplant in titleexpectant motherdomineering fathersaying gracecourthousedare19 year oldkneelingexpectant fatherwater hosewashing dishesice cubehand kissingplanet earthsnoopinghoselooking in a windowjigsaw puzzlejumping on a bedorganiststeamheartbeatstained glass windowtrashcanloss of innocencelaundry drying on clothes linecar repairpower plantschoolyardsparklerlawn sprinklercosmosplayingelectric fanthree brotherswind chimeembryochild as main charactersunflowerancestrylearning to readblessinglighting a candlebig bangblowing bubblessomersaultdeath in familybad newsplainplaying catchtarkovskyesquebb gunwading in waterwalking on a beachstrict fatherdaily lifedestroying propertyholding head underwaterpatentpipe organwatering cantime capsulewanting to dieartificial respirationhand clapping gamebegins with a quoteresentment toward fatherlimping manreference to johannes brahmsschool bellstreetlightrolling down a hilltree swingplanting a treebegins with a quotationreference to jobhanging out washingtolling bellorigins of lifeveinair rifleelectrical shockfloating in the airglass elevatorhairbrushglass coffinwaco texaseye maskfertilizationkicking a canpineconeddtdirgejumping from a treepantheismreference to arturo toscaninisurvival of the fittestdeath notificationbirth of sonhit with a boardice traylearning to walkparents arguing (See All) |
In the winter of 1820, the New England whaling ship Essex was assaulted by something no one could believe: a whale of mammoth size and will, and an almost human sense of vengeance. The real-life maritime disaster would inspire Herman Melville's Moby-Dick. But that told only half the story. "In the H …eart of the Sea" reveals the encounter's harrowing aftermath, as the ship's surviving crew is pushed to their limits and forced to do the unthinkable to stay alive. Braving storms, starvation, panic and despair, the men will call into question their deepest beliefs, from the value of their lives to the morality of their trade, as their captain searches for direction on the open sea and his first mate still seeks to bring the great whale down. (Read More)
| Subgenre: | independent filmcoming of agetragedycreature featuredisaster movie |
| Themes: | starvationcouragedeathrevengesuicidepregnancyfearescapeparanoiarivalryhopecannibalismself sacrificenear death experience |
| Locations: | storm at seashipwaterbeachboatfarmseacaveoceanstormnew englandship fire |
| Characters: | husband wife relationshipfather son relationshipboywritertough guylittle girlcousin cousin relationshipdaughtership captain |
| Period: | 19th century1850s1820s |
| Story: | sinking shipanimal attacklost at seacastawaypacific oceandolphinshipwreckwhalesailornovelisthungertold in flashbacksurvivorsubtitled scenelightning …underwater scenemapaxesubjective camerasurvivalislandvomitingknifebare chested malebloodgunphotographexplosionchasesurprise endingpistolbased on true storyfirebased on bookcorpsehorseshot in the headslow motion scenefalling from heightletterrifleheld at gunpointhallucinationdeath of friendimpalementnonlinear timelineno opening creditsbirdchild in perilnecklaceconfessionattempted murderauthorlegendattackcharacter's point of view camera shotcover upskeletonamerican flagpigchickendisastercaptainwhat happened to epilogueheavy rainloss of friendskullmexican standoffsocial commentaryretirementwhiskeyhaunted by the pasttensionfloodbraverycannibalevacuationrowboataerial shotrainstormmoral dilemmaexpeditiontestimonysailboatyoung version of characterhurricanetavernindustrysouth americamassachusettsinnexploding shipsole survivorcockney accentanimal killingrookiegiant animalvoyagecompasssailing shipthirststarts with narrationflintlock pistolhorse drawn carriageleadershipblond manspaniardbritish actor playing american characteremaciationharpoontidal waveecuadoranchorabandoned shipmalnutritiondesert islanddehydrationhuman skeletonlancespyglassreference to moby dickrationingsailclosing eyes of dead persongiant wavewhalinginquirysinking boatnepotismunderwater explosionmaroonedwill to liveessexinquestman versus naturenecklace yanked offcutting a ropemale rivalryschoonerbrigrow boatwhalercabin boyfive dollar billnantucket islandyear 1850capsizing shipdrawing strawsrepairing a roofwhite whaleyear 1821first matesperm whale (See All) |
Deep into a solo voyage in the Indian Ocean, an unnamed man (Redford) wakes to find his 39-foot yacht taking on water after a collision with a shipping container left floating on the high seas. With his navigation equipment and radio disabled, the man sails unknowingly into the path of a violent sto …rm. Despite his success in patching the breached hull, his mariner's intuition and a strength that belies his age, the man barely survives the tempest. Using only a sextant and nautical maps to chart his progress, he is forced to rely on ocean currents to carry him into a shipping lane in hopes of hailing a passing vessel. But with the sun unrelenting, sharks circling and his meager supplies dwindling, the ever-resourceful sailor soon finds himself staring his mortality in the face. (Read More)
| Themes: | lonelinessdrinking |
| Mood: | rain |
| Locations: | storm at seawaterboatseastormyachtboat accident |
| Characters: | one actor |
| Story: | cargo shipswimming underwaterfalling into waterlost at seaoverhead shotflaresailorhungerwindsharksurvivorunderwater sceneapologymapeating …flashlightsurvivalswimmingvoice over narrationthree word titleknifeflashbacktitle spoken by characterfirefoodmirrorrescuecomputerdrinkbookf wordold manfishradiofishingdangerreadingsleepingeyeglassesdisasterropeclaim in titleshavinglooking at oneself in a mirrordesperationbraveryweatherall male castminimal castgloveshead woundalonevery little dialoguesailboatsailingraftknocked unconsciousone man showhammockin medias reswriting a letterwetnessinner title cardwetwrenchfloodingemergencydamagesolostatement in titlereference to ernest hemingwayhead bandagegodsshipping containersunburnglueminimal dialoguepaintbrushrepairdriftingnavigationcalling for helpmopping a floorsailindian oceansetting a fireboiling waternavalsinkingsosleakmessage in a bottlelife raftdeep seaone man filmfalling overboardradio signalsextantsleeping in a hammocksurvival kit (See All) |
Epic adventure Exodus: Gods and Kings is the story of one man's daring courage to take on the might of an empire. Using state of the art visual effects and 3D immersion, Scott brings new life to the story of the defiant leader Moses as he rises up against the Egyptian Pharaoh Ramses, setting 600,000 … slaves on a monumental journey of escape from Egypt and its terrifying cycle of deadly plagues. (Read More)
| Subgenre: | black comedyepicchrist allegorybiblical |
| Themes: | starvationcouragedyingfaithreligionmurderdeathrevengesurrealismpoliticsfearescapeweddingfuneraldeath of father …brutalityparanoiagriefillnesshopecrueltypanicfreedomhuntingcooking over a campfire (See All) |
| Mood: | raindarkness |
| Locations: | shipbeachboatdesertvillagefarmcavecampfirestormship explosion |
| Characters: | uncle nephew relationshipchristianityreference to godbrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsfather daughter relationshipboybrother sister relationshipsoldiersister sister relationshipthiefjewish …interracial relationshiplittle boybiblefishermanbaby boyfacial tattoo (See All) |
| Story: | animal attackoverhead shotcamelbelief in godthunderbroken leggoatlightningflash forwardpainunderwater scenejourneyapologysnakeeating …montageaxesurvivalsubjective cameraknifebare chested malebloodviolencebondagedogkissfightexplosionchasesurprise endingfirecryingcorpseshot to deathfoodhorseshot in the chestrescuebattleswordarrestfalling from heightshowdownliehand to hand combatrunninginterrogationhallucinationcombatshot in the backspyassassincandlesword fightold manmountainarmyimpalementstabbed to deathstabbed in the chestfishno opening creditskingsearchshot in the legdrowningperson on fireattackliarrace against timestatuetentknocked outdeath of childhangingpursuitdeath of sonthreatthreatened with a knifechickengeneralwhippingcowtrustarsonbattlefieldprincerioteavesdroppingdestinysabotagedestructionbow and arrowkilling an animalspearassassination attemptmass murderheavy rainhelmetslaverydiseaseragebeardhidingfrogsheepparadetorchmilkcrushed to deathslaveeaten aliveguardpromiseshieldsufferingconstruction siteloss of sonstabbed in the throategyptironyshot in the faceprophecydelusionexilehit on the headsibling rivalryarmorclifftribedead boydaggerpalacehorseback ridingtombsaving a lifebarking dogsunsetjudaismmummydead animaldoubttreasoncrocodileplagueshoutingstabbed in the armwelltornadoseagullhearing voicesflyfilm starts with textpyramidadopted sonsense of smellsword and sandalstabbed in the shoulderempireshot in the throatarcherhonestymaggotcaravanstabbed in the facefather son reunionwaking upmilitary trainingmonumentman on firehorse and wagonshepherdfloggingancient egyptvillain not really dead clichethronehebrewchantinglootingcatastrophemercylambfalling off a cliffcobraquarryflaming arrowrunning for your lifemessengerhusband wife reunionegyptiandead babyguerilla warfarepharaohgallowssandstormembroiderydead fishtidal wavebased on the bibleexodusomenkiss on the foreheadwalking in the rainmarriage ceremonysphinxgrapeanimal sacrificechariotclappingvenomemancipationlanceswarmencampmentbedouinpriestesscarrying a dead bodydivine interventionold testamentreference to abrahampassovertalking to godweavingeldermosesbuilding explosioncatfishinhumanityadvisorbolt upright after nightmarecavalry chargecovered wagonwading in watergiant wavereunited familylocustnile riverpublic hangingburning a dead bodyadopted brothercradleface paintinghaillandslideloomoxenmudslidered seaspinning wheelhorse drawn wagonshiveringmountain roadten commandmentstrampled to deathviceroycrocodile attackact of godboildeath of a horseescape from slaveryseditionvolley of arrowsbiblical plaguesburning bushcamp sitesword held to throatdead duckgrand vizierox cartcanaanwedding vowsbody soreswarm of insects (See All) |
Hank, stranded on a deserted island and about to kill himself, notices a corpse washed up on the beach. He befriends it, naming it Manny, only to discover that his new friend can talk and has a myriad of supernatural abilities...which may help him get home.
| Themes: | lonelinessfriendshipsurrealismjealousyfeardrunkennessmemoryfalling in lovefear of death |
| Mood: | rain |
| Locations: | beachforestbuswoodscavecampfiresinging on a bus |
| Characters: | reference to godhusband wife relationshipmother son relationshipfather son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerpolicemanlittle girlcoronerconsidering suicide |
| Story: | swimming underwaterfalling into water11 year oldnicknamesurvivorbearfantasy sequenceflash forwardunderwater sceneapologyeatingmontagesurvivalreference to jesus christisland …urinationthree word titleflashbacksexmasturbationfightphotographexplosionsingingpartychaseerectionshowerfirecell phonesongcorpsefoodface slapslow motion scenebare buttfalling from heightbooksunglassesbirthdaydead bodyhallucinationhandcuffsf wordambulancebridgesuicide attemptfishmicrophoneprologuemistaken identityskeletonhangingpursuitwigsleepingtrustkilling an animalfriendship between menlistening to musicscene during opening creditsmagazineflatulencecrying manembarrassmentlostlaughterhomoeroticismmale male kissdead motherfast motion scenevodkatext messagingearphoneslevitationdefecationwebsitename callingtrashtv reporterpopcornbearded manhearing voicesnoosebody baggurneybeltsleeplessnessman on firefade to blackraccoonleg woundstory tellingthirstman in dragjet skicowardicecrutchlooking in a windowhead bandagelullabyhumminggrappling hookgaggingtwo directorsbear attackcarrying a dead body40 year oldtalking about masturbationkilling a birdcall for helpshadow playbrought back to lifereference to the internettv cameramanberriespunched in the mouthbotched suicidereference to halloweendeserted islandcorkdead body on beachdecompositionreference to netflixtalking to a dead bodyflashback montagecrawling on the groundcrawling on hands and kneesreference to vaginatalking corpse (See All) |
| Themes: | infidelityadulterydrinkingfeardrunkennessmemoryextramarital affairdivorcedepressiondrug useunfaithfulnesswealthtechnologyhuntingcamping |
| Mood: | nightmare |
| Locations: | swimming poolrestauranthotelhelicoptersnowdesertbicycletaxielevatorvillagewoodstaxi driverusa |
| Characters: | uncle nephew relationshipmuslimreference to goddancermother son relationshipfather son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshiplittle girlwaitresslittle boy …employer employee relationshipamericanamerican abroadgrandfather grandson relationshipdriveryounger version of characterbaby girlasking for forgiveness (See All) |
| Story: | swimming underwateroverhead shotarabic11 year oldreading a book12 year oldprayingcamelanimated sequenceswimsuitbearbusinessmanflash forwardunderwater sceneapology …montageswimmingreference to jesus christvomitingdancingbare chested malebased on novelflashbacksexbloodbare breastsgunkissfightcigarette smokingpartyshowertelephone callunderwearmirrorwatching tvcomputerdrinkundressingpaintingriflebeersunglassesbombneighborhallucinationalcoholtelephonef wordbridgearmycocainedrivingkingtalking to the cameracoffeeconfessionhotel roomprologuesuitcasedolltentcollege studentbusinessinjectionhairy chestlaptopgardensleepingtrustfreeze frameprincehenchmanpickup trucksurgeryeyeglassesshavingteawolfhypodermic needlelooking at oneself in a mirrorlistening to musicscene during opening creditsarchitectcrying womanculture clashsheepguardpromisewhiskeymiddle eastconstruction siteinfectione mailhologramsalesmanvoice over lettercellphonebalconyfemale doctorcorporationduct tapesurgeonbrushing teethsports carchauffeurvodkareference to elvis presleyhandshakenew jobbandageconstruction workereconomymen's bathroomstairwayname callinghangoverroller coaster14 year oldtraffic jamknocking on a doorparamedicjacket15 year oldstethoscopereceptionistscalpelstrokebeach housemosquetour guidegurneysexual frustrationmetal detectorpark benchsleeplessnesscocaine snortingintercomsex on the floorstory tellingfictional cityselfiehijabsleeping bagtumorstrobe lightnational parkdivorced manbottled waterdanishtradejoke tellingsaudi arabiaworrying21 year oldcold the temperatureanxiety attackband aidslip the undergarmentauto repairmotorscootercar rentalreference to new york citybowingarchitectural modeloversleepinganesthesiaelectric razorlong underwearsnorkelinghot wiring a carolive oilblufflesionfalling to the groundreference to starbucksair conditioningcomputer techniciananalogyreggae musicstranger in a strange landreference to texasunderwater kissflip phonereference to chicago illinoisreference to englandmeccareference to new jerseyjet lagreference to boston massachusettsreference to chinareference to the ciareference to kentucky fried chickensaudibiopsyreference to soren kierkegaardmedical operationreading a book to a childteleconferencingviking helmetbuilding a sheltercystneedle and threadcloakroomcollapsing chair (See All) |
A regular family - Maria ('Naomi Watts' (qv)), Henry ('Ewan McGregor' (qv)) and their three kids - travel to Thailand to spend Christmas. They get an upgrade to a villa on the coastline. After settling in and exchanging gifts, they go to the pool, like so many other tourists. A perfect paradise vaca …tion until a distant noise becomes a roar. There is no time to escape from the tsunami; Maria and her eldest are swept one way, Henry and the youngest another. Who will survive, and what will become of them? (Read More)
| Subgenre: | independent filmsuspensetragedydisaster filmdisaster movie |
| Themes: | couragedeathchristmasfearmemoryangerparanoiagriefhopenear death experience |
| Mood: | rainnightmareambiguous endingtearjerker |
| Locations: | swimming pooljunglewaterbeachhospitalrestauranthotelhelicopterairplaneairportseatruckoceanblood in water |
| Characters: | reference to godteenage boybrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsdoctortattooboyfemale protagonistnurselittle boyterrorgerman …americanamerican abroadtruck driver (See All) |
| Period: | 2000swinteryear 2004 |
| Story: | swimming underwaterfalling into watermotivationaloverhead shotreading a bookshipwreckwindswimsuitsurvivorpainunderwater sceneapologymapeatingsurvival …subjective cameraswimmingurinationbare chested maleflashbackfemale nuditynuditybloodmale nuditybare breastsfemale frontal nuditymale rear nuditytwo word titlekissphotographsurprise endingbased on true storytelephone calltopless female nuditycryingcell phonecorpseblood splatterfoodblonderescueslow motion scenewatching tvundressingbikinitearsrunningdead bodytelephonecleavagewinemountainfishno opening creditsbirdscantily clad femalechild in perilsearchold womantreescreamingcharacter's point of view camera shotvacationrace against timesuitcasetentscreamscarinjectionfemale removes her clotheshairy chesttragic eventreunionflowersleepingstrong female characterholidaypickup trucksurgerydisasteritalianhuggingdestructionwoundhypodermic needleinjurytouristteddy bearhome moviestrong female leadearthquakepresumed deadwatching televisionpromisebarefootreverse footagetensionfloodtelescopesufferingstarbraveryinsectballchristmas eveinfectionaerial shotwedding ringfemale doctorcanenotelanternholding handsmoral dilemmaseparationsunbathingclose up of eyesasiaenglishman abroadearphoneshistorical fictionchristmas presentdead animalrepeated scenehead woundnude14 year oldcoca colano title at beginningresortnude girlfilm starts with textstretcherfallingbare feetkindnessbleedingpalm treegurneyclimbing a treenatural disasterhome videoscarfoverhead camera shotfather son reunionspitting bloodfrenchmantsunamimattressping pongfade to blackwaveleg injuryleg woundorangebeetlecatastrophefloodingmissing fatherreference to santa clausenglishwoman abroadhusband wife reuniondevastationfamily vacationoxygen maskmother son reunionsoutheast asiadead fishtidal wavemissing sonstar gazingceiling fancold the temperatureseparation from familythaithree brothersfear of flyingvomiting blood9 year oldlooking through a windowblenderseat belt7 year oldbeach resortsitting in a treeswedename tagmissing husbandmissing wifemissing brothermissing motherwading in waterindian oceanface woundrubbledragging someonenear drowningrapidssnorkelingassumed deadbeach ballbrother brother reunionturbulencesoda popfive year oldmissing boyone breast exposedantibioticsearch for familyopening creditstorn clothesclothes cut offphuket thailandtangerineboxing daylifting a boy into the airsplashing water on someoneshoulder wound2004 indian ocean earthquake and tsunami73 year oldmissing familypaper lanternred ballswept awayfather son reunitedfloating lanternhole in ceilinglantern festivalthree sons (See All) |
A couple on a holiday in the Caribbean decide to spend the day on a scuba diving trip. But was it the wrong decision? When a mis-count happens on the boat, Susan and Daniel are left behind in the middle of the ocean, the boat long gone. With all their hopes set on the boat coming back to rescue them …, they try to keep themselves safe, especially when sharks start to appear. (Read More)
| Subgenre: | independent filmpsycho thriller |
| Themes: | lonelinessdeathdrinkingfearnatureangerparanoiaillnessphotographypanic |
| Mood: | darkness |
| Locations: | swimming poolshipwaterbeachhotelhelicopterairplaneboatoceandeath at sea |
| Characters: | dancerhusband wife relationshipchildrenphotographer |
| Story: | lost at sealizardhungerdivingsharkswimsuitlightningunderwater sceneeatingsurvivalswimmingislandurinationknifedancing …bare chested malefemale nuditybloodfemale frontal nuditykissfemale full frontal nuditynipplesmale full frontal nuditybased on true storytelephone callcell phonecorpseunderwearfoodwatching tvcomputercameradrinkbikinisunglassesbedlow budget filmcleavagewomanfemale pubic hairfishbirdscantily clad femalesearchargumenthotel roompoisonvacationsuitcasemissing personactor shares first name with characterscene during end creditshairy chestdeath of husbandisolationcharacter says i love youfirst partunderwatersleepingmachetetouristtimefateboxer shortsinsectdespairthunderstormbrushing teethalarm clocklaptop computerlighthousesunsetface maskminimal castglovesstrandedabandonmentresortscuba divingtour guidebased on true eventsnude with glassesgogglesshark attackdovetropical islandairlinerjellyfishcoconutseaplanefloatinginstructorworryingsunburnboatingdehydrationpelicansuntan lotionleft behindstingbuoysuicide of wifereference to katharine hepburnoil tankerwet suitbittenfrenzysuntandeep sea divingman against naturetropical fishtourist resortdaybreakshark bitediving equipmentair tankdiving instructorleg crampmovie gameswim fins (See All) |
In February of 1952, one of the worst storms to ever hit the East Coast struck New England, damaging an oil tanker off the coast of Cape Cod and literally ripping it in half. On a small lifeboat faced with frigid temperatures and 70-foot high waves, four members of the Coast Guard set out to rescue …more than 30 stranded sailors trapped aboard the rapidly-sinking vessel. (Read More)
| Subgenre: | tragedydisaster film |
| Themes: | couragefriendshipdeathlovefearheroparanoiahopepanicnear death experience |
| Mood: | against all odds |
| Locations: | storm at seashipwaterbarchurchsnowsmall townboatnightclubpolice carseaoceanstormfishing boatnew england …singing on a boat (See All) |
| Characters: | mother son relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshiptough guysingle motherfishermanengineerfiance fiancee relationshipship captain |
| Period: | 1950swinter |
| Story: | sinking shipfreighterlifeboatshipwreckprayingsailor3 dimensionalcookflash forwardunderwater scenemapaxeflashlightsurvivaldancing …photographexplosionsingingpartysurprise endingbased on true storybased on bookcorpsecar accidentrescueslow motion scenewidowdinerno opening creditsradiosearchmarriage proposalbinocularscharacter repeating someone else's dialoguedangerpay phonemissionrace against timelong takeautomobilesingle parentdisastercard gamedestructionwhat happened to epilogueheavy rainphone boothjumping from heighthitchhikerhitchhikinghaunted by the pasttensionfloodbraveryitalian americanobesitypower outagelove at first sight3daerial shottitle at the endrainstormpierdark pastrescue missionweathersouthern accentheroismlighthousefirst dateno title at beginningredheaded womanblizzardaltered version of studio logomassachusettstragic pastdistrustportradarcompassgas explosionworld war two veteransnowstormbritish actor playing american charactercoast guardboiler roomtidal wavesearchlightcoastal townsearch and rescueyear 1952seamangiant waveemployee employee relationshipu.s. coast guardoil tankeryear 1951commanding officernorth atlanticyoung widowrejecting a marriage proposalman versus natureradio operatorassertive womanwoman proposes marriagecapsizing shipship run agroundsmall town america (See All) |
In the taut thriller The Shallows, when Nancy (Blake Lively) is surfing on a secluded beach, she finds herself on the feeding ground of a great white shark. Though she is stranded only 200 yards from shore, survival proves to be the ultimate test of wills, requiring all of Nancy's ingenuity, resourc …efulness, and fortitude. (Read More)
| Subgenre: | black comedysuspensefound footagefish out of watercreature featureaustralian horroramerican horrorspanish horror |
| Themes: | couragemurderdeathfearescapemonsterdeceptiondeath of motherparanoiacancerpanicnear death experience |
| Mood: | goredarknesspoetic justice |
| Locations: | mexicowaterbeachforestseaoceantexasblood in watersea water |
| Characters: | father son relationshipfather daughter relationshipboyfemale protagonistsister sister relationshipthieflittle boyvillainhispanicterroramericansingle fatherdriverself surgery |
| Story: | flare gunanimal attackdolphinflarewhalehungerdivingsharkloss of mothersplit screenflash forwardunderwater scenesubjective camerasurvivalswimming …islandflashbackbloodviolencetwo word titlephotographchasesurprise endingfirecell phonecorpseblood splatterrescueslow motion scenecamerabikinishowdownf wordbrastabbingimpalementnonlinear timelineno opening creditslooking at the cameranecklacetalking to the cameraracial slurdangerscreamingwidowerelectrocutionattackrace against timetough girlstalkingdie hard scenariosingle parentstrong female characterrocktouristhelmetstealingwristwatchdesperationsurfingvictimladderstrong female leadeaten alivemexicanfemale warriorwoman in jeopardytensiontrappedbraverysandescape attemptdrunkaerial shotsexy womancellphonechainethnic slurfast motion scenetorso cut in halfclose up of eyestext messagingfinal showdownminimal castvomitdead animalhomagesurferearringseagullyoung womandrunkardfoot closeuppursepredatorcoughingfemale heroepiloguesurfboardpalm treemedical studentcrabsoccer ballvideo footageold photographtextingin medias rescamera phonepsychotronic filmimprovised weaponmurder spreeanimal killinggrindhouse filmwavebilingualismshark attackextreme close upleg woundcat and mousejellyfishtalking to selfrescue attemptwine bottletime limitflesh eatingsingle set productiontalking to an animaltijuana mexicotidal wavestopwatchkiller sharkanchorlittle sistershoredehydrationhypothermiayelling for helpeating human fleshgreat white sharkpreyagainst the oddshell on earthman eaterreefbody partstidecut off jeansbuoyjawsripped in halfcellular phonegangreneamerican touristtough womancontainmenthumpback whalesmiley faceflare gun as weaponman versus naturesunscreensurfer girlthrowbackone year lateropening creditsreference to steven seagal1 year latergoprofemale surfertalking to a birdalone against the oddsshark bitelow tidebitten in the legtext messaging on screenbig wavehigh tidebroken wingcalling someone buddy (See All) |
| Subgenre: | epicchrist allegory |
| Themes: | faithreligionmurderdeathloverevengemarriagebetrayaljealousypoliticsescapedeceptionangerbrutalityredemption …home invasionexecutionhopeblindnessvengeanceamnesiaforgivenessself sacrificenear death experience (See All) |
| Locations: | shipwaterbeachsnowcemeterydesertvillagesearooftopcaveoceancampfiresea battle |
| Characters: | christianityreference to godhusband wife relationshipmother son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipbrother sister relationshipsoldierhostagetough guywarriorteacher student relationshipjewchildhood friend |
| Story: | sinking shipadriftoardrummiraclelightningflash forwardunderwater scenemontageaxeorphanvoice over narrationknifedancingcharacter name in title …bare chested malebased on novelflashbackbloodviolencedogtitle spoken by characterexplosionpartysurprise endingfirecorpsehorseshot in the chestremakeshot in the headslow motion scenebattleswordarrestlettershowdowncombatsword fightmountainarmyprisonerstabbed in the chestnonlinear timelinefalse accusationno opening creditsdisarming someoneassassinationracial slurtrainingperson on firetentlong takecrossgiftreunionthreatened with a knifesevered armwhippingbare chested male bondageclass differencesqueenbattlefieldprincecircusbow and arrowassassination attemptheavy rainfriendship between menhelmetslaverycrucifixbeardrebelrebellioncrying mantorchcompassionsocial commentarydebateslavepresumed deadcelebrationreverse footageshieldresistancewhiphatredmercilessnessdeath threatgreeceoilsibling rivalryrainstormbalconybetwar veterankingdomstadiumsevered legdaggermoral dilemmapalaceman cryingbriberynarrated by characteroppressioncrucifixionfinal showdownspiral staircasemale friendshiphorse racingshot with an arrowamputeejerusalemarcherygovernorraftemperorcheering crowdarenahead injurywagerpalm treestablesword and sandalfight the systemchainedparaplegicarcherbettingancient romecarpenterbowhorse racefreedom fighterresistance fighterbanquetdreadlocksloinclothtotalitarianismnomadloss of memoryrowingroman empiredinner tableflaming arrowstabbed in the sideromansheikcaught in the rainjesus christlobotomydiscipleseparation from familydeus ex machinanaval battle1st centurychariotfirst aidleprosycrucifixion of jesusroman soldierjerusalem israelcannonballzealotreference to julius caesarjulius caesarenslavementlepertunicshackledadopted brotherslave girlcenturionremake of remakeriding accidentroman legionchariot racepontius pilatefast forwardleper colonytrampledcapsizeroman armycarrying someone over shouldercoliseumrebel fighterroman salutewhipping scars (See All) |
The man-cub Mowgli flees The jungle after a threat from the Tiger Shere Khan. Guided by Bagheera the panther and the bear Baloo, Mowgli embarks on a journey of self-discovery, though he also meets creatures who don't have his best interests at heart.
| Subgenre: | disney |
| Themes: | couragefriendship |
| Locations: | junglevillagecave |
| Characters: | human animal relationshipboy |
| Story: | animal companionorangutanrhinocerostigerelephantmonkeybearjourneyorphanbased on novelflashbacksingingfireremakeriver …good versus evilno opening creditstreemanipulationwolfburned alivetalking animaltorchmusical numberdeerbonfiresquirrelbellbare chested boyfriends who live togetherclimbing a treenight timevulturebuffalohoneyvinehowlingpantherstar died before releasestampedegiant snakepythonwolf packbowingporcupineblack pantherwildfirewild childfighting backlive action remakegiant apewild pighoneycombtalking bearbaby elephantingenuitywolf cubtreetophuman bear relationshipraised by animalstalking snaketalking wolf (See All) |
Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr …overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)
| Subgenre: | coming of ageteen movieperiod film |
| Themes: | writingdyinglonelinessfriendshipsuicidedrugschristmasjealousydrinkingfeardanceincestmemoryseductiondepression …drug usecancerguiltdatingmental illnesspoetryabusebullyingunrequited lovehomophobiabreak upcheatingfirst lovedying from cancerdeath of best friendsuicide of friend (See All) |
| Mood: | high school |
| Locations: | catholic churchhospitalrestaurantchurchsnowtrucktunnelpennsylvaniaschool dancekitchen knife |
| Characters: | catholic priestcatholicreference to goddancerteacherteenage boybrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipshomosexualteenagerfriend …boyfriend girlfriend relationshipdoctorsingerboybrother sister relationshipteenage girlgirlpolicemanphotographerwriterpriestbest friendgay kissbullylittle boyteacher student relationshippsychiatristgay teenagergay relationshipaunt nephew relationshipboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All) |
| Period: | 1990syear 1991 |
| Story: | aspiring writer11 year old12 year oldnicknamebuddhistclassflash forwardpainapologyeatingsubjective camerareference to jesus christprayerclassroomvoice over narration …knifedancingbased on novelflashbackkissfightphotographsingingpartytelephone callcryingbeatingfoodcar accidentmirrorface slapslow motion scenepunched in the facewatching tvcamerawritten by directordrinkcondomsecretlettershootingbooktearsrunningbirthdaycafemarijuanabathroomcollegehallucinationtelephonef wordgay slurbedroomwinecandledeath of friendfootballsuicide attemptdinnerchild abusedrivingracial slurlibraryvirginreadingchristmas treecollege studentprankhigh school studentcheerleaderglassesrock 'n' rollsadnesssix word titlereference to william shakespearetypewritertrustteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualhuggingfireplacelooking at oneself in a mirrorlistening to musicsexual abuseice creamred dresshappinessamerican footballmovie theaterimpersonationnew year's evecrushvirginityclockpromisemovie theatreinnocencepillssufferingmobile phonebackstagepunched in the stomachsexismkaraoketaking a picturemental hospitalfootball playertheatre audiencefirst kisschristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingothgraduationshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingteenage lovefirst dateadolescencechild molestationblackoutlooking out a windowharmonicaponytailschool principallsd16 year old15 year oldstonedkiss on the lipsunhappinessgiving a toastveganhazingtutoreasterpromaudio cassettehouse partylip synchingcar radioteenage crushdance scenewriting a letterabusive boyfriendwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actreference to frank sinatracrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school dancehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glasseslast day of schoolenglish classfacial injuryprincipal's officeacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailmix tapewriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All) |
In late 1951, Eilis Lacey, a young Irish girl, emigrates to Brooklyn. Sponsored by Father Flood, a priest from her native town Enniscorthy, she is assured to find a full-time job there. But the early days are tough, seasickness being soon replaced by loneliness and homesickness, two feelings all the … more acutely felt by Eilis for having had to leave behind her widowed mother and her dear sister Rose. She nevertheless little by little manages to find her footing by adapting to her job as a salesgirl, by studying bookkeeping at Brooklyn College as well as with a little help from both Father Flood and Mrs. Kehoe, the owner of the boarding school she now lives in. And not only does graduation follow but love shows its face in Tony, an Italian-American plumber, full of adoration and respect for her. They end up marrying, although keeping the thing secret. It is at that point that tragedy strikes inciting Eilis to return to Enniscorthy to support her mother morally. And there a strange thing happens : she gradually gets lured by the charms of her native place, going far as to let herself be wooed by Jim Farrell, a young local. (Read More)
| Subgenre: | melodramafamily tragedy |
| Themes: | lonelinessfriendshipdeathmarriagechristmasmoneyjealousydrinkingdanceweddingtraveldatingillnessfalling in loveprejudice …death of daughter (See All) |
| Locations: | catholic churchshipschoolbeachnew york citybarrestauranttrainsnowcemeterytaxiapartmentbaseballusa |
| Characters: | catholicreference to goddancerstudentteacherbrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerfemale protagonistpriest …sister sister relationshiplove trianglebest friendemployer employee relationshipself deception (See All) |
| Period: | 1950swintersummer |
| Story: | crossing oneselfseasicknessrespectteasingswimsuitclassjourneyapologyeatingsubjective cameraswimmingreference to jesus christprayerclassroomvomiting …dancingbare chested malebased on novelone word titlesex scenekisscigarette smokingphotographtitle spoken by charactersingingtelephone callcryingsongfoodmirrordrinkundressingsex in bedlettertearssunglassesbedbathroomrivermanhattan new york citytelephonef wordbandold manambulancewomanimmigrantvoice overgraveyardmarriage proposalimmigrationgraveprologuesuitcasechristmas treeflowersamerican flagtragic eventcrosssadnesspremarital sexirelandeuropefreeze frametwenty somethingeyeglassesitalianapplausewaitergolftealoss of virginitylooking at oneself in a mirrorlistening to musicworking classwatching a moviecrying womangossipirishbrooklyn new york citycommunitypromisegrocery storeitalian americandeath of sistervoice over lettersnowingfamily dinnertrophydivorceebenchpipe smokinglocation in titleengagement ringaccountantwedding ceremonyshynessheartbreakirish americanmake upemigrationdead fathergolf clubname callingadvicedepartment storegiving a toastwhistlingbunk bedplumberrugbyloss of sisterwoman in lingeriemarriage engagementclothingreading a newspapergravestonesleeplessnessanguishreturning homenew york skylinespaghettibride and groomemigrantdiarrheachurch serviceboarding housefemale in swimsuitfemale sitting on a toiletreading a lettertrolleymirror balllong island new yorkdead husbandchristmas dinnerhomesicknessblowing a kissconey island brooklyn new york citynylonslittle brothercotton candybigger dreamssecret marriagewaving goodbyeyear 19528 year oldwolf whistlelandlord tenant relationshippacking a suitcaseirish accentreference to gary cooperirish musiclamp postdear john letternativity scenesalesclerkbookkeeperreference to the new york yankeesirish immigrantpneumatic tubebrooklyn dodgersfemale flatulencefour brotherscivil weddingdual livescork irelandellis islandbookkeepingtorn between two menwedding vowsreference to the zombie apocalypse (See All) |
Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and … the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)
| Subgenre: | suspensetragedypost apocalypsedystopiaepicchrist allegory |
| Themes: | starvationdyingfriendshipmurderdeathrevengesuicidekidnappingbetrayalfeartortureescapedeceptionmilitarytravel …angerbrutalityobsessiondeath of motherparanoiaredemptionhopedeath of wifepanicself sacrificenear death experiencemurder of familyprison escapefuture war (See All) |
| Mood: | raindarkness |
| Locations: | junglewaterbeachforesthelicoptersnowdesertvillagewoodscavecampfiretunnelmilitary truck |
| Characters: | brother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipstattoosoldierbabyhostagelittle girlsnipersniper rifledeath of a friend |
| Period: | near future |
| Story: | animal fightanimal attackorangutanloss of familyloss of brothersubtitled scenemonkeyloss of motherjourneymapmontageaxeflashlightorphansurvival …subjective cameraknifebare chested maleflashbackbloodviolencesequelfightphotographexplosionchasesurprise endingpistolfireshootoutbeatingdreamcorpseshot to deathfistfightfoodmachine gunhorseshot in the chestshot in the headshotgunrescueslow motion scenebattlegunfightbrawlfalling from heightshootingshowdownrifleheld at gunpointsunglassesinterrogationhallucinationalcoholcombatshot in the backambushstrangulationmassacremountaindeath of friendbridgearmyimpalementprisonerweaponno opening creditspart of serieschild in perilfictional wardouble crossthird partattempted murdertreebinocularsbeaten to deathdangerattackcharacter's point of view camera shotmissionrace against timedollknocked outtankopening action scenedeath of brotheramerican flagtragic eventexploding bodydeath of sonwaterfallflowerhandgunwhippingbattlefieldak 47missileropetraitorshavinghand grenadesabotagegrenadedestructionbow and arrowspearwarehouseheavy rainmachetetalking animalcagequesthelmetviruscaptivewalkie talkiecrucifixstealingloss of loved onebeardhammerexploding buildingloss of wifeblockbusterdesperationlaserrocket launchertorchburialcolonelsocial commentaryprison guardfloodinvasionu.s. armycrossbowloss of sonwhiphatredmercilessnessmutespecial forcesdeath of protagonistassault rifleinfectionaerial shotprisoner of warshadowcommandocapturebulletproof vestcliffbordertribesnowingrescue missionlasersightarrowbonfiredeath of loved onerpgexploding helicoptersign languagesmokemoral dilemmashaved headgatling gungrenade launchermain character diesimprisonmentfemale soldierabandoned buildingflagfinal showdownreturning character killed offarmored caralarmabandoned houseshot with an arrowgorillawallshoutinghugclimbingkidhelicopter crashfilm starts with textfallingbehind enemy linesmercy killingblizzardrazorleaderbody bagaltered version of studio logofinal battleskychainedchimpanzeepart computer animationcommando raidmurder attemptaperighteous ragedeath of familybowtragic endingholepsychological tortureavalancheheroic bloodshedhermitanimal killingarmy baseassisted suicidevalleyknocked out with a gun buttberetfleeingloggas explosiontrilogyphotoepic battlehorse chasemercypunchingkeysleadershipbarricadeguerilla warfaremilitantleft for deadshot in the sidewhite horsenational anthemsaddlestar spangled bannersurprise attackexoduspickaxeoutrunning explosionmissile launcherplatoonslave laborspear throwingforced laborprisoner of war campsecret tunneldarwinismtexthead shavingmute childunderground tunnelescape planprovocationoasissimian fictionfeedingmilitary campexploding bridgelast wordsprequel and sequellockupcoverman versus naturemilitary jeeptalkingcaesarfernplanet of the apes50. caliber machine gunsequel to a rebootthrowingturncoattalking animalsfall downapesrolling (See All) |
Garland's novel centers on a young nicotine-addicted traveler named Richard, an avid pop-culture buff with a particular love for video games and Vietnam War movies. While at a hotel in Bangkok, he finds a map left by his strange, whacked-out neighbor, who just committed suicide. The map supposedly l …eads to a legendary island paradise where some other wayward souls have settled. (Read More)
| Themes: | murderdeathsuicideinfidelitydrugsbetrayaldrinkingdrunkennessfuneralextramarital affairtravelblackmaildrug useinsanityfreedom …utopia (See All) |
| Mood: | rainnightmarepretentiousness |
| Locations: | jungleshipbeachtrainhotelboatvillagepolice stationcampfire |
| Characters: | christianitydancerpoliceboyfriend girlfriend relationshiptattoophotographerlove trianglefrenchamericancheating on girlfriend |
| Story: | animated sequencesharkcookmonkeyfantasy sequenceunderwater scenemapsurvivalswimmingislandvomitingvoice over narrationknifedancingbare chested male …based on novelflashbacksexfemale nuditybloodmale nuditytwo word titlegunsex scenekissphotographtitle spoken by characterchasepistoltelephone callcorpseshot to deathblood splattermachine gunshot in the chestwatching tvcomputercameradrinkbikinisecretliebeerbeddead bodymarijuanashot in the backsoccerdeath of friendimpalementfishcultdream sequencefishinggravepossessionpassiontentfarmerprankpursuittrapwaterfallmoontwenty somethingak 47pot smokingdesireinjurytouristhappinessjumping from heightcommunityburialpassportguarddentistsoapbackpackhippiedelusionenglishbooby trapblood on shirtdead manfieldplantmarijuana jointcartoon on tvcannabisdiscoverysecret societyelectronic musicresortvolleyballdrug traffickingmercy killingwrist slittingcricket the gameleaderrussian roulettecrotch grabtitle same as bookdisillusionmentfirst person narrationpleasurecommunehedonismguerrillashark attackfleeingtropical islandbitecaterpillarparadisetrail of bloodtreasure mapscottalking to selfbangkok thailandwashingblood drinkingjumping off a cliffsecrecyostracismsoutheast asiabackpackingthailagoonbackpackerinternet cafelistening to sexsettlementbeach resortguerrilla warfaredeath by suffocationtooth extractiongangreneself sufficiencygameboysound of sexgoing nativesecret islandspear fishingunderwater kissgroup photopet monkeyurban mythshark biteerrandleg bitingdecencypursuit of happiness (See All) |
In Bedridge, Professor Parker Wilson finds an abandoned dog at the train station and takes it home with the intention of returning the animal to its owner. He finds that the dog is an Akita and names it Hachiko. However, nobody claims the dog so his family decides to keep Hachi.
| Themes: | friendshipdeathlovechristmasjealousypregnancyweddingfuneralmemorydeath of fathertheatre |
| Mood: | raintearjerker |
| Locations: | schoolsnowcemeteryairplanebathtubkitchenjapanstormshed |
| Characters: | human animal relationshipjapanesedancerstudentteacherhusband wife relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipafrican americanfriendboygirlbabygrandfather grandson relationship …grandmother grandson relationship (See All) |
| Story: | reference to christopher columbusmotivationalwindtold in flashbackclassflash forwardanimalmontagesubjective cameraclassroomdancingcharacter name in titleflashbackdogsex scene …kissbased on true storytelephone callpunctuation in titlecryingremakewatching tvcomputercatcamerabeertearsanimal in titlebedapostrophe in titlepianonewspaperdeath of friendwidowcoffinforeign language adaptationbathsuburbbased on short storychampagnecharacter's point of view camera shotflowerspianistdeath of husbandballetsleepingreference to william shakespeareblack americanheart attackpickup truckapplauseloyaltywhat happened to epilogueslow motioncagerailway stationmilkinterracial friendshipremote controlmobile phoneballbookstoresnowingpuppywedding receptionphoto albumposterstairwayfencepopcornbellballerinatrain tracksepiloguecollege professorgravestonereference to shakespeare's hamletpolaroid camerashared bathwaitingdog moviebride and groomnewspaper reporterstreet vendorpoodlehot dog standskunkdog lovertalking to a dogbutcher shoprhode islandlost dogdog poundbarkinglocked in a cagereference to thomas edisonboy dog relationshiptripping and fallingdoghousehot dog vendorremake of japanese filmremake of asian filmanimal's point of viewcommuterart restorationmaster dog relationshipbarbecue grillwatching through a windowwedding photographbaggage handlerchange of seasonsdog cagefrench poodlestation masterdog's point of viewanimal licking someoneakitabaseball on tvmusic professorplaying fetchschool report (See All) |
The Lost City of Z tells the incredible true story of British explorer Percy Fawcett, who journeys into the Amazon at the dawn of the 20th century and discovers evidence of a previously unknown, advanced civilization that may have once inhabited the region. Despite being ridiculed by the scientific …establishment who regard indigenous populations as "savages," the determined Fawcett - supported by his devoted wife, son and aide de camp returns time and again to his beloved jungle in an attempt to prove his case, culminating in his mysterious disappearance in 1925. (Read More)
| Themes: | starvationdyingmurderpregnancydrinkingfearmemorytravelracismdeath of fathergriefcannibalismregretmurder of fatherarchaeology …murder of husbandmurder of son (See All) |
| Mood: | rainambiguous ending |
| Locations: | jungleshiphospitaltrainchurchboatlondon englandvillagetruckcavecampfirebrazilsinging on a boatrunning after a truck |
| Characters: | reference to goddancerteenage boybrother brother relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipdoctorsingerboybrother sister relationshipsoldier …christianlittle boygermanbaby boybiologistcrying boy (See All) |
| Period: | 19th century1920s1910s20th century |
| Story: | reading a bookwhistlehungerthundernicknamesubtitled sceneflash forwardunderwater scenejourneyapologysnakemapmontagesubjective cameraswimming …reference to jesus christvomitingdancingflashbackviolencebare breastsdoggunkisscigarette smokingphotographexplosionsingingchasepistolbased on true storybased on booksongdreamfoodhorseface slapslow motion scenedrinkbattlebare buttletterbooklieriflebeddead bodyrivernewspaperoperacandlemountainarmyhuman rightsfishno opening creditsbirddrawingmissionsuitcaserabbitpursuitgiftdeath of sonhorse ridingfeminismworld war oneirelandwaterfalltypewritersacrificenewspaper headlinebattlefieldeyeglassespoemapplausehugginggolddestinyfireplacebow and arrowwhat happened to epiloguespearcrying womanskullcrying mantorchcolonelorchestraslavegas maskreconciliationbraverybackpackinsectdespairballlostheavendeath of protagonistinfectiondeervoice over lettertribebigotryfieldhorse and carriagefortune tellergunfirenewspaper clippingexplorationenglishman abroadnews reporterbarbed wiresaving a lifewomen's rightsbarking doghandshakeexpeditionnotebookcanoereading aloudlecturename callingdiscoverymajorraftmedalflaskwhisperingknocking on a doorgiving a toastmailbayonetbritish armymilitary uniformfeverexplorersouth americatelegrammaggotequalitybagpipescompassleg woundtrenchbody paintloinclothchantingchurch bellresignationcowardiceboliviaportrait paintingthreat to killflame throwermutinyskepticismbaronhand kissingbrandypiranhawaltzcandelabraportugueseopera housepoison gastheorycablepantherdartkiss on the foreheadseparation from familygeographyriver rapidsvomiting bloodreference to adamdead deerpotterydeer huntingshot in the earlieutenant colonelwar paintdead rabbitwaving goodbyechristeningyear 1916amazon tribereading a letter aloudyear 1954surroundedfather slaps soneye bandagefalling off a horseamazon junglelost cityyear 1912burning a letterfalling into a riverknighthoodreference to judasborder regioncannibal tribenews conferenceprogressivismlost civilizationconquistadorrubberbuglegiving a speechkilled with an arrowindian chiefindian tribeamazoniakilling a deerkilling a rabbitfixationstranger in a strange landbritish officerreference to francetolling bellyear 1905year 1924year 1906year 1923blood poisoningdeer headgas attackgrabbed from behindtribal warfareback scarpan fluteconcertinacorn fieldear shot offbattle of the sommeel doradoreference to rudyard kiplingriver bargejungle expeditionrubber plantationcork irelandfacial makeupimitating someonereading a poem aloudlance corporalland surveyingaide de campchlorine gasfalling horselifted into the airmaizemap makingreference to portugalwhitewashing (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his …pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
| Subgenre: | fairy taledisneybiblical |
| Themes: | surrealismjealousyfearartmagicnatureangertheftunrequited lovehopeunemploymentfreedombook of magic |
| Mood: | rainarchive footagepoetic justice |
| Locations: | swimming poolshipwaternew york citytrainforesthotelcarsnowboatnightclubdesertbicycletaxielevator …woodsapartmentlaketruckrooftopcaveoceansewerforest fire (See All) |
| Characters: | dancerteacherfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshippolice officermusicianactorartistlittle girlbullywaitresscomedianfisherman |
| Period: | 1930swinter |
| Story: | dance classfalling into waterlife jacketarkflamingohippopotamuszebrarhinocerosbucketwhalecameldrummerhungerthundergoat …elephantmonkeybearratlightningpainsnakeaxesubjective cameraknifedancingnumber in titlesequeldogkisschasefirecryinghorsemirrorremakerescuecatfalling from heightbooktearsrunningcafepianorivernewspapermountainsubwayfishdream sequencedrawingfishingsearchanthologycoffeetreeportraitumbrelladragondollrabbitscreampianistsadnessunderwaternewspaper headlinejazzicewolffireplacedestructionfaintingperformancemagicianmousetoyoverallsclassical musicfrogtennisrailway stationpart animationviolinmilkorchestraclockembarrassmentapplepresumed deadanthropomorphismfloodtrappedhypocrisymisunderstandingpet doganthropomorphic animalrejectiondespairballlaughterlionbutterflyice skatingvolcanodaydreamshadowspyingdeerturtlecliffduckboxhorse and carriageflightweathercoinbatjoyspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainfoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatorwoodtemptationbeeperformerpopcornseagulllavaquitting a jobjacketsorcerercloudhostgreat depressionballerinadisappointmentimmaturityeaglealligatorasheshammockcrabmeteorpart computer animationrainbowhonestymistakeapepart live actiondrillpolar bearclumsinessconductorgymnasticskangaroowindowmiseryspringabstractcourtshipdoormanapprenticelocketgiraffenoiseblanketdoverebirthunicornrevolving doordance lessonregenerationstreet vendorice rinkbroombaldnesspaperfaunacity parkconformityflorasheet musicsignextinctionnetsubway trainbubblecoatphonograph recordvasehornwheelbarrowabstract artmovementfloatingostrichchestjazz clubfigure skatinghard hatleashvolcanic eruptioncartcollisionnoseorganisticebergskunksunlightcarrying someoneimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonpet storeelkiciclemarqueenoah's arkmilkmanfatiguehopscotchmusic lessonscubaramppuddlestooltripping and fallingashcauldronjazz combotubewhirlpoolcentral parkdizzinesssupernovaspellcastingbillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathsleeping in a chairbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionflower petalhenpecked husbandpantaloonwalnutlinebranchteardropflipperglowing eyestepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirdflooded roomtrampleddog bonetimingfruit cartlily padmagical hatseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All) |
A visionary sheik believes his passion for the peaceful pastime of salmon fishing can enrich the lives of his people, and he dreams of bringing the sport to the not so fish-friendly desert. Willing to spare no expense, he instructs his representative to turn the dream into reality, an extraordinary …feat that will require the involvement of Britain's leading fisheries expert who happens to think the project both absurd and unachievable. That is, until the Prime Minister's overzealous press secretary latches on to it as a 'good will' story. Now, this unlikely team will put it all on the line and embark on an upstream journey of faith and fish to prove the impossible, possible. (Read More)
| Themes: | faithreligionfriendshipdeathmarriagemoneydrinkingobsessionterrorismgriefhopefalling in lovewealthjustice |
| Mood: | rain |
| Locations: | waterrestaurantchurchhelicopterairplaneboatdesertlondon englandtaxicastleofficecampfirecanyon |
| Characters: | muslimreference to godhusband wife relationshipmother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipchildrenboyphotographerchinesefishermanengineer |
| Story: | reflection in wateroverhead shotarabicprayingmiraclegoatsplit screenunderwater scenejourneyapologymapeatingmontagesubjective cameraswimming …reference to jesus christprayerbare chested malebased on novelsexgunkisscigarette smokingtitle spoken by charactertelephone callcryingcell phoneunderwearfoodslow motion scenecomputercameradrinkundressingletterrifletearsanimal in titlerunningcafebritishriversciencetelephonescientistf wordnewspaperjournalistassassinwineterroristvideo camerafishfishingnews reportumbrellamissiontentthreatreunionnewspaper headlinepickup trucktv newstraitoranswering machinecaptainteasabotagedestructioncountry name in titleassassination attemptreference to adolf hitlerpropagandaislammagazinepress conferenceculture clashorchestrawatching televisionmiddle eastfloodbreakupboxer shortsministermobile phonescotlandpartnernewsreel footageafghanistanoilschool uniformarabvoice over lettertuxedomidlife crisisholding handsislamicprime ministertext messagingsaving a lifehandshakeshynesswar heroterritory name in titlenaivetylistening to a radioquitting a jobunhappinessdamgiving a toastcelloplaying a video gamepressdeath of boyfriendluckinternet chatsleeplessnessradio newsdeath by drowningprivate jetintercomcellistscientific researchfloodingbad luckpublic relationskneelingsaying goodbyesalmonwatching someonecandelabrabeing watchedhead scarfjoke tellingvisionarydead fishgeologistdining halltalking to an animaldessertheadsetdreamerworryingfly fishinghusband wife estrangementcivil servantmissing in actionmandarinphdfish in titlelooking through a windowbureaucrattrombonefishing netreference to queen elizabeth iisheikhwading in waterhubrisirrigationbritish prime ministerbritish governmentshreddersharing a bedburkayemenreference to californiafisheryreference to mars the planet10 downing streetpress secretaryreference to ark of the covenanttrombone playerkoi pondrod and reelgravelfish farmmoment of truthlistening to classical musicreference to geneva switzerlandsport fishingdangling feet in waterreference to a nazisluicespawning (See All) |
On a journey to San Francisco, Richard, his father and cousin Emmeline find themselves on a ship about to explode. Rushed to a lifeboat with Paddy Button, the two children escape while their father (and uncle) are on another lifeboat. In the chaos following, the lifeboats are separated. Paddy, Richa …rd and Emmeline find themselves with no food and no water stuck in the middle of nowhere. After some time, the three come across an uncharted paradise, where Paddy quickly teaches the children fishing, hunting and building. After maybe a month or two, Paddy gets very drunk off a barrel of rum found on the island when they first arrive, and drowns in the middle of the night. Emmeline and Richard, now alone and very scared, move location and rebuild their island home. Many years later, the two young teenagers have developed a very real home, but hormones and feelings between the two strain their friendship, until Richard, who is still very determined to reach San Francisco, is let down by Emmeline when a ship passes by the island and she does not light the signal fire. Throwing her out of the home they had built together, Emmeline attempts to survive on her own but is hurt. After Richard finds her dying, he realizes how he really feels for her and manages to save her. Nature runs its course and their friendship turns into love as the couple learn about the facts of life, when Emmeline has a baby and does not understand why. (Read More)
| Subgenre: | coming of ageteen movieteen romance |
| Themes: | dyingfriendshipmarriagechristmaspregnancydrunkennessnaturesexualityfalling in lovewildernessmother natureback to nature |
| Locations: | shipwaterbeachboatseacampfireship fire |
| Characters: | teenage boyfather daughter relationshipteenagermother daughter relationshipboyteenage girlgirlbabylittle boycousin cousin relationshipyounger version of character |
| Period: | 1900s1890s |
| Story: | adriftoarlifeboatcastawaypacific oceandolphinshipwrecksailorbananadivingsharkcookflash forwardunderwater scenejourney …montagesurvivalislandthree word titlebare chested malebased on novelsexfemale nuditynuditybloodmale nudityfemale frontal nuditymale frontal nuditymasturbationmale rear nuditysex scenephotographsingingerectionfireremakerescuebeddead bodymale pubic haircolor in titlealcoholdecapitationold manweaponbirdfishingspankingskinny dippingpoisonskeletonchildbirthfirst partunderwatersacrificeteenage sexteen angstloss of virginityblockbusterskullteenage protagonistattempted suicidechild protagonistrowboatmentoryoung lovetribegrowing upparrotmudvictorian eranude swimmingsexual awakeningteenage pregnancygiving birthbeheadingmenstruationbreast feedingpubertystrandedhuman sacrificecorporal punishmentsailboatraftblood stainnativeteenage sexualityunplanned pregnancynewborn babyhammockcrabmusic boxoctopusshrineintergenerational friendshipdeath by drowningsex in naturebarrelnude bathingincestuous desirenude photographchristmas carolsailing shiptropical islandloinclothblond boyhutshackturn of the centurypearlhuman skullsuicide pactrumdrummingsunburnclotheslinesearch partyexploring sexualitylagoonmarbledesert islandnative tribeunderwater photographymenarchespyglassstarfishcovered in mudsandcastlecoral reefmorning sicknesssea turtlecoralstranded on an islanddrownedswimlacepearl divingberrieschristmas stockingspear fishingsouth seasnude in naturenude female silhouettepuffer fishhandfishingforagingsignal fireship's cookabandoning shipfoot cutgutting fishmistaken for godnative ritual (See All) |
Lil ('Naomi Watts' (qv)) and Roz ('Robin Wright (V)' (qv)) are two lifelong friends, having grown up together as neighbors in an idyllic beach town. As adults, their sons have developed a friendship as strong as that which binds their mothers. One summer, all four are confronted by simmering emotion …s that have been mounting between them, and each find unexpected happiness in relationships that cross the bounds of convention. (Read More)
| Themes: | lonelinessfriendshipdeathrevengemarriageinfidelityjealousyadulterypregnancydrinkingfeardrunkennessweddingvoyeurismmemory …extramarital affairdivorcedeath of fatherguiltunfaithfulnesstheatre (See All) |
| Locations: | beachhospitalbarhotelcemeterybuskitchenaustraliafranceofficeoceantownsuvrunning on a beach |
| Characters: | reference to goddancerteenage boyhusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsfriendboyfriend girlfriend relationshipsingerboyteenage girlactorbabyactress …best friendaustralianex husband ex wife relationshipolder woman younger man relationshipgrandmother granddaughter relationshipyounger version of charactertheatre director (See All) |
| Period: | summer |
| Story: | swimming underwateroverhead shotreading a bookdolphinbroken legswimsuitflash forwardunderwater sceneapologyeatingswimmingreference to jesus christvomitingdancingbare chested male …flashbacksexfemale nudityf ratednuditymale nuditymale rear nuditykissfemale rear nudityfightcigarette smokingphotographsingingleg spreadingpantiestelephone callcryingcell phonesongwoman on toptitle directed by femaledreamfoodmirrorblondeface slapcomputerdrinkbikinisex in bedbare buttsecretbookliebeertearssunglassesrunningbirthdaysex standing upneighborvoyeurtelephonef wordcleavagewinewidowchildscantily clad femalebirthday partygraveyardbartenderjeansgraveblack pantieschampagneauditionflowerscrossdeath of husbandlaptopsadnessreunionsuspiciontearevelationlooking at oneself in a mirrorlistening to musichappinessagingwatching a moviesurfingaudiencecoitusforbidden loveart galleryburialbald manministercard playingseasidecliffcopulationwedding receptionsunbathingphoto albumfemale female kissnew jobbirthday presentsydney australiaremorsereading aloudcrutcheslost lovesurferraft18 year oldtheatre productiongiving a toastmother in lawbeach houselollipopreverendsurfboardsurrogate motherlesbian subtextleg injuryleg woundremarriagebedtime storyhappy birthdayrearview mirrorsaying goodbyeplay rehearsalbreaking upsidewalk cafebased on novellatryst20 year oldunderwater fightsurrogate sonwoman directorleg in a casttravel agentcurtain callwetsuitphysical rehabilitationbank checkloversreference to george gershwin21st birthdaymusical productionreflection in a rearview mirrorantisepticreading a book to a childsurfing accidentwater wings (See All) |
Buffalo newsman Evan Baxter is elected to Congress with the slogan, "Change the world." He lucks into a huge house in a new Virginia suburb. His Capitol office is also fantastic, but there's a catch: he's tapped by the powerful Congressman Long to co-sponsor a bill to allow development in national p …arks. In steps God, who appears to a disbelieving Evan and gently commands him to build an ark. Tools and wood arrive in Evan's yard, animal pairs follow, his beard and hair grow wildly, nomad's clothes and a staff appear. Long grows impatient, Evan starts building, his family leaves him, reporters gather, and drought grips D.C. Still, Evan believes. But will he change the world? (Read More)
| Themes: | faithreligionpoliticsdancecorruption |
| Mood: | rain |
| Locations: | restaurantboatmilitary truck |
| Characters: | reference to godbrother brother relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipssoldierpolice officerpolicemanbiblesecretary |
| Story: | arkhyenazebraprayingspittingtigermiracleelephantmonkeybearunderwater sceneanimalsnakeprayerdancing …character name in titlenuditymale nuditysequeldogtwo word titlecatsecond partreporterbridgefishdinnernews reportparkpublic nuditytreescreamingsuburbfired from the jobscene during end creditsamerican flagdisappearancegiftautomobilethreatelectionwashington d.c.waiterwolfloyaltyfaintinglawbeardspiderfraudpress conferencepicnicpromisefloodconstruction siteprophecyaquariumlionwisecrack humorinsultmarital problemalarm clockweathercrownews reporterpethairlong hairhikingtelevision newswoodsuitgorillafish tankelection campaignpolitical campaignchangedamrobekindnesswarningvirginiamoving inspitrainbownewscastfamily crisisgiraffedroughtcongressmanwater fountaininternexcrementworkaholiccongressnew housenational parkpenis sizeostrichcamping tripbiblical referencestray dogbiblical quoteridiculelicense platecnn reporterfrat packdepiction of godbaboonnoah's arkwrecking ballbuffalo new yorktoolstoolboxweather reportpledge of allegianceirrigationconstruction craneu.s. capitol buildingcrossing guardanchormanchief of staffbird poopsloganboat buildinglionessgod as humanmuttusa governmentland developmenthummer h2u.s. house of representativesclock radiodam burstyakrepresentativewhite dovealpacareal estate investmenttwo man saw (See All) |
At the age of 38, Mark O'Brien, a man who uses an iron lung, decides he no longer wishes to be a virgin. With the help of his therapist and his priest, he contacts Cheryl Cohen-Greene, a professional sex surrogate and a typical soccer mom with a house, a mortgage and a husband. Inspired by a true st …ory, The Sessions, follows the fascinating relationship which evolves between Cheryl and Mark as she takes him on his journey to manhood. (Read More)
| Themes: | friendshiprevengemoneyjealousydrinkingfearfuneralguiltsexualitypoetrydisabilityfalling in lovenear death experience |
| Locations: | catholic churchbeachhospitalrestaurantchurchhotelbathtubbicycleelevatorwheelchairbaseballmotelsan francisco californiarunning on a beach |
| Characters: | catholic priestcatholicreference to godteenage boyhusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshiptattoosingerboy …prostitutegirlwriterpriestbest friendjewself pitysex therapistself deprecation (See All) |
| Period: | year 1988 |
| Story: | reading a bookkarmaprayingfantasy sequenceflash forwardpainunderwater scenejourneyapologyeatingsubjective camerareference to jesus christprayerurinationvoice over narration …bare chested maleflashbackfemale nuditymasturbationtwo word titlesex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingejaculationnipplessingingpartyleg spreadingerectionpantiestelephone callsongwoman on topfoodblondecatwritten by directordrinkundressingsex in bedbookbeertearssunglassesrunningcafemarijuanacollegevoyeurtelephonef wordcleavagenewspaperbraambulancewomanfemale pubic hairwhite pantiesman with glassesscantily clad femalecoffinmarriage proposalcoffeeconfessioncursevirginspiritualityfired from the jobreadingcollege studentfemale removes her clothessadnesspoetsleepingtypewritereyeglassespoemhugginganswering machinepot smokingloss of virginitytape recorderbuttockstherapisthome movieforbidden lovepicnicchokingpromisejob interviewpower outagesex talkanxietydespairpanties pulled downtan linemale virginwoman in bathtubsermonsexual awakeningnarrated by characterjudaismparalysistelevision newsfemale genitalianaivetymasochismnewspaper articleecstasyshirtgurneyloss of sisterstation wagonsexual repressionundressing someonegolden gate bridgeintimacyreference to the virgin maryshared bathwoman undressingfirst sexual experiencephilosopherpremature ejaculationsexual pleasureman in a wheelchairjealous husbandsynagogueimplied nudityweepingsexual explorationsexual arousal911power failuretrolleyvoice over inner thoughtsdoorbellsaying goodbyeoxygenreference to the bibleactress breaking typecaststrong sexual contentcolognelogicpoliosex therapyearmale with long hairwoman wearing glassesberkeley californiajewish manbed riddenoutdoor cafescratching6 year oldcollege graduationsense of touchspeaker phonevoice over writingmotorized wheelchairthrift storeweeping womangirl wearing pantiesshaving someonesponge bathfutonrespiratordifficulty breathingsex surrogatehandicap seximplied male nuditylove poempity sexreading a poemwriting a poemiron lunguniversity of california berkeleyitch38 year oldreference to boston massachusettsjewish convertpower blackoutmotel desk clerk49 year oldkissing someone's chestorange tabby catoxygen tentpolio victimmikvah (See All) |
Abandoned after an accident, baby Mowgli is taken and raised by a family of wolves. As the boy grows older, the wise panther Bagheera realizes he must be returned to his own kind in the nearby man-village. Baloo the bear however thinks differently taking the young Mowgli under his wing and teaching …that living in the jungle is the best life there is. Bagheera realizes that Mowgli is in danger, particularly from Shere Khan the tiger who hates all people. When Baloo finally comes around, Mowgli runs off into the jungle where he survives a second encounter with Kaa the snake and finally, with Shere Khan. It's the sight of a pretty girl however that gets Mowgli to go the nearby man-village. (Read More)
| Subgenre: | 2d animationdisneybuddy comedyhand drawn animationtraditional animation |
| Themes: | friendshipsurrealismkidnappingabductionadoption |
| Mood: | rainnight |
| Locations: | indiajunglevillagejungle book |
| Characters: | human animal relationshipfriendsingerboygirlbaby boy |
| Period: | 19th century1890s |
| Story: | orangutantigerbananaelephantmonkeybearanimalsnakeorphanvoice over narrationthree word titledancingbased on noveldogfight …title spoken by charactersingingfirerescueriverstrangulationdisguisenarrationkingtreeactor playing multiple rolesfirst partwildlifecross dressingwolftalking animallifting someone into the airblockbusterfaked deathcolonelanthropomorphismbarefootticklingchild protagonistanthropomorphic animalhypnosisthunderstormblack eyemusical numberdeerhappy endingrunning awayjazz musicfruitbare chested boyanthypnotismmale protagonistcactusfriends who live togetherfamous scoretitle same as book10 year oldanimal that acts humanvultureyoung boyabandoned babysong and dancepantherwild animalcastle thundersurrogate familyorphan boycartoon bearwolf packtalking birdferal childlead singerblack pantherwild childcroonersinging animalancient ruinshuman animal friendshipbackup singerstorybook in opening shotcartoon wolfinterspecies friendshiptalking bearroaringcartoon elephanthappy go luckywolf cubanimal licking someonecartoon monkeyspiraling eyescartoon tiger10 year old boyhuman bear relationshiptalking snaketalking wolf (See All) |
Following his parents' death in Africa, John Clayton has been be raised by an ape, was known by the name Tarzan, but eventually left Africa and for his parents' home in England, along with the woman he fell in love with and married, Jane Porter. He is asked by Belgian King Leopold to go to Africa to … see what he has done there to help the country. Initially, he refuses. But an American, George Washington Williams, wants him to accept so he can accompany him. He says that Leopold might be committing all sorts of atrocities to achieve his goal, like slavery. Clayton agrees and his wife insists that she accompany him because she misses Africa. When they arrive, a man named Rom, who works for Leopold, attacks their village and captures Tarzan and Jane. With Washington's help he escapes and sets out to rescue Jane by going across the jungle. Washington joins him despite being told that he might not make it. (Read More)
| Subgenre: | martial artsblack comedyswashbucklerrevenge plot |
| Themes: | couragefriendshipmurderdeathrevengekidnappingbetrayalpoliticsescapedeceptioncorruptiondeath of fatherbrutalitydeath of motherredemption …exploitationgreeddeath of wifewealthself sacrificehuntingnear death experience (See All) |
| Locations: | jungleshiptrainboatlondon englandvillageafricacavecampfire |
| Characters: | husband wife relationshipfather son relationshipafrican americansoldierbabyhostagetough guywarrioraction heromaidsniperamerican abroadengineeramerican in the uk |
| Period: | 19th century1880s |
| Story: | animal attackswimming underwaterhippopotamusleopardloss of family3 dimensionalelephantsubtitled scenemonkeyloss of motherloss of fatherlightningflash forwardunderwater scenemap …montageorphansubjective camerasurvivalvoice over narrationknifecharacter name in titlebare chested malebased on novelflashbackviolenceone word titlekissfightphotographtitle spoken by characterexplosionchasesurprise endingfireshootoutbeatingcorpseshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightlettershowdownrifleheld at gunpointbeerhand to hand combatinterrogationhandcuffsrevolverrivercombatshot in the backgood versus evilambushstrangulationmassacremountainwomanarmymixed martial artsnonlinear timelineno opening creditsanti herodisarming someoneone man armyassassinationchild in perildouble crosskingracial slurattempted murderone against manytreebinocularsbeaten to deathdangerprologueumbrellacharacter's point of view camera shotrace against timetentevil mankicked in the facetough girlopening action scenebraceletdiarymanipulationscardeath of sonsuspiciontied upthreatened with a knifemercenarywaterfallflowernewspaper headlinebattlefieldstylized violencecouplecaptainsabotagefireplacegrenadebow and arrowkilling an animalrevelationhead buttspearheavy rainquestslaveryhunterloss of loved onekicked in the stomachblockbusterdesperationservantjumping from heightskulltorchinterracial friendshipsocial commentaryslaveeaten alivepresumed deadfemale warriordamsel in distressadventurershielddiamondfloodbraverydual wieldloss of sonmercilessnessgash in the facerowboatescape attemptpunched in the chestlionaerial shotfograinstormcapturetribepierpassionate kissdeath of loved onegatling gunhogtiedclose up of eyesprime ministerenglishman abroadmale objectificationyellinghistorical fictionexpeditionfinal showdownspit in the facecrocodilegun held to headcomic reliefshot with an arrowgorillayoung version of characteradventure herocheering crowdfilm starts with textstretcherrailroadreluctant heroadopted sonantcolonialismbankruptcyhumorfight the systemfinal battleheirwet t shirtaperighteous ragetreehousedeath of familyportdiplomatanimal killingbilingualismhide and seekextreme close upgas explosionrainforestknife held to throatrepeating rifleasphyxiationexploding boatrosarymultiple time framesslow motion action scenehorse drawn carriagebegins with textcongowoman punches a manlordrescue attemptcoming out of retirementostrichmanor housevinecollapsing buildingcaught in the raincaged humancaught in a netstampedeslave laborjungle warfareamerican womanbelgiankissing in publiccheetahlocked in a cageanimal bitesteamboattarzantelescopic riflecivil war veterangeopoliticssavannahreboot of seriessteamshipmineralriver boatshackleddislocated shoulderwildebeesttribal chiefbegins with historical notesrolling down a hillstitching a woundledgerjumping from a boatpebbletrampledear shot offenvoyjumping off cliffskiffpaddlewheel boatprecipicetribal leaderwhite paintfording a river (See All) |
Born Christmas Day 1960, Zac Beaulieu is the fourth of five sons of Gervais and Laurianne Beaulieu. Zac feels somewhat disconnected to his brothers, all of whom are different from each other. They include the bookworm Christian who is the eldest, the dumb jock Antoine who is third, and the youngest …Yvan. But Zac has the most contempt for his second eldest brother, the shiftless druggie Raymond. To his devout Catholic mother, Zac is her miracle son, both for being born the same day as Jesus Christ (a fact which Zac has always hated), and because a Tupperware-selling mystic once told her that he has the power to heal. Laurianne has always coddled Zac, the two who have a special if unspoken bond. But Zac wants more to please his father, who wants more than anything in his sons that they grow up to be man's men and not sissies. As Zac goes through his mid-teens to early twenties, Zac isn't sure if he can live up to the ideals of either his mother or especially his father. A young man with stress-induced asthma, Zac just wants to be what he considers normal, which includes getting rid of his asthma. But more importantly, he wants to get rid of the underlying thoughts that he has and which most going through puberty have, but that for him are becoming more prevalent as he grows older. (Read More)
| Subgenre: | independent filmcoming of agepunk |
| Themes: | deathmarriagechristmaspregnancyweddingfuneraltravelobsessiondrug usedysfunctional familyredemptionhomophobiachildhooddrug addictioncatholic guilt |
| Mood: | rainnightmare |
| Locations: | catholic churchwaterschoolbeachhospitalchurchsnowmotorcycleairplanebathtubnightclubdesertbicyclecanadaisrael …gay barmotorcycle accidentbicycle accident (See All) |
| Characters: | uncle nephew relationshipcatholicdancerteenage boybrother brother relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipshomosexualteenagerboyfriend girlfriend relationshipdoctortattoo …singerboyteenage girlprostitutegirlbabypriestlittle boypsychiatristcousin cousin relationshipcanadiangay teenagergrandmother grandson relationshippregnant wifefrench canadianself loathinghomosexual teenager (See All) |
| Period: | 1970s1980s1960schristmas party |
| Story: | montreal quebecprayingcamelloss of brothermiracleswimsuitfantasy sequencelightningstorytellingunderwater sceneapologyeatingreference to jesus christprayervomiting …voice over narrationdancingflashbacksexmasturbationkissfightcigarette smokingphotographsingingpartytelephone callpunctuation in titlecryingsongbeatingunderwearfoodmirrorface slapslow motion scenepunched in the faceundressingbooklietearssunglassesmarijuananeighborgay slurambulancedrug dealersuicide attemptdrivingcoffinacronym in titlenarrationhit by a carvoice overgraveyardconfessionparksmokingdrug addictmicrophoneliarumbrellatentreadingchristmas treedeath of brotherinjectioncrosschildbirthdeath of sonobscene finger gesturerecord playertwenty somethingbirthday cakeitaliancloseted homosexualpot smokingsyringediscohypodermic needlehelmetrecordingice creamcaught having sexexercisecrucifixdrug abuseflatulencebirthpeeping tomdrug overdosewatching televisionface paintreconciliationsandloss of sonsex talkmakeupsibling rivalryarabblack eyechoirsnowingtuxedoinsultbrushing teethalarm clockwedding receptionmiscarriagefast motion scenedormitorygiving birthearphoneslevitationhiding in a closetbirthday presentqueer cinemapostcardquebecsummer campoverdosetombstonejerusalemno title at beginningbus stopasthmapeer pressuredenialpush upscatholicismstonedlistening to radiobunk bedbleedinggay brotherwakeentire title is capitalized acronymroller skatescar radioneck bracemassfetusmopedfootprintthirstmusical instrumentrecord storebirthmarkbanjodyed hairpainted facesexual orientationwatching sexlord's prayerbubble gumbaby carriagefrench frieschristmas dayfantasizinglaundry drying on clothes lineransackingketchupconfederate flagreference to david bowienunchakubed wettinglunchboxreference to bruce leegiving the fingersmooth chestline dancingpramwashing a carinhalerboys' choirfoetusdeath by overdosedrum setelectric trainholding one's breath underwaternunchuckholy landchryslerangry fatherneck injurypretending to be straightsmoke ringhomosexual sonplaying dress upnose pickingred haired girlreference to patsy clineblowing smoke ringdrug stashdropping a babyelectric irontupperwareatomizer (See All) |
A rat named Remy dreams of becoming a great French chef despite his family's wishes and the obvious problem of being a rat in a decidedly rodent-phobic profession. When fate places Remy in the sewers of Paris, he finds himself ideally situated beneath a restaurant made famous by his culinary hero, A …uguste Gusteau. Despite the apparent dangers of being an unlikely - and certainly unwanted - visitor in the kitchen of a fine French restaurant, Remy's passion for cooking soon sets into motion a hilarious and exciting rat race that turns the culinary world of Paris upside down. (Read More)
| Subgenre: | computer animationslapstick comedyfish out of watercgi animation |
| Themes: | starvationfriendshipdeathloveghostjealousydrinkingdrunkennesstheftobsessiondeath of motherabductioninheritance |
| Mood: | rain |
| Locations: | paris francerestaurantmotorcycleboatbicyclekitchenfrancerooftoptunnelsewerfrench restaurant |
| Characters: | uncle nephew relationshipbrother brother relationshipfather son relationshippolicefriendbrother sister relationshippolicemanlawyerthieffrench |
| Story: | animal attackfalling into waterhungerstreet lifetold in flashbackcookratlightningstorytellingunderwater sceneanimaleatingvoice over narrationknifeflashback …violenceone word titleinterviewdogkisstitle spoken by characterchasetelephone callfirefoodface slapshotgunrescuewatching tvdrinkbookriflerunningcaferiverreporternewspapercookingwinewomanpainterroommateold womanconfessionpoisonblindfoldsleepingwaitereggtalking animalblockbustercheffood in titlegas maskanthropomorphismanthropomorphic animalevacuationrainstormchildhood memorynew jobhairapparitionsuccesseiffel tower parislast will and testamentbreadimaginary friendsoupchandelierdnamushroomsense of smellbreaking a windowcheesegarbagetomatoheirpuppetryorchestral music scorepun in titleroller skatesin medias resmarketingmotor scooterovenrecipebitingtv show in filmstruck by lightningmotorcycle helmetshellmousetrapomenseine riversinkpesticideseparation from familyrat poisonbargedead ratgourmetla marseillaiseanthropomorphic mousecookbookfancy restaurantfood criticgastronomyomeletpantryspicehealth inspectorstarving artistsense of tastestepladdercleanlinesshaute cuisinesous cheffrench cuisinerotisseriechef's hatfood pornculinary schoolsnack foodculinary artistrat invasiongrowling stomachpots and panspulling someone's hairratatouille (See All) |
Corporate billionaire Edward Cole and working class mechanic Carter Chambers have nothing in common except for their terminal illnesses. While sharing a hospital room together, they decide to leave it and do all the things they have ever wanted to do before they die according to their bucket list. I …n the process, both of them heal each other, become unlikely friends, and ultimately find joy in life. (Read More)
| Subgenre: | black comedy |
| Themes: | dyingfaithfriendshipdeathlovesuicidemarriagemoneydrinkingfuneralobsessioncancerillnessphilosophy |
| Locations: | hospitalrestaurantairplanelos angeles californiabathtubtaxiroad tripcourtroomafricaroad movie |
| Characters: | reference to godhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsfather daughter relationshipfrienddoctortattoosingerprostitutenurseex husband ex wife relationshipgrandfather grandson relationshipgrandfather granddaughter relationship |
| Story: | zebrabucketstreet marketbelief in godtold in flashbackelephantclassbusinessmanjourneyanimalprayervomitingvoice over narrationthree word titlegun …cigarette smokingphotographsingingtelephone callcryingcell phonesongcorpsemirrorwatching tvlettertearsdead bodycafeorgyold manmountainno opening creditsroommateold womancoffeelimousinehotel roomprologuechampagnetentflowerscourtterminal illnesssurgeryhypodermic needlehong kongmale bondinginterracial friendshipmechanicbuddymobile phoneegyptmillionairecard playinglaughterlionparachutevoice over letterfamily dinnermarital problemviolinistearphonescremationhomecomingrace carbillionaireno title at beginningbubble bathpyramidbleedingbeliefauto mechanicashesgurneytibetfirst person narrationcar racingcoughing bloodprivate jetreturning homeceomountain climbingmortalityracetrackbrain tumorchemotherapyskydivingsurgical operationfather daughter reuniontriviabuddy moviewish fulfillmentcairo egyptbrain surgeryreference to oprah winfreyeulogynarration from the gravereference to walt disneytanzaniahospital visitsafarihimalayasbumper cartaj mahallistshaving headmount everesttoilet bowlgreat wall of chinamile high clubbusiness meetingcaviarmedical treatmentjohannesburg south africamountain climbercollege dropoutelderly protagonistsavannahto do listblack white relationsreference to nikola teslafrench rivieraelectric razortin canabused wifecote d'azurwealthy manoncologistreference to chuck berryreference to michelle pfeiffercathetergin rummygreat pyramidreference to herbert hooverlife expectancythings to do before you dietv quiz showreference to spiro agnewveldtaperitiflegal hearingmalignant tumorreference to marconi (See All) |
The story follows an underground weapons manufacturer in Belgrade during WWII and evolves into fairly surreal situations. A black marketeer who smuggles the weapons to partisans doesn't mention to the workers that the war is over, and they keep producing. Years later, they break out of their undergr …ound "shelter" --- only to convince themselves that the war is still going on. (Read More)
| Subgenre: | black comedyepicpolitical satire |
| Themes: | friendshipmurderdeathloverevengesurrealismmarriagepoliticspregnancydrinkingtorturedrunkennessweddingfilmmakingmemory …theftdeath of mothertheatreexploitationhopedeath of wifecommunismfreedomrevolutiondeath in childbirth (See All) |
| Mood: | rainsatirebreaking the fourth wall |
| Locations: | shiphelicopterbathtubbicyclewheelchairsewer |
| Characters: | uncle nephew relationshipdancerbrother brother relationshiphusband wife relationshipfather son relationshipfamily relationshipsfriendbrother sister relationshipprostitutesoldierphotographerbabythiefactress …film directorgermangrandfather grandson relationshipgirlfriend (See All) |
| Period: | world war two1990s1960s1940syear 1941 |
| Story: | floating islandtigerzooelephantmonkeymagical realismunderwater sceneanimalswimmingislandvomitingurinationdancingbased on novelsex …female nudityone word titlemasturbationgunkissfemale rear nudityfightexplosionpartybased on playfireunderwearhorsemirrorcatdrinkshootinglieriflebirthdaybandstrangulationweaponfishbirdradiocoffintalking to the cameraliartankhangingchildbirthbasementflowerrefugeeeuropehatecoupleberlin germanycivil wareyeglassestraitorgoldhead buttcrucifixstealingcommunistclockbombingresistancenewsreel footagetheatre audiencefascismdeerhorse and carriagecellarparrotposterjoypost world war twodead animalfascistyugoslaviamarching bandchimpanzeepartisanresistance fighterwanted postersheltergestaporewardponyhooliganreference to noahbalkanelectricianmelonanti fascismarms dealcommunist partyhappy new yearanti fascistflying machineelectro shockturntablefreight elevatortied togetherbridal gownzagreb croatiaelectrical generatorbelgrade serbiathrown down a wellljubljana sloveniareference to marshal tito (See All) |
Based on a true story. After graduating from Emory University, Christopher McCandless abandoned his possessions, gave his entire savings account to charity, and hitchhiked to Alaska to live in the wilderness. Along the way, Christopher encounters a series of characters who shape his life.
| Subgenre: | independent filmcoming of age |
| Themes: | starvationdyingdeathmarriageinfidelitymoneyadulterydrinkingdrunkennessmemorynaturedrug useguiltgriefunfaithfulness …illnesspoetryadoptiondeath of wifefreedomaffairforgivenesshuntingwildernessback to nature (See All) |
| Mood: | rainnightmarecar chasearchive footagebreaking the fourth wall |
| Locations: | mexicobeachbarrestauranttrainchurchforestcarsnowsmall townlos angeles californiaboatbusdesertwoods …rural settingfarmroad tripsealaketruckcavecampfirestormtunnelslumalaskacanyoncable car (See All) |
| Characters: | dancerteenage boyhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipsingerbrother sister relationshipteenage girlpoliceman …waitresslittle boyamericangrandfather grandson relationshipself discoverypolice arrestolder man younger man relationshipgirl in underwearalcoholic drink (See All) |
| Period: | 1990swinteryear 1991year 1990year 1992 |
| Story: | motivationalteasingwhalethunderdivingsubtitled scenebearsplit screenlightningpainjourneysnakemapflashlightswimming …prayerurinationvoice over narrationthree word titleknifedancingbare chested maleflashbacksexfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditydogfightcigarette smokingnipplesphotographtitle spoken by charactersingingchasepantiesshowerbased on true storytelephone callfiretopless female nuditycryingbased on bookbeatingdreamunderwearhorseblondeface slapslow motion scenewatching tvdrinkarrestundressingbare buttbookrifletearsrunningcafepianomale pubic hairguitarriverf wordcookingold mancaliforniatoplessmountainbridgedinerfishnonlinear timelinebirdfishingsearchvanbartendergunshotskinny dippingargumentmicrophoneprologuefbiwidowerpay phonepoisonmissionon the roadtentreadingchristmas treefarmeruniversitydiarydomestic violencedisappearancedeath of sonisolationstageunderwaterwaterfallflowerfireworksfreeze framegirl in pantiestwenty somethingeyeglassespoemapplauseshavinggamewolfnipples visible through clothingballoonmachetelistening to musicexercisebeardspiderlosstimeaudiencehome moviecheating husbandsouth africanaked womanhitchhikerhitchhikingapplemexicanbarefootbackpackhippiecharitynippleco workerdeath of protagonistlaughterarizonadeerhighwayborderbarbecuenotetrailerlens flaregrowing uppuppydivorceebonfirebrushing teethsirenowlprivate investigatorfast motion sceneplantnasaplaying cardsrocketsatellitepiano playernude swimminggraduationstage performancedrifterfarmingcanoejournalfilm clipjukeboxbeeborder crossingfast foodcattlelaundromatsolitudesicknesscredit cardcrystallistening to radiodamtaking off shirtmarching bandbumpalm treetopless girlguitar playereaglevirginiageorgiaatlanta georgiaapartheidcrabwindmillwet t shirtbeltacoustic guitarspeedboatentertainerplannatural breastsoverhead camera shotchapter headingsdumpsterin medias resbreasthypocriteteenage girl in underwearhobohorse and wagonbagpipesschizophrenicscandinavian girlflashback within a flashbackshopping cartrock climbingreference to george w. bushfamily historynudistmortalityborder patrolidentity crisismaterialismcanalguard dogcheckharvestleaving homecamperfaunafloraillegitimate sonsleeping bagpaddlegrand canyonmetropolisremotewisdomfalse namemoosewashington stateemaciationnudismoil lamptrampwater skiingduplicityfood poisoninghowlingfreight trainprairieburning moneyanti conformitysit upskayakspeakerbackpackinggrizzly bearintrospectionriver rapidsillegitimate daughtermultiple narratorshot springlicense plateencampmentpatroliciclenew beginningsouth dakotawashing a carriver crossingfollowing a dreamgrainchapterschequelosing weightcarvingcollege graduateaerialchest hairkayakingnaked outdoorscollege graduationpull upsravinestocking capborder checkpointirrigationnorthern californiawheatfishing polenorth americascoped riflebigamistbadlandsjumping onto a traintractor trailerreference to lord byronsoft focustrue life adventuresearch for truthtime clockman against natureman vs naturepick up truckreference to joni mitchelltrain depotflash floodrootsalton seapartinghoover damgeorgia usanew year's resolutionstarving to deathabandoned buscolorado rivergraduate schoolreference to jack londonlife savingswriting in sandriding the railschapterwise storytellingfairbanks alaskahandicraftsneo luddismpermitreference to thoreaucharacter lies about agegraduation presentgullindividuationlake meadreference to tolstoyshiversjet stream (See All) |
The 17-year-old Sean Anderson receives a coded signal and his stepfather Hank helps him to decipher the message. They find that Sean's grandfather Alexander Anderson has found the mysterious island in the Pacific described by Jules Verne and two other writers in their novels. The stubborn Sean wants … to travel to the coordinates and Hank decides to buy the tickets and travel with the teenager to a small island nearby the location. They rent an old helicopter owned by the locals Gabato and his teenage daughter Kailani and the group heads to the unknown spot. Along their journey, they cross a hurricane and crash on the island. They find a beautiful and dangerous place, surrounded by forests, volcanoes with lava of gold and menacing life forms. They also meet the old Alexander and Hank discovers that the island is sinking. Now their only chance to survive is to find the legendary Nautilus. (Read More)
| Subgenre: | slapstick comedy |
| Themes: | surrealismmonsternear death experience |
| Locations: | swimming poolstorm at seajunglebeachhelicoptermotorcycleseacaveoceancampfiresubmarinecar motorcycle chasecave inhelicopter accident |
| Characters: | teenage boyhusband wife relationshipmother son relationshipfather daughter relationshipteenagerteenage girlgrandfather grandson relationshippolice chasestepfather stepson relationship |
| Story: | animal attackflarelizard3 dimensionalsharkelephantlightningunderwater scenejourneymapislandvoice over narrationbased on novelnumber in titlesequel …kissexplosionchasesurprise endingcell phonedigit in titleremakerescueslow motion scenefalling from heightletterbooksunglassessecond partbirthdaynumbered sequelmountainbrunetteno opening creditspart of seriescreatureelectrocutionrace against timestatueopening action sceneskeletonscene during end creditswaterfalllove interestmoonstrong female charactergoldheavy raineggeccentricgiantskullearthquakemexicanseriesflood3dbutterflybooby trapvolcanowisecrack humorlocation in titlebirthday presentsecond in seriesbeecomic reliefhurricanetour guidewet t shirtpart of a seriestreehousecamera phonegiant animalcompassteenage herotorpedostarts with narrationgiant spiderhelicopter pilotjellyfishsurprise during end creditsnumber 2 in titleatlantisvolcanic eruptiongiant creaturelong black hairham radioreefbroken anklesea creaturecode breakinggiant wavelost cityamateur radiounderwater explosiongiant birdglow sticklost worldukelelewet pantsgiant lizardreference to yodaex navyjules vernecaptain nemoelectric eelgiant antmusic score features choirmysterious island (See All) |
Hunger follows life in the Maze Prison, Northern Ireland with an interpretation of the highly emotive events surrounding the 1981 IRA Hunger Strike, led by Bobby Sands. With an epic eye for detail, the film provides a timely exploration of what happens when body and mind are pushed to the uttermost …limit. (Read More)
| Themes: | starvationdyingreligionmurderdeathsuicidepoliticsprisontorturememorybrutalityterrorismhumiliationillnesssadism …executioncrueltyfreedompolice brutality (See All) |
| Locations: | watersnowbathtubbusprison hospital |
| Characters: | catholic priestcatholicbrother brother relationshipmother son relationshipfather son relationshipfamily relationshipsdoctorboybabypriestbibleprison officer |
| Period: | 1980syear 1981 |
| Story: | crossing oneselffly the insectspittinghungerratstorytellingpaineatingmontagereference to jesus christvomitingbare chested maleflashbacknudityblood …male nudityviolenceone word titlemale frontal nuditymasturbationmale rear nuditygunkisscigarette smokingphotographtitle spoken by charactercryingbeatingunderweartesticlesfoodmirrorshot in the headpunched in the faceundressingbare buttmaskshootingtearsrunningbathroomjailhallucinationmale pubic hairriverf wordterroristprisonerdrivingbirdcontroversyold womanlatex glovesgunshotprologueprotestlocker roomuniformsuitcaseflowerslong taketragic eventcrossirelanddirectorial debutriotwhat happened to epiloguehead butthypodermic needlevandalismcrucifixdemonstrationbeardswat teamcovered in bloodirishbreakfasthaircutbarefootshieldprison guardbloody nosesufferingboxer shortssmugglingscissorscigarette lighterblack eyeprison cellsnowinglooking at self in mirrorbriefschildhood memorymain character diesoppressionyellingbodyspit in the facehead woundlockervery little dialogueshoutinglistening to a radiourinehead injuryurinalnursing homeprison visitgurneypolitical prisonercontrabandclothingmartyrradio newssurrenderfreedom fightermassdeathbednegotiationnorthern irelanddressingdeterminationstarvingrunnerblanketchantingends with textexcrementpassing outpolitical protestbegins with textburnhand injuryirish republican armyemaciationcell mateconvulsionreference to the bibleirahospital visithunger strikesinkeye injuryworryingpolice vanhand woundpolitical criminalends with deathhandspeepholemale with long hairbody mutilationfilthrolling a cigarettefacial injuryurine samplebedsheetbritish government28 year oldbody searchcavity searchbritish parliamentdisinfectanthuman excrement27 year oldmaggotstinfoilmargaret thatchernorthern irishmandistorted soundrectal examstarving to deaththe troublescross country runningback scarbelfast irelandfood traypolice batonriot gearriot squadsweeping a floortrashing a roombody sore (See All) |
Everything is connected: an 1849 diary of an ocean voyage across the Pacific; letters from a composer to his lover; a thriller about a conspiracy at a nuclear power plant; a farce about a publisher in a nursing home; a rebellious clone in futuristic Korea; and the tale of a tribe living on post-apoc …alyptic Hawaii far in the future. (Read More)
| Subgenre: | independent filmpost apocalypsedystopiaepic |
| Themes: | couragedyingfriendshipmurderdeathloverevengesuicidemoneydrinkingescapememorydrug usecancerguilt …executiondeath of wifecannibalismdevil (See All) |
| Locations: | swimming poolstorm at seashipbeachbarrestaurantforestsnowairplanebathtubbicycletaxielevatorvillagewoods …outer spacecampfirestormsan francisco californiabar brawlairplane explosion (See All) |
| Characters: | uncle nephew relationshipreference to godbrother brother relationshiphusband wife relationshipfather son relationshipfamily relationshipshomosexualfather daughter relationshipfrienddoctorchildrensingerboybrother sister relationship …prostitutegirlnursepolicemanwriterlawyergay kisshitmanwaitresslustjewgay relationshipuncle niece relationshipgrandfather granddaughter relationshipolder man younger man relationship (See All) |
| Period: | futureyear 2012year 1973year 1975 |
| Story: | overhead shotreading a bookkarmahungerstreet lifegoatlightningflash forwardunderwater sceneapologyeatingflashlightsurvivalsubjective cameraprayer …bare chested malebased on novelflashbackfemale nudityf ratedbloodmale nudityinterviewdogtwo word titlegunsex scenekissfightcigarette smokingphotographtitle spoken by characterexplosionsingingchasepistoltelephone callcryingcell phonesongshootoutwoman on topdreamcorpseblood splatterfoodhorseface slappunched in the facecomputercatdrinkarrestbare buttsecretfalling from heightlettershootingbookrifletearsrunningcar crashdead bodyinterrogationcafepianohandcuffstelephoneshot in the backf wordreporternewspaperjournalistcandleold manstabbingthroat slittingbridgenonlinear timelineno opening creditsfictional warspaceshipanthologyshot in the leggunshotauthorprologueprotestpay phoneumbrellaactor playing multiple rolesdebtskeletonringpianistpursuitreuniongeneralgrandmotherwhippingtypewriterpubtrustchild murderrecord playereyeglassestape recorderlawrecordingslaveryagingcaught having sexdemonstrationwitchcraftcomposercovered in bloodrebellionvirginitybar fightslavewatching televisionmale prostitutereincarnationcrossbowgrandfatherspanishpower outagetitle appears in writingprophecydespairescape attemptensemble castoilexilemurder of a childvoice over lettertriberaidsnowingmale male kisseye patchclonehorseback ridingcontractrevolutionaryactress playing multiple rolesmultiple storylinegun in mouthkilling a dogspiral staircaselast will and testamentjournalcorporal punishmentshot with an arrownaivetyknocking on a doorloanhead bashed inhand over mouthpoisoningdnan wordnursing homesouth koreatitle same as bookparasitefacial scarslaughterhousedistrusttequilawriting a letter10 year oldpole dancerwoman smokerlocked in a roomfloggingmountain climbingclimbing out a windowplantationtear on cheekradio broadcastsailing shipknife held to throatvolkswagen beetlelast standdeja vusheet musictalking to oneselfbirthmarkthreat to killscotsmangarroterunning for your lifepassenger trainreference to charles dickenshot pantsone eyed manbarefoot womanstowawaycandelabramaorichateauheartbeatfalling out a windowlugershooting starnuclear powerdistant futurepast lifeelderly coupleold people's homenuclear reactoroil companypeepholeyelling for helphuman skeletonseoulfootbridgefree willwar paintfirefightsodomiteair battleescape planshooting a dogyear 1936faked suicidebackhand slapstuck in an elevatorfuturistic cityabolitionisttooth knocked outgoatherdheaddressvoice over writingswinging on a ropemale sitting on a toiletyear 1931aleout of ammunitionreference to jezebelviolareference to berlin germanytelephone hanguptransamerica pyramidwoman hitting a manelevator malfunctionthrowing a cell phonethrown from a buildingchild shot in the backmusical compositionpresent dayreference to germanycult heroreference to herman melvillecrashing through a gatecleaning a swimming poolhands held in the airsix storiesspaceship explosionreference to arthur conan doylesextetasian with coloured hairreference to the korean warrunning over a fire hydrantescaped slavefacial makeupgray tabby catwaistcoatyear 1849chest of gold coinsclimbing a cliffcomputerized voicegrandchildrenmicro minireference to alexander solzhenitsynsubmerged in car (See All) |
| Subgenre: | martial artscoming of ageabsurdismslapstick comedyfish out of watersteampunkswashbucklersword and fantasychrist allegory |
| Themes: | couragefaithfriendshipmurderdeathrevengesurrealismkidnappingbetrayalfearescapeherodeceptionmagichope …near death experience (See All) |
| Locations: | shipforestboatlondon englandwoodsouter spacecavecampfirecable car |
| Characters: | mother son relationshipchildrenboybabyhostagewarriornative americanamerican abroadmermaidship captaincrying boyboy crying |
| Period: | world war two1940s1930s |
| Story: | animal attackflying fishshipwreckanimated sequence3 dimensionalflash forwardunderwater scenejourneymapaxeflashlightorphansubjective cameravoice over narrationknife …character name in titlebased on novelviolenceone word titlegunfighttitle spoken by characterexplosionchasesurprise endingpistolfirefistfightface slaprescueslow motion scenepunched in the facebattleswordbrawlfalling from heightlettershowdownheld at gunpointhand to hand combatbombrivercombatgood versus evilsword fightambushmountainmixed martial artsnunno opening creditschild in perilfictional warcreaturesearchprincesson the runtrainingattempted murdertreecharacter repeating someone else's dialogueprologuekeyattackfugitivecharacter's point of view camera shotstatueevil manknocked outkicked in the facetough girlskeletonmartial artistexploding bodytied upthreatened with a knifebattlefieldstylized violencehenchmanflirtingropepiratedestinycaptainflyingspearslaverycowboy hatjail cellkicked in the stomacheccentricgiantjumping from heightirishorphanagetorchaction heroinesocial commentarybald manslavecannoneaten alivefemale warriorguardvisionexplosivechild's point of viewbraveryfairydual wieldchild protagonistfalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestbooby trapmusical numbertribeminekingdomsword duelcellarflamethrowerprequelclose up of eyesheroismflagminingfemale fightercrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfantasy worldfighter pilotreluctant heroilliteracyaltered version of studio logohumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanegiant animalpirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laboralternate worldblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcewarrior racereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All) |
The story of Seita and Satsuko, two young Japanese siblings, living in the declining days of World War II. When an American firebombing separates the two children from their parents, the two siblings must rely completely on one another while they struggle to fight for their survival.
| Subgenre: | tragedysemi autobiographical |
| Themes: | starvationdyinglonelinessfriendshipdeathsurrealismmoneyghostfearmemoryrobberytheftdeath of fatherdeath of motherillness …homelessnessradiation (See All) |
| Mood: | rainanimenightmare |
| Locations: | shipwaterschoolbeachhospitaltraincemeteryairplaneboatbathtubbicyclejapantruckstormtrain station …fire station (See All) |
| Characters: | japaneseteenage boyfather son relationshipmother son relationshipfamily relationshipsfather daughter relationshipteenagermother daughter relationshipfrienddoctorchildrensingerboybrother sister relationshipgirl …photographerthiefmothercousin cousin relationshipaunt niece relationshipaunt nephew relationshipjapanese soldier (See All) |
| Period: | world war two1940syear 1945 |
| Story: | buckethungertold in flashbackapologyeatingorphansurvivalswimmingurinationvoice over narrationthree word titlebased on novelflashbackbloodphotograph …explosionsingingbased on true storyfirecryingsongbeatingcorpsefoodhorsecatcameraundressinglettertearsbombrunningdead bodyneighborbandsubwaybirdbathgraveyardgravetreeattackumbrelladollreadingdeath of childringfarmercountrysideflowersleepingfireworksrecord playersisterdisastericedestructionmedicineinjuryrecordingstealingfrogtorchburialjanitortokyo japaninnocencebombingshoesfaninsectscissorsdead childdaydreamdeath of sisterswingraidmineduckhorse and carriagepumpkinpost world war twocandyanti warruinscremationbandagebugelementary school14 year oldemperorseagullclimbingflypursestretcherantmailboxkimonoashestomatowatermelonair raidin medias ressurrendergymnasticspotatoburn victimorgandiarrheashelterfleeingphonographtoothbrushstrawberrybroomfloodingricewagontantrumwashingmosquitowashing dishesdeath of parentemaciationcartabandoned minebomb shelterjapanese armyleechstovefireflyimitationcuttingolder actors younger roleshummingmelonplayingmalnutritionmarblesibling relationshipgrapepiggy back ridefirst aidjapanese flagdebriskamikazemale tearswartimerailroad stationfirebombcombcartwheelimperial japannoodlesrationingstrawbutterrashacid raincharcoaltin canradiation poisoningburning a dead bodybeanstalkheart troubleself sufficiencyfallout shelterstrafinghorrors of warsandboxwater canteenwadingmintfirehouseherringplumjapanese navykobe japanhair clipworld warribcageolder brother younger sisteremperor of japanbroken water pipeimitating the firing of a gunmosquito nettingshovelling (See All) |
In the South American jungle supplies of nitroglycerin are needed at a remote oil field. The oil company pays four men to deliver the supplies in two trucks. A tense rivalry develops between the two sets of drivers and on the rough remote roads the slightest jolt can result in death.
| Themes: | starvationdyingfriendshipdeathsuicidemoneydrinkingfearmemorytheftillnessunemployment |
| Mood: | rain |
| Locations: | junglewaterbarrestaurantmotorcyclecemeteryairplanetaxiairportvillagerural settingtruckroad moviecanyontruck accident |
| Characters: | catholicdancerbrother brother relationshiphusband wife relationshipfather son relationshippolicefrienddoctorchildrensingerboypolice officerpolicemanphotographerthief …tough guynative americanwaitressfrenchgermanamericanamerican abroaddrivertruck driversuicide by hangingself destructivenessgerman abroadreligious statue (See All) |
| Period: | 1950s |
| Story: | drumstreet marketspittingdrummerhungerbroken legstreet lifesubjective cameraprayervomitingurinationknifedancingbased on novelfemale nudity …blooddoggunfightcigarette smokingexplosionsingingsurprise endingshowertelephone callfirecryingsongcorpseunderwearface slapcameradrinkletterriflebeertearsrunningdead bodycafeguitarrivernewspapercookingcandlemountainbridgedrivingcigar smokingdangerchampagneon the roadhangingcrosssleepingmachismoitalianshavingjeeptouristguitariststealingspiderdesperationclockpassporthaircutwhiskeytensionexplosivebraveryconstruction sitespanishjob interviewinsectmedical examinationbribeoilcigarette lightercard playingdynamiteexistentialismsirenreckless drivingpipe smokingfirefighterpost world war twodrifterbandageconstruction workercrutchesbeggarbugforeignercoca colaharmonicalatin americatraffic jamlistening to a radiosaloonwhistlingsense of smellcactusfeverauto mechanicsouth americahammockcorrupt officialdemolitionriskindigenous peopletalking while drivingbroken bottleloudspeakervultureleg injuryvenezuelaexpatriaterocking chairbeetlecowardicefuneral processionfired from a jobmosquitocigarette holdervisabrandydying younglemonadebreaking glassexhaustionlife and deathoil industrysuicide missionlegagonybar ownerends with deathcoin tossoil companycraterleprosytestosteronemalariaair baseflourcementpin upreference to al caponeoil wellsplashed with watercar damageeye bandagerolling a cigaretterecklessnessitalian abroadtankeroil fieldcrude oilfrenchman abroadsaved from hangingpetrolchampagne bottleoutdoor showerthermosvibrationcaracas venezuelaheadlightsoil pipelinestuck in mudshiveringexplosive devicemountain roadair stripfalling rockrisk takingstarving to deathnitroglycerinework accidentfinancial troublelast chancenitroglycerinoil leakrun over by a truckburropith helmetcorsairfoot woundtruck radiocalabria italycorsicanoil derrick (See All) |
'Slow West' follows a 16-year-old boy on a journey across 19th Century frontier America in search of the woman he loves, while accompanied by mysterious traveler Silas.
| Subgenre: | suspense |
| Themes: | dyinglonelinessmurderdeathmoneydrinkingdrunkennessescaperobberytheftdeath of fatherunrequited lovemurder of father |
| Mood: | rain |
| Locations: | beachforestwoodscampfirestorm |
| Characters: | uncle nephew relationshipreference to godteenage boyhusband wife relationshipfamily relationshipsfather daughter relationshipafrican americanboyfriend girlfriend relationshipsingerboygirlsoldierbabywriterthief …native americanlittle boyfrenchgerman (See All) |
| Period: | 19th century |
| Story: | falling into wateroverhead shotdrumdrummersubtitled scenestorytellingflash forwardjourneyeatingorphanurinationvoice over narrationknifeflashbackblood …violencedogtwo word titlegunkisscigarette smokingsingingchasepistolfirecryingsongshootoutdreamcorpseshot to deathblood splatterfoodhorsemirrorshot in the chestshot in the headshotguncatdrinkgunfightbare buttshootingrifleheld at gunpointtearsrunningbeddead bodyshot in the backf wordmountainbridgeimpalementchilddream sequencesearchcigar smokingshot in the legcoffeeshot in the foreheadgunshotprologuerabbitshot in the shoulderpursuithorse ridingirelandcabinmercenarydirectorial debutsleepingblack americanmooneyeglassesteabow and arrowbulletegglooking at oneself in a mirrorhatcowboy hathammeraccidental deathirishwhiskeyfloodbootsministerblood on facemercilessnessoutlawaccidental killingbounty hunterfieldbonfirehorseback ridingmysterious manpeasantdrifterhit in the facedead animalwalletamerican indianvery little dialogueshot with an arrow17 year oldnaivetywhispering16 year oldgun violencemushroomreverendscarecrowbleeding to deathold westhold uphiding under a bedreference to shakespeare's romeo and julietoutlaw gangchild abandonmentcardinal direction in titlekiss on the cheekreference to charles darwinwanted posterman hits a womancompassblanketattempted robberystory tellingrewardcaterpillarscottishfloodingtied to a treebanjobloody facescotsmanlordfrontierflaming arrownailshot through a wallladystar gazingabsintheirishmanbegins with narrationteepeeaccidental murderdead rabbithorseshoeashchaperoneempty gunlong underwearbiscuitamerican westfalling to the groundshaving someoneshushingrolling down a hillstealing from a dead bodyblood on floorhit with a gungun sightblack bearwrapped in a blanketfalling to one's kneesonce upon a timewanted dead or alivecalling someone a son of a bitchrolling downhillreference to canadareference to irelandburned villagegreenhornthreat to murdertwo narrators (See All) |
In 1944, upper class boy Julien Quentin and his brother Francois travel to Catholic boarding school in the countryside after vacations. Julien is a leader and good student and when the new student Jean Bonnet arrives in the school, they have friction in their relationship. However, Julien learns to …respect Jean and discovers that he is Jewish and the priests are hiding him from the Nazis. They become best friends and Julien keeps the secret. When the priest Jean discovers that the servant Joseph is stealing supplies from the school to sell in the black market, he fires the youth. Sooner the Gestapo arrives at school to investigate the students and the priests that run and work in the boarding school. (Read More)
| Subgenre: | semi autobiographical |
| Themes: | starvationcouragereligionfriendshipdeathlovechristmasbetrayaljealousydrinkingfearescapetheftbrutalitycommunism …wealth (See All) |
| Mood: | nightmare |
| Locations: | paris franceschoolrestauranttrainchurchsnowmotorcyclebathtubbicycle |
| Characters: | catholicreference to godstudentteacherbrother brother relationshiphusband wife relationshipmother son relationshipfather son relationshipfrienddoctorsingerboybrother sister relationshipnursepriest …thiefchristianjewishbullybiblejewrussiangermanamericangerman soldier (See All) |
| Period: | world war two1940s |
| Story: | reference to allahrespectteasingmathematicscookclassmapflashlightorphanreference to jesus christprayerclassroomurinationbloodmasturbation …fightcigarette smokingphotographsingingchaseerectiontelephone callcryingsongunderwearfoodmirrordrinkarrestundressingsecretletterbooklietearsbombrunningbathroompianobritishcompetitionwinecandlewidowprisonerdinnernunchilddrawingbathsearchconfessionfired from the jobliarreadingrabbitpianisttragic eventpigsleepinghatetraitorwolflistening to musicfaintingmouseexercisestealingcommunisthidingwatching a moviemagazineviolinmonktowelanti semitismbombingresistancehatredironycharitynewsreel footagelostbathingatticboarding schoolcapturevoice over lettersnowingclassmatelanternbrushing teethpajamasviolinistheroismpiano playersermondormitoryaccountantcrucifixiongreekbandagepostcardlockerblackoutbreadmilitiafilm projectorjerusalemblack marketconventrumorschoolboypush upslatintreasure huntmaileasterauschwitzcowardnazismbourgeoisiepersecutionprivate schoolroofair raidinformernazi occupationprophetpotatoheadmastermassdressingblanketmusic teachergestapoboarcowardicetied to a treebarracksprotestantred crossgerman occupationholy communionreference to charlie chaplincurfewromanfreezinglord's prayerwet dreamboy scoutdining hallpiano teacherstovegraceinfirmarylimpingwehrmachtkiss on the foreheadcollaboratorpiano lessonschoolmatefrench resistanceknife woundwashroomplayingbed wettingmalnutritionfastingfrostbiteiciclestampodorhereticfood shortagesabbathdraft dodgerpublic bathhard onjamconfirmationhail maryvichyair raid sheltercombing hairpiano duetmoor the landscapeprovincial settingstiltssugar cubearabian nightschoir practicewild pigthree musketeersalsatianbavariananemiajuvenile bedwettingfrench literaturemauthausenalgebraass kissingboogie woogiepiano accompanistsaracencarmelitehorse meatsalamiblack knightcod liver oilarithmeticreference to richard the lionheartschool vacationwhooping cough (See All) |
United Press International journalist Will Bloom and his French freelance photojournalist wife Josephine Bloom, who is pregnant with their first child, leave their Paris base to return to Will's hometown of Ashton, Alabama on the news that his father, Edward Bloom, stricken with cancer, will soon di …e, he being taken off chemotherapy treatment. Although connected indirectly through Will's mother/Edward's wife, Sandra Bloom, Will has been estranged from his father for three years since his and Josephine's wedding. Will's issue with his father is the fanciful tales Edward has told of his life all his life, not only to Will but the whole world. As a child when Edward was largely absent as a traveling salesman, Will believed those stories, but now realizes that he does not know his father, who, as he continues to tell these stories, he will never get to know unless Edward comes clean with the truth before he dies. On the brink of his own family life beginning, Will does not want to be the kind of father Edward has been to him. One of those stories from Edward's childhood - that he saw his own death in the glass eye of a witch - led to him embracing life since he would not have to fear death knowing when and how it would eventually come. The question is whether Will will be able to reconcile Edward's stories against his real life, either directly from Edward before he dies and/or from other sources, and thus allow Will to come to a new understanding of himself and his life, past, p… (Read More)
| Subgenre: | fairy tale |
| Themes: | dyinglonelinessreligiondeathlovesurrealisminfidelitymoneyadulterypregnancyescapeweddingfuneralmonsterhero …robberyextramarital affairtheftdeath of fatherunfaithfulnessillnessfalling in loveutopia (See All) |
| Mood: | raindarkness |
| Locations: | swimming pooljunglewaterhospitalchurchforestcarmotorcyclecemeterysmall townairplaneboatbathtubwoodsrural setting …wheelchairlakebaseballrussiacavecampfiretexasstorm (See All) |
| Characters: | dancerstudentteacherteenage boyhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsdoctorsingerboygirlnursephotographerbaby …writerthiefwitchfrenchself discoverymermaidpregnant wifeu.s. soldierolder man younger man relationshipmother in law daughter in law relationship (See All) |
| Period: | 1970s1980s1960s1940s2000s1950s1930s |
| Story: | swimming underwaterfly the insecthungermagical realismclassloss of fatherstorytellingflash forwardpainunderwater scenejourneysnakeswimmingclassroomvoice over narration …dancingbased on novelflashbackfemale nuditynudityblooddoggunkissfemale rear nudityphotographtitle spoken by charactersingingpartychasepistolcryingbeatingdreamfistfightslow motion scenecomputercatbare buttsecretlettershootinglierifletearsanimal in titlebedpianorevolverrivercriminalreporterbandbasketballarmyfootballhousefishjokechildcoffinfishinggraveyardtreelegendkarateclownkeyliaron the roadtentringpursuitchildbirthautomobiledeath of husbandbank robberyflowerpoettwinsacrificeheart attackcircuswerewolfpoemgoldwolfspiderbuttocksaccidental deatheccentricgiantmobstrangersheepparadecarnivalembarrassmentambitionpresumed deadbarefootgypsyshoesu.s. armyco workerimmortalitymiami floridaoillostswampthunderstormfat manparachutecubashadowsalesmanwedding ringcaneeye patchgrowing uploss of husbandwedding receptioncrowpiano playernude swimmingstage performancemetaphortv commercialbeerear nudityyoung version of characterbank robberbeastsororitystrokemoroccounsubtitled foreign languagemarching bandbankruptcyhearsealabamaidentical twinsmarriage engagementromantic rivalrytelegramfather son estrangementestrangementfather son reunionsecret missionhouse firemob violenceold housebonenight vision gogglesfamily feudfamily historykorean warvulturespotlightchemotherapyrocking chairfather in law daughter in law relationshipleaving homecongofootball gamebanjobrief female nudityventriloquistbutt nakedstudio logo segues into filmarmy lifeone eyed mannaked buttwoman's bare buttstorytellerparatroopericebergleechlifting an adult into the airdictionaryquicksandpower plantsiamese twinsspider webtraveling salesmanglass eyecircus performerterminal cancermultiple narratorslycanthropymilitary draftkorean war veteranbare butt womanlifting a male into the airfire eatermilkmantrailer housesideburnssorority housecatfishreference to bob hopeconjoined twinsscience fairfalling off a ladderrefusing to eattall taleanimate treewichita kansassearch for truthwoolly mammothunreliable flashbackringmasterroses are red poemunreliable narrationbuickforced perspectivecarnydaffodilamazing grace the hymnlandscaperparallel montagechicken poxgold ringmechanical handskywritingnewsweek magazinewhite picket fencecongenital heart defecthuman cannonballcar in a treecircus wagonpoet laureateshrinerwork in progress (See All) |
A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.
| Subgenre: | suspense |
| Themes: | murderdeathsurrealismrapedrinkingfuneralinvestigationvoyeurismmemoryobsessionredemptionpoetryhome invasionhopemurder investigation …death of daughterafterlifemissing child (See All) |
| Mood: | rain |
| Locations: | schoolhospitalsnowcemeterybathtubbicycletaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water |
| Characters: | dancerteenage boyhusband wife relationshipmother son relationshipfather son relationshipfamily relationshipspolicefather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipteenage girlserial killerdetectivepoliceman …photographersister sister relationshiplittle girllittle boygrandmother granddaughter relationship (See All) |
| Period: | 1970syear 1973 |
| Story: | falling into watershipwreckfantasy sequencelightningflash forwardunderwater sceneeatingmontageaxeflashlightsubjective cameravoice over narrationthree word titleknifedancing …based on novelflashbackf ratedblooddogkisscigarette smokingphotographtitle spoken by characterchasetelephone callfirecryingbeatingdreamcorpseblood splatterfoodwatching tvcameradrinkfalling from heightpaintingbooktearsrunningbirthdaydead bodyneighborvoyeursoccercandleno opening creditspaintersearchtreestalkersuburbsuitcaseevil manreadingbaseball batflowerspursuitsuspicionhatestrong female characterrecord playereyeglassespoembreaking and enteringhatjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesshopping mallfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationlost lovevacuum cleanerbroken windowdigging14 year oldcornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousetoy storechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All) |
Carl Denham needs to finish his movie and has the perfect location; Skull Island. But he still needs to find a leading lady. This 'soon-to-be-unfortunate' soul is Ann Darrow. No one knows what they will encounter on this island and why it is so mysterious, but once they reach it, they will soon find … out. Living on this hidden island is a giant gorilla and this beast now has Ann in it's grasps. Carl and Ann's new love, Jack Driscoll must travel through the jungle looking for Kong and Ann, whilst avoiding all sorts of creatures and beasts. (Read More)
| Subgenre: | cult filmstop motion animationcreature featuremonster movie |
| Themes: | dyingdeathlovekidnappingmoneyfearescapedancemonsterfilmmakingpovertyabductiontheatreexploitationgreed …panicunemployment (See All) |
| Locations: | jungleshipbeachnew york citytrainhotelmotorcycleairplaneboatvillagelakerooftopcavecampfireairplane accident …sea monstertrain driver (See All) |
| Characters: | dancerpolicepolicemanactorphotographerbabyhostageactressfilm directorchinesefiance fiancee relationshipship captaindeath of herowitch doctor |
| Period: | 1930s |
| Story: | animal fightanimal attackfalling into watersailorhungercookmonkeyunderwater scenejourneysnakemapsubjective cameraswimmingislandknife …dancingcharacter name in titlebased on novelbloodviolencetwo word titlegunkissfightexplosionchasetelephone callshot to deathmachine guncar accidentblonderescuecameraundressingfalling from heightriflebombrunningbedhandcuffsrevolvermanhattan new york cityreporterstrangulationmountainstabbingwomanbridgedinerbirdradioritualkingsearchpilotbinocularsscreamingcharacter's point of view camera shotmissionscreamflowerspursuitneck breakingsadnesstied upsacrificedisasterspearwoundfaintingfamelifting someone into the airblockbustergiantbrideladderfemale tied uppart animationtorchcrushed to deathappleeaten aliverampagedamsel in distressshopliftingfalling to deathtitle appears in writingtheatre audienceswampfogclifftribetuxedorescue missionpipe smokinganimal name in titledrumsceremonyexpeditiongatecanoemovie producergiant monsterhuman sacrificegorillaplane crashwallraftbeastfilm cameratheatre productionhand over mouthgreat depressionwhistlingmeat cleaversense of smellclimbing a treetitle in titlebroadway manhattan new york citymarriage engagementtyrannosaurus rexprehistoric timesorchestral music scoreapeair raiddeath of title charactermotorcycle copradio newsaltarchainsanimal killingbiplanefamous linegiant animalstarvingflash camerafleeinglogvulturewoman in dangerchrysler building manhattan new york cityfootprintlifting female in airgiant spiderretreatshacklesscreaming in fearel trainkaijulong island new yorkair strikevineempire state building manhattan new york cityalliterative titlesoutheast asiagiant creaturelifting an adult into the airremadetriceratopstheatrical agentnew york city skylineends with deathscreen testtrain wreckanimal deathsource musicdestruction of propertylarge format cameranative tribepterodactylfalling treesitting in a treegongking kongsimian fictionravinechasmman eating monsterexotic localetrain derailmentsteamshipwoman as objectfilm extralost civilizationbegins with a quotestegosaurustheatre marqueebogbroken jawcontemporary settinglost worldmonster as victimsymphonic music scorebrontosaurusdisaster in new yorkfeathersdirector actor relationshipgiant apeclimbing up a buildingwater canteengiant crabescaped animalstomped to deathleitmotifship's crewbleeding mouthpeeling potatoesmortal woundmouth forced openreference to beauty and the beastbitten to deathbomb throwinggorilla costumeoutrigger canoegrass skirtfruit vendorgas bombpartially lost film (See All) |
In a futuristic Japan, an outbreak of canine influenza spreads throughout the (fictitious) city of Megasaki with the risk of becoming contagious to humans. The city's authoritarian mayor, Kenji Kobayashi, ratifies an official decree banishing all dogs to Trash Island, which is immediately approved d …espite the insistence of Professor Watanabe, the mayor's political opponent who states he is close to creating a cure for the dog flu. The first canine deported from the city is a white and black-spotted dog named Spots Kobayashi, who served as the bodyguard dog of 12-year-old orphan Atari Kobayashi, the mayor's distant nephew and ward.
Six months later, Atari hijacks a plane and flies it to Trash Island (now nicknamed "Isle of Dogs") to search for Spots. After crash-landing, Atari is rescued by a dog pack led by an all-black canine named Chief, a lifelong stray. With their help Atari first finds a locked cage that presumably contains Spots' skeleton, but learns that it is not him. They then fend off a rescue team sent by Mayor Kobayashi to retrieve Atari. Atari decides to continue his search for Spots, and the pack decides to help him, but Chief declines because of his refusal to have a human "master". He is then convinced by Nutmeg, a female ex-show dog, to help the boy out of obligation. The pack seeks advice from sage-like dogs Jupiter and Oracle, who surmise that Spots might be held captive by an isolated tribe of dogs rumored to be cannibals.
Meanwhile, Watanabe finally… (Read More)
| Subgenre: | conspiracydystopiastop motionepicstop motion animation |
| Themes: | couragewritingfriendshipmurdersuicidechristmasmoneypregnancyfearescapeangercorruptiondepressionwrestlingpoetry …adoptioncrueltycannibalismfreedomsamurainarcolepsy (See All) |
| Mood: | rain |
| Locations: | shipwaterhospitalhotelhelicoptercemeteryairplaneboatairportjapancitylaboratory |
| Characters: | uncle nephew relationshipjapanesestudentbrother brother relationshipfriendtattoojapanese womanboygirlsoldierphotographerpriestwarriorprofessoramerican …mayorfemale scientisttattoo on backjapanese food (See All) |
| Period: | futurethe future |
| Story: | 12 year olddrummerbroken legsubtitled sceneclassratsplit screenlightningflash forwardjourneymapmontageflashlightorphansubjective camera …survivalswimmingclassroomislandvoice over narrationthree word titlebare chested maleflashbackviolencedogfightphotographtitle spoken by characterexplosiontelephone callfirelickingcryingunderwearrescuecomputercatcamerabattleswordarrestbare buttliesunglassesanimal in titlerobothandcuffsriversciencecriminaltelephonescientistnewspapergangmountainvideo cameramansionbridgepoliticianfishchild abusecoffindrawingfictional warbathsearchvoice overpilotlegenddangerprologueprotestkeypoisonmissionstatueskeletonhangingspeechisolationsadnessschoolgirlelectionstageblindfoldgeneralgraffitinewspaper headlinedismembermenthatesurgeryeyeglassesapplausetv newsloyaltywoundcagelistening to musicquestpropagandascene during opening creditshelmetcomadiseasesecurity camerademonstrationfraudchefdesperationjumping from heightladdertorchfateburialbossmoralitycultureguardremote controlguestbuddyresearchteamresistancecannibalplaneheadphonesprophecyexileschool uniformenglishbathingairplane crashinfectionparachuteshadowdemocracycapturetribecaneeye patchlanternbroken armextortionkingdompuppyrescue missionsirenowlwrestlerposterdrumsunderdogtranslatorbriberygiving birthpetbeheadingearphonesflagkatanabrainwashinggatecremationbandageschemeepisodic structurecartoon dogsuit and tiename callingskirttelevision newsdeportationtrashanimal crueltyinsomniarumorcrashlanguagehospital bedwhisperingunited statesjapanese schoolgirlmegaphoneblackboardwormwhistlingferris wheeldeath penaltydnamonitorslingshotgarbagepoliticaltop secretcrabquarantinemaggotweekendsushioctopusplanoverhead camera shotdumpstervotingtalking dogcartoon catdog moviesilhouettedoormancolonyweight lossgogglesloudspeakerflash cameraoutbreakspotlightstory tellingguard dogsolidarityresearcherwhite coathumanwastelandbandanavoicedrinking alcoholfurmuralsignemergencyscrollbanishmentreference to mosesyoung boydog tagmascotmetropolistranslationyoungdoorbellbrain surgerydukesquidnews anchorwearing sunglasses insideawardsserumbubble gumsneezingrendezvousexchange studentstray dogtirewastecompanionentrapmentchimneykidneyordercanineberlincaught in a netrightsoracledog biteheadsetrunwaywalkerbamboodog loversockheavy breathingstickpharmaceutical companyabandoned shipanimal protagonistcommunity servicejapanese manlost dogschool expulsionsumo wrestlermen's toiletcontrol roomsailor uniformtext on screenkidney transplantname tagadoptive father adopted son relationshipchopsticks the eating utensilleg in a castclimbing a ladderforeign exchange studentdripping waterrobot dogtask forcedog foodcandlelight vigilkidney failurehair curlersmaster dog relationshipchocolate milkcorrupt mayorjapanese wrestlerman wrapped in a towelblack boxscene during closing creditstake offtesticles slurdog adoptionear piecemissing boywild dogabandoned amusement parkfish as foodimplied male nudityfoot bridgeplastic bottlesumo wrestlingblack dogdog cagedog trackinterspecies friendshippregnant animalhouse petschool newspapercartoon fishlos angeles timesred buttonbiohazard signmaster keybiting an earcartoon ratdog trickface offmad dogman's best friendwolf dogcartoon owlcomputer hackingdog biscuitdog fightspitting out a tooththree piece suitcartoon crabcub reporterred telephonerigged electionwashing a dog (See All) |
A passenger ship, on her way to the scrap yard is pushed to her limits by the new owners to save on the dismantling fees. A tidal wave hits her, flipping her over so that all the internal rooms are upside down. A priest takes a mixed band of survivors on a journey through the bowels of the ship in a …n attempt to survive. (Read More)
| Subgenre: | cult filmsuspensedisaster filmdisaster movie |
| Themes: | couragedeathmarriagechristmasfearescapeangergriefdeath of wifepanicself sacrificeclaustrophobia |
| Locations: | storm at seashipwaterhelicopteroceanescape by helicopterrescue helicopter |
| Characters: | husband wife relationshipfather son relationshipdoctorsingerbrother sister relationshipnursepriestjewishlittle boypolice detectiveship captainjewish americanex prostitute |
| Period: | 1970s |
| Story: | swimming underwaterseasicknessloss of brothersurvivorunderwater scenejourneyflashlightsurvivalswimmingthree word titledancingbased on novelexplosionsingingpanties …firesongface slaprescuefalling from heighttearsbandbinocularsmicrophonerace against timechristmas treescreamstagedie hard scenariounderwaterheart attackdisasterropedestructionjoggingloss of wifeblockbusternew year's eveladderpreacherearthquakecelebrationfloodtrappedbraveryministerobesitychaospsychotronicdeath of protagonistone dayweathermusic bandmain character diessermonsaving a lifehysteriaalarmtelling someone to shut uprestroombachelorreverendpassengercruise shipnatural disasterrescue from drowningbarbershopensembleradardeterminationvoyagechurch servicecruisejealous husbandfloodingreference to mosesatlantic oceannew year's eve partypendantrescue attempthot pantsweldingjumping on a bedmediterranean seasteamocean linertidal wavecorporate greedcrisis of faithfire hosenew year's dayretireeair ductagainst the oddsship sinkingfemale corpseclaustrophobicreference to napoleon bonaparteunderwater explosionsostrapped underwatervisceralauld lang syneengine roomhaberdasherluxury linercapsizehigh seasolder sister younger brotherartificial christmas treewelding torchbra less woman (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi …c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
| Subgenre: | live action and animation |
| Themes: | deathfeardancemagicmilitaryangerpanic |
| Locations: | jungleschoolbeachmotorcyclesmall townlondon englandbicyclevillageenglandcastlemuseumtrain stationsubmarine |
| Characters: | human animal relationshipdancerbrother brother relationshipchildrensingerboysoldiermusicianpriestlittle girllittle boywitchgerman |
| Period: | world war two1940syear 1940 |
| Story: | hyenaleoparddrumstreet marketwhistlesailordrummerfull moonelephantmonkeybearfantasy sequencejourneyflashlightorphan …islandknifedancingfightexplosionsingingpistolfirecryingbased on booksongmachine gunmirrorpunched in the facebattleswordletterbookriflebombrunningbedbritishcompetitioncombatsoccercandleold manfishchilddream sequencefishingkingcigar smokingnecklacetransformationgunshotlibrarybinocularsuniformtentrabbitscreampianistpursuitcountrysideunderwaterapplauseropewaitercaptainentertainmentgrenadebow and arrowathleteflyingspearperformancelifting someone into the airragemagiciancaptivemousetoyenemywitchcraftfraudaudiencepart animationparadecolonelanthropomorphismshieldexplosiveinvasionanthropomorphic animalevacuationballcon artistlaughterlionarmorcliffraidtrophypigeoncrowdmusic bandposterrefereeplaying cardsimprisonmentspellauntmagic tricknotebookchoreographybicyclingperformergorillatween girlcrownmedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiometamorphosisunsubtitled foreign languagepotionpalm treealligatortrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentkangarooapprenticeliquidpet catanimal that acts humangiraffelockballroomvulturehookmarchstreet vendorbroomretreatscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerlongingostrichvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelineincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingroarcalypsochorinegoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All) |
Seventeen-year-old Greg has managed to become part of every social group at his Pittsburgh high school without having any friends, but his life changes when his mother forces him to befriend Rachel, a girl he once knew in Hebrew school who has leukemia.
| Subgenre: | independent filmcoming of ageblack comedyteen moviefilm parody |
| Themes: | dyingfriendshipdeathsurrealismdrinkingtorturememoryangerdeath of fatherdrug usecancergriefdatinghumiliationillness …regret (See All) |
| Mood: | high school |
| Locations: | schoolhospitalbuselevatorschool bus |
| Characters: | reference to godteenage boyhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattooboyteenage girljewish …single motherself referentialself hatetheatre student (See All) |
| Story: | overhead shotanimated sequencenicknameclassstorytellingflash forwardapologyeatingmontagesurvivalreference to jesus christprayerclassroomvomitingvoice over narration …based on novelflashbackinterviewmasturbationdogfightphotographsingingtelephone callcryingsongfoodmirrorslow motion scenewatching tvcomputercatdrinkbare buttsecretletterliemarijuanacollegehallucinationtelephonebedroomambulancedrug dealertalking to the cameralimousineprologueflowerswighigh school studenttrustblack americanterminal illnessnerdpot smokinglooking at oneself in a mirrorcomaice creammousetoyspiderclassical musicinterracial friendshippromiserap musicheadphonesdespairco workerscissorssurprisee mailhologramcellphonetuxedogeeknarrated by charactercremationcafeteriastairwaysarcasmname callinglooking out a window17 year oldpopcornstonerclimbing through a windowsquirrelhearing voices15 year oldstonedunhappinesscookiesoupleukemiatestepilogueawkwardnessreference to googlehonestywakepillowpolar bearhoodiekiss on the cheekreference to richard nixonhip hop musicgogglespittsburgh pennsylvaniapanic attackhebrewchemotherapydoombaldnessbirthmarkhigh school seniortarantulathreat to killapple computerpretending to be deaddoorbellkindergartenharpjoke tellinglooking in a windowreference to gandhirappinglimousine driverpenis slurinner titlespityreference to andy warholgerman accentfilm fanchased by a dogschool expulsionunreliable narratorhistory teacherboys' bathroomhit in the stomachteenage drinkingreference to orson wellesstocking caphumilityschool cafeteriaaspiring filmmakertulipgroup hugreference to salvador dalicollege applicationfist bumpmotherly lovereference to francois truffautreference to akira kurosawatattoo on neckhigh school cliquecrawling on the floorreference to texashornetreference to indiareference to luis bunuelsociology professorcorsagecrying teenage girlreference to lebron jamesreference to wolverinebreasts slurcrying teenage boycuttlefishget well cardpig costumereference to julian assangereference to klaus kinskicartoon chipmunkpassive resistancereference to cat stevenscremated ashesreference to princeton universityreference to werner herzogwalking down the middle of a streetdestroying a bookreference to afghanistanreference to hugh jackmansenior prom (See All) |
In this belated sequel to 'The Decline of the American Empire', 50-something Montreal college professor, Remy, learns that he is dying of liver cancer. He decides to make amends meet to his friends and family before he dies. He first tries to made peace with his ex-wife Louise, who asks their estran …ged son Sebastian, a successful businessman living in London, to come home. Sebastian makes the impossible happen, using his contacts and disrupting the entire Canadian system in every way possible to help his father fight his terminal illness to the bitter end, while he also tries to reunite his former friends, Pierre, Alain, Dominique, Diane, and Claude to see their old friend before he passes on. (Read More)
| Subgenre: | independent filmsex comedyhistorical eventdisney |
| Themes: | writingdyingreligionfriendshipdeathmarriageinfidelitymoneypoliticsadulteryfearweddinginvestigationrobberyextramarital affair …travelcorruptiondrug usecancerunfaithfulnesssexualityillnesshopeholocaustdrug addictioncheatingfear of deathsexual liberation (See All) |
| Mood: | satire |
| Locations: | catholic churchshiphospitalrestaurantairplaneboatlondon englandairportwheelchairsealakechinayachtalaska |
| Characters: | muslimcatholicchristianityreference to godstudentteacherhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipshomosexualpolicefather daughter relationshipmother daughter relationship …frienddoctorchildrenbrother sister relationshipprostitutenursedetectivepolicemanmusicianwriterpriestteacher student relationshipbibleprofessorcanadianex husband ex wife relationshipchinesefatheramericanparent child relationshipold friendfrench canadianbiologistreligious art (See All) |
| Period: | future |
| Story: | reference to albert camuspacific oceanmathematicsanimated sequencemiracleclassbusinessmanpainaxeclassroomflashbacksexsequelkissfight …cigarette smokingerectiontelephone callcell phonedreamfoodwatching tvcomputersecretbookcafemarijuanacollegewinecandlemassacreambulancedrug dealernunfishinglibraryspermdrug addictcowboybuxombankactor shares first name with characteruniversityamerican flagpoetgay coupletrustherointerminal illnessitalianteadiscowarehousepatientpsychologyhomerapistinvasionpastspanishsonmillionairejunkiepeacefeministbribeabsent fatherarabmeditationchilee mailphiladelphia pennsylvaniadivorceebonfireauctionlaptop computercia agentfianceepeasantsocialismsuccessbureaucracysydney australiaeconomicseuthanasiaintelligencecoloradocottagehugdrug dealunited statestoastyuppiecollege professorseizurepondauschwitzgurneycountry housefailuremanuscriptbarbarianmartyrmiddle agesestrangementfather son reunionopiummorphinespoonbaltimore marylandfather son conflictpolishradicalassisted suicideathens greecereference to george w. bushex wifemortalitysocialistfinancefather in law daughter in law relationshiptrophy wifeguardian angelarchaeologistholy communionvermontfamily conflictsaying goodbyeswallowco edportuguesegoodbyereference to platoreference to george washingtondrug withdrawalu.s. constitutionparadoxblowing a kisscultural revolutionmontrealreference to tom cruisetrystphilosophicalcapitalistantique dealerreference to mother teresareference to socratesalbanianreference to leonardo da vincireference to thomas jeffersonestranged sonphdreference to michelangeloberkeley californiapain killerliverintravenousmarxistreference to benjamin franklinnarrow mindednesspuritanreference to julius caesaru.s. canadian borderbuoypromiscuous manpromiscuous pastpulitzer prizelast ritespowderprostateart auctionhard onjesuitfrench presidentreference to jean luc godarddeclaration of independencemethadonereference to jean paul sartretrufflebedpanfirenzeethnologyreference to pope john paul iieaster islandreference to ikeameningitisreference to dantebulgarianchinese cultural revolutioncultural exchangescrambled eggid badgemedicarereference to machiavellivalparaiso chilechaliceseducerbattle of gettysburgmaoistsaint lawrence riverseparatistswamicriminologyexistentialistnew caledoniaperiodic tableproofreadernarcotics squadreference to nicole kidmanterracotta armycarmelitecommunion waferfatima portugalliver cancermecca south africapadua italylabor union corruptionreference to john adamsreference to silvio berlusconireference to sophoclesrubdownthighreference to alexander hamiltonreference to alexander solzhenitsynreference to euripidesreference to francoise hardyreference to herbert marcusereference to julie christiereference to tacitussituationist (See All) |
After being trapped in a jungle board game for 26 years, a Man-Child wins his release from the game. But, no sooner has he arrived that he is forced to play again, and this time sets the creatures of the jungle loose on the city. Now it is up to him to stop them.
| Subgenre: | fish out of water |
| Themes: | couragefriendshipsurrealismmagictime travelfirst lovemissing child |
| Mood: | breaking the fourth wall |
| Locations: | junglebeachforestmotorcyclecemeterysmall townabandoned factorybicycle chase |
| Characters: | father son relationshipmother son relationshipfamily relationshipsmother daughter relationshipbrother sister relationshippolice officerbullypsychiatrist |
| Period: | 1990s1960s19th century20th centurychristmas party1860syear 1969 |
| Story: | animal attackzebrarhinoceroselephantsubtitled scenemonkeyunderwater sceneapologyaxeorphanone word titletitle spoken by charactersurprise endingcar accidentshotgun …arrestrifleheld at gunpointhandcuffsrevolverrivermansionbridgeno opening creditschild in perilhit by a carconfessionlibraryprologuefactoryactor playing multiple rolesconvertiblefireplaceheavy rainlifting someone into the airhunteroverallsblockbustercgiearthquakepresumed deadrampagefloodstealing a carconstruction sitechaostime lapse photographylionatticrefrigeratormutationbullet timebatimpersonating a police officerhiding in a closetcrocodiletween girlshoefriends who live togetherboard gamefather son reunionmotorcycle coprecluseimprovised weaponbased on children's bookanimal killingloss of parentsrainforestlootinggiant spiderhuman becoming an animalsanta claus suitauto theftmosquitogiant insectchestexterminatorvortexnew hampshirequicksandstampedegun storetailconveyor beltaltering historypelicaninvestment bankertrailer narrated by hal douglasmonsoonsporting goods storepoison ivybig game hunterinsect attackcarnivorous plantyear 1869dybbuk boxcar through wallanimal driving a cartrailer narrated by nick tate (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com