Please wait - finding best movies...
When ambitious young real estate agent Leigh is asked to sell a house with a checkered past, she crosses paths with a disturbed girl whom she believes is the runaway daughter of the couple selling the property. When Leigh tries to intervene and help her, she becomes entangled with a supernatural for β¦ce that soon pulls Leigh's artist sister Vera into its web - and has sinister plans for both of them. (Read More)
Themes: | evilpregnancymoney |
Locations: | hospital |
Characters: | suicide by hangingartistsister sister relationship |
Period: | year 19872000s1980s |
Story: | mirror does not reflect realitylooking at self in mirrorsupernatural pregnancy2004 indian ocean earthquake and tsunamisuicide of pregnant womansuspended mid airselling soulthrown out a windowshell gamesoul sellingboxer briefsart showfalling out a windowadopted childloft β¦wardroberaincoatloss of sisterbabysittingreal estatealarmreal estate agentdead woman with eyes opendemonic possessiondeath of sisterpower outagemale underwearcomababysitterhangingvirginnonlinear timelinefoot chasetelevisiondemonmirrorcell phonesurprise endingknifephotographbare chested maleblood (See All) |
While babysitting a boy and his baby brother, Casey Beldon has a dreadful nightmare involving a weird dog and an evil child, and she tells her best friend Romy over the phone. Casey is haunted by this boy, and when she goes to the ophthalmologist, he asks if she has a twin brother or sister. She ask β¦s her father and discovers that her mother lost a son that died in the womb. Casey suspects that she is haunted by the spirit of her brother. She finds a letter addressed to a woman called Sofi Kozma and a creepy picture at home that belonged to her mother. She goes with Romy to a retirement home to meet Sofi, a survivor of the experiments during the Holocaust. But Sofi tells Casey that she had never met her mother and later calls Casey to tell her she is in great danger. (Read More)
Themes: | evilpregnancydeathrevengesuicidedeath of motheradoptionholocaust |
Mood: | rainnightmare |
Locations: | hospitaltrainnightclubwoods |
Characters: | suicide by hangingfather daughter relationshipboyfriend girlfriend relationshipfemale protagonistpriestghost in mirrorgerman officer |
Story: | mirror does not reflect realitybabysittingdemonic possessionpower outagebabysittermirrorsurprise endingphotographbare chested malebloodflashbackdogtwo word titlekisstitle spoken by character β¦chasepantiesshowertelephone callbeatingpunched in the facefalling from heightmaskletterbookvomitinghallucinationprayerriverflashlightcandleaxevideo camerastabbingbasketballstabbed to deathsubwaywhite pantiesdream sequencechild in perilhit by a carrituallocker roompossessiondeath of childcollege studentinjectionlaptoppremarital sexloss of motherclasstwinbralessgirl in pantiesexperimentcoachfalling down stairssyringediscojoggingwalkie talkiestabbed in the stomachloss of loved oneback from the deadwindball gagstabbed in the neckinsectheadphonesscissorshit on the headsuperstitionjumping through a windowconcentration campaerial shotexorcismnewspaper clippingshowapparitionelderlyeyestairwaypregnancy testfilm projectorwhistlex raybroken mirrorrabbitwin brotherholocaust survivorbellreference to albert einsteindeath of boyfriendauschwitzgurneykiller childdeath of grandmotherfetushebrewevil childgloveimplied nudityinfanthornpendanthuman experimentationfall to deathultrasoundcamel toephantomstabbed in the bellybroken backwind chimebaby monitorblue eyescatatoniaabandoned hospitalcirclebasketball coachpossessed girlkabbalahdistortionstillbirtheyes different colorfried eggone way mirrornazi experimentpit bullhead spinbathroom mirrorgirls locker roomneedle in eyeeye doctorchimecrash through windowhead twisted backwardsdybbukhetero chromiabreaking mirroreye colorcrab walkhome for the old (See All) |
Subgenre: | cult filmsuspense |
Themes: | evilpregnancymurderdeathrapefearescapedeceptiondevilmurder of family |
Mood: | goreslow burn |
Locations: | hospitalcemeterykitchen knifeblood in carrunning water |
Characters: | husband wife relationshipfemale protagonistnurseterrorpregnanttalking to oneself in a mirrorself inflicted gunshot woundself cutting |
Period: | 1980syear 1982 |
Story: | power outagebabysitterfoot chasedemonsurprise endingknifephotographbare chested malebloodflashbackcigarette smokingdancingchasepantiespistol β¦corpseblood splatterblondeshot in the headwatching tvsecretdead bodycollegepianocleavagebound and gaggeddeath of friendthroat slittingstabbed to deathsuicide attempthousefishwhite pantiesscantily clad femaleritualroommatevangraveyardstabbed in the backprologuepay phoneproduct placementknocked outcollege studentshot in the shoulderwigdeath of sonbasementpremarital sexhaunted housepizzagirl in pantiesocculteavesdroppinghypodermic needlepatientstabbed in the stomachwitchcraftcovered in bloodattempted suicidepool tableshot in the faceanxietyheadphonesbilliardsmurder of a childeye gougingcanetrophywilhelm screamlyingceremonyhairshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishfilm starts with textlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestoneritetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in feardrinking bloodrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultsatanic ritualstained glass windowstartledstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All) |
Robert and Katherine Thorn seem to have it all. They are happily married and he is the US Ambassador to Great Britain, but they want nothing more than to have children. When Katharine has a stillborn child, Robert is approached by a priest at the hospital who suggests that they take a healthy newbor β¦n whose mother has just died in childbirth. Without telling his wife he agrees. After relocating to London, strange events - and the ominous warnings of a priest - lead him to believe that the child he took from that Italian hospital is evil incarnate. (Read More)
Subgenre: | paranormal phenomenasupernatural horrorchristian horror |
Themes: | evilmurderdeathsuicidereligionfearfuneralinvestigationsupernatural powergriefadoptiondeath of wifedevildeath in childbirththe devil |
Mood: | gore |
Locations: | hospitalchurchcemeterylondon englandkitchencavegas stationstormcatholic churchairplane trip |
Characters: | suicide by hangingfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipchildrenboypolicemanphotographerbabypriestchristianitylittle boybible β¦american abroadcatholic priest (See All) |
Period: | 1970s |
Story: | dead woman with eyes opendemonic possessionhangingdemonsurprise endingknifephotographbloodviolencedogtwo word titlegunslow motion scenefalling from heightreference to jesus christ β¦decapitationgood versus evilorphanimpalementsevered headnuncoffinchild in perilbirthday partygraveyardgravestalkerfirst of seriespossessionlightningu.s. presidentskeletonamerican flagfirst partnewspaper headlinechild murderoccultfireplacebulletgothicrome italylifting someone into the airloss of wifevillainessblockbustermonkanimal attackreincarnationstabbed in the throatmillionairezoobroken glassreference to satanbible quotedeath of protagonistbody landing on a cardaggerexorcismnewspaper clippingmiscarriagenannygothbeheadingmysticismmonasteryjerusalemambassadorunsubtitled foreign languagemoving infamous scoredarkroomdisfigured facedead wifealtardog attackdiplomatburn victimantichristcasketevil childexorcistbirthmarkdeath by hangingarmageddonluciferbible prophecygovernesstricyclerottweilerchild murdererlifting male in airdevil worship666english accentomentrailer narrated by percy rodriguezdeath by impalementhorror movie remadearcheological digbaboonbook of revelationpushed down stairscharacter appears on front page of a newspaperfacial disfigurementswitched at birth5 year oldends with funeralstillborn childphotograph in newspaperevil dogbaby switchjackalflatbed trucklightning rodends with a quotepaternosterreligious sacrificeamerican ambassadorphotography darkroompublic suicide (See All) |
Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl β¦osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)
Subgenre: | independent filmcult filmparanormal phenomenasupernatural horror |
Themes: | evilmurderlovemarriageghostfearweddingtheftsupernatural powerparanoiasurveillancepanicpolice investigationmurder of family |
Mood: | nightmare |
Locations: | barchurchmotorcyclecatholic church |
Characters: | husband wife relationshippriestterrorcatholic priest |
Period: | 1970s |
Story: | real estatereal estate agentdemonic possessionmale underwearbabysitterdemonbloodsexfemale nudityflashbackdogthree word titlepantiesbased on bookdream β¦shotgunvomitingbeerplace name in titleriverbedroomaxeambulancetoiletwhite pantiesnunvanparktreelibrarycurseattacklightningscreamcrosshauntingfirst parthaunted housechild murderoccultfireplacegothiclifting someone into the airagingcrucifixbeardblockbustergrindhousereincarnationstairsthunderstormbriefswedding receptionblindsuffocationclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwhite briefswoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgirl stripped down to pantiesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storycamel toeremadetrailer narrated by percy rodriguezbare midriffevil forcehorror movie remademicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All) |
When the Vatican observatory priest sees the appearance of a comet, the Church is sure that it confirms the eve of the Armageddon. Meanwhile, the USA President's godson Robert Thorn is informed in the maternity in Rome by Father Spiletto that his wife Katherine has just lost her baby and she had tro β¦ubles with her uterus and would not have another pregnancy. Spiletto suggests Robert that another just born child that lost his mother could be the substituted for his son, and Robert accepts the child and gives the name of Damien. Robert is promoted to ambassador in London after a tragic accident. When Damien's nanny commits suicide in his birthday party, a substitute, Mrs. Baylock, comes to work and live with the family. Along the years, Katherine realizes that Damien is evil, while Robert is contacted by Father Brennan, who tells him that Damien is the son of devil. When the priest dies in a bizarre accident, the photographer Keith Jennings shows evidences to Robert that the boy is the Antichrist. They travel to the town of Megiddo to learn how the boy can be stopped. (Read More)
Subgenre: | paranormal phenomenachristian horror |
Themes: | evilpregnancymurderdeathsuicidereligionfearfuneralparanoiacancerapocalypsewritingthe devil |
Mood: | gorerainnightmarehorror movie remake |
Locations: | hospitalnew york citychurchcemeterybathtublondon englandrooftop |
Characters: | suicide by hangingfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipchildrenboysoldiernursephotographerpriestpsychiatristterroramerican abroadcatholic priest |
Period: | 2010s |
Story: | dead woman with eyes opendemonic possessionhangingdemoncell phonesurprise endingknifephotographblooddogtwo word titlecigarette smokingexplosionpistolfire β¦corpseshot to deathblood splatterremakeslow motion scenesecretfalling from heightmanhattan new york cityreporterdecapitationorphancandleimpalementexploding carsevered headnunchild in perilhit by a carbirthday partygraveyardattempted murderlimousinegraveperson on firepoisonpossessionchristmas treelightningu.s. presidentscreamskeletonmanipulationamerican flagtragic eventcrossloss of mothernewspaper headlinemonkeybirthday cakesyringefireplacekilling an animalballoonheavy rainrome italylifting someone into the aircrucifixloss of loved oneloss of wifetherapistswat teamjumping from heightfatemonkanimal attackfull moonfloodplaygroundloss of songash in the facezooprophecyscissorsreference to satanbible quotethunderstormfoghandheld camerae mailmurder of a childdisfigurementswingbody landing on a carlasersightworld trade center manhattan new york citydaggernannytombpopemonasteryfemale psychopathgorillascootersatanismtraffic jamburnt facecatholicismshoeambassadorloss of childbreaking a windowwarningnoosekicked in the headmoving inkiller childdarkroomdisfigured facetabloidmagnifying glasstsunamicheckpointmerry go roundpentagramsledgehammerdog attackburn victimbouquetcometantichristhide and seekhurricane katrinastrawberryred winecutting hairevil childchurch belltantrumbirthmarkarmageddonconcussionskepticismbig ben londoncardinal the priestexhumationmob of reporterstricycledead babyshaky camwoman kills womanobservatoryhelium balloondevil worshipfreak accident666omenbiblical quotehanged by the neckpleadingremake of cult filmnun's habitu.s. embassyvatican citydriftinganimal biteblowing bubblesdisbelieving adultmilitary funeralmilitary dress uniformreference to the new testamentlightning strikenikon camerablowing out a candlered balloontelephoto lensevil dogisraeli flagmanhole covergasoline truck21 gun salutejackalmark of the devilmonster in mirrorrazor scooterremake of british filmupside down crossmotorcycle escortpunch and judy (See All) |
In New York, the former NYPD detective Ben Carson is hired to work as night watch of the remains of the Mayflower Department Store that was partially destroyed by fire many years ago. Ben became alcoholic and was retired from the police force after killing a man in a shooting. His marriage was also β¦destroyed and now he is living in the apartment of his younger sister Angie. However he has not been drinking for three months and sees the employment as a chance to rebuild his life. When he goes to the rounds in his first night, he finds that the mirrors are impeccably clean and his colleague explains that the former night watch was obsessed with the mirrors. After a couple of nights, Ben sees weird images in the mirrors, but due to the lack of credibility of his past, his ex-wife Amy believes he has hallucinations as a side effect of his medication. When Angie is found brutally murdered in her bathtub, Ben discovers that there is an evil force in the mirror that is chasing him and jeopardizing his family. (Read More)
Subgenre: | supernatural horror |
Themes: | evildeathsuicidemarriageghostfearangersupernatural powerguiltinsanitygriefalcoholismmurder of a police officer |
Mood: | gorehorror movie remake |
Locations: | hospitalnew york citybarbathtubrural settingpolice carpennsylvania |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipgirlpolice officerlittle girlsecurity guardpsychiatristtalking to oneself in a mirrorghost in a mirror |
Story: | mirror does not reflect realitydemonic possessiondeath of sisterdemonmirrorsurprise endingknifephotographbloodfemale nudityone word titleflashbackfemale rear nuditytitle spoken by characterexplosion β¦chasepistolfirecorpseblood splattercar accidentremakewatching tvcameravomitingheld at gunpointbirthdayhallucinationprayerflashlightmassacreambulancethroat slittingimpalementtied to a chairsubwayapologynunchild in perildrowningbartenderlocker roomperson on firepossessionbasementratgraffitinewspaper headlineburned alivecoplooking at oneself in a mirrormutilationtied to a bedmorguebuttockshomecrying manschizophreniacrushed to deathmental institutionwhiskeypillsgash in the facemental hospitalscissorsmedicationdeath of protagonistbathingautopsyalternate realitymarital separationalarm clocksirennewspaper clippingnannyman cryingdoppelgangerabandoned buildingclosetex cophiding in a closetmonasterybandagesubway stationremorsephysicianconventbroken mirrorburnt faceinterracial marriageglassscene of the crimepsychiatric hospitalvideo footageinterracial coupledeath of familystatue of libertycut handmurder of a nude womanpool hallimmolationbreaking a mirrorhousemaidcityscapenypdnight watchmanbreaking down a doorblond hairexposed breastcprfire enginevideo recordingdummyscreaming in painstartledestranged coupleinterracial loveestranged wifeevil forcethrown through a wallsprinkler systemglass shardfather child relationshipreflection in waterjaw ripped offremote controlled toy carfaucetestranged husbandhandprintspurting bloodpaint on glasssliced bodychild drowningtrapped underwatermirror as portalpsychiatric treatmentburned out buildingmalevolent entityantisepticpleading for helpremake of korean filmartistic imagery (See All) |
In 1988, in California, cinematographer Dennis moves to the house of his girlfriend Julie to raise a family with her daughters Katie and Kristi. Little Kristi has an imaginary friend named Toby while weird things happen in the house. Dennis decides to place cameras in the house to capture images dur β¦ing the night and soon he finds that there is an entity in the house. Dennis's friend Randy Rosen ('Dustin Ingram (I)' (qv)) researches the events and learns that his house might be a coven of witches and the children may be in danger. (Read More)
Subgenre: | supernaturalmockumentaryfound footageparanormal activity |
Themes: | fear |
Locations: | kitchen |
Characters: | sister sister relationshipmother daughter relationshipboyfriend girlfriend relationshipwitchstepfather stepdaughter relationship |
Period: | 2000s1980syear 1988 |
Story: | looking at self in mirrorbabysitternonlinear timelinedemonsurprise endingnumber in titlesequelthree word titledigit in titlesecretmaskbooksubjective camerabedroomvideo camera β¦cultno opening creditschild in perilbirthday partythird parttalking to the camerapoint of viewcharacter's point of view camera shottentcharacter says i love yougaragefalling down stairsvideotapeteddy bearearthquakefanprequelfast motion scenemarijuana jointinvisibilitylevitationhiding in a closethair pullingyoung version of characterno title at beginningimaginary friendwhisperingwoman in bra and pantiesactress shares first name with charactervhswoman wearing only a man's shirttrampolinefilmed killinghome videoroller skatessymbolpentagramvcrnumber 3 in titlepinatatea partybroken backlocked in a closetno music scorescratchwatching someone sleepanimate objecttripodwedding videopainting a wallhorror movie prequelhalloween maskprequel and sequelwatching videoloud noisewedding photographreference to the tooth fairybloody marygrandmother's housecrawl spaceinvisible beingoscillating fanreference to macgyversanta rosa californiacovivant covivant relationship (See All) |
The twenty-one year-old Timothy "Tim" Allen Russell is discharged from a mental institution by his psychiatric Dr. Shawn Graham completely healed from a childhood trauma where his father purportedly tortured and killed his mother before being killed himself by Tim. His sister Kaylie welcomes him in β¦the parking area and brings him home. Then she tells that they need to destroy an ancient mirror that she has found through working at an auction house. She then steals the mirror and the reluctant Tim follows his sister and has fragmented recollections from their childhood, going back to when his father Alan buys a mirror for the home office of their new family home. Kaylie and Tim see a woman with their father in his office and the behaviors of Alan and Marie change, ending in a family tragedy. Kaylie blames the mirror and now she wants to destroy it with Tim. Will they succeed? (Read More)
Subgenre: | supernaturalparanormalparanormal phenomenaghost storysupernatural horror |
Themes: | murderdeathsuicideghostadulteryescapeinvestigationdeceptiondeath of fatherobsessionsupernatural powerdeath of motherdysfunctional familyinsanitytrauma β¦childhood traumamysterious death (See All) |
Mood: | nightmare |
Locations: | hospitalpolice car |
Characters: | family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipboybrother sister relationshipfemale protagonistgirlpolice officerpolicemanalcoholicpsychiatristself mutilationfiance fiancee relationship β¦colleague colleague relationshipcrying girlcrying boyghost in mirrorghost in a mirror (See All) |
Period: | year 2002 |
Story: | mirror does not reflect realitylooking at self in mirrorloss of sisteralarmdeath of sisterfoot chasemirrorcell phonesurprise endingphotographbare chested malebloodviolenceone word titleflashback β¦doggunfightchasetelephone callcryingface slapremakewatching tvcameraarrestshootingbirthdayhallucinationhandcuffsrevolverorphanflashlightstrangulationvideo camerastabbed to deathaccidentapologydream sequenceanimaltalking to the cameragunshotargumentcursepossessionstatuescreamdomestic violencescarloss of fatherreunionloss of motherhaunted houseredheadtherapystrong female charactersisterexperimenteavesdroppingnipples visible through clothinglooking at oneself in a mirrortold in flashbackhidingwatching a moviecrying womantherapistaccidental deathvisitcheating husbandcrying manchokingmental institutionpromiseresearchblood on facestabbed in the neckhousewifemental hospitaldelusionsculpturehit on the headaccidental killingabusive fatherlanternpuppyasylumchainalarm clockabusive husbandchildhood memoryshot multiple timesauctionplantunfaithful husbandmale objectificationfianceemental patientbarking dogillusionrepeated scenegolf clubvacuum cleaneranimal crueltybroken mirrorhearing voicesartifactlocked doorbased on short filmmoving inpsychiatric hospitalcrying femalemysterious womanoverhead camera shotiphonewatching a videospitting bloodtoy gunwoman slaps a manpsychotronic filmdog attackfeet on tablehusband murders wifebreaking a mirrorglowing eyesgrindhouse filmpointing a gun at someonescreaming womantear on cheekframed photographabusive mothercaged animalcrying malejumping out a windowthreatened with a gunhysterical womanflickering lightbad dreammental asylumnew housearchival photographfiancesecretly observingskepticismhand injurymarital crisisoverheard conversationlocked ingolden retrieverhysterical outbursttimerbloody mouthchild murdererblood on handscomputer programmertalking to an animalwoman hits a mancrime scene photographdog biteadulterous husbandson murders fatheranchorwoman in a bathtubcaught cheatingtalking to a dogcheating on wifebloody handsingle locationdrinking wineband aidyear 1955private investigationhit with a golf clubblood on mouthlightbulbmagical mirrorchained to a wallabusive parentmysterious eventstrong female protagonistblood on wallchild's bedroompossessed womanrepeated scene from a different perspectiveanimal bitedead body in a bathtubblood on handhole in the walleating an applepacking a suitcasepossessed mansleeper holdloading a gunmale female fightsleeping shirtlesswatching a cartoon on tvbitten by a doghome officetelephone terrordragging someoneviolent manescape out a windowfemale alcoholiclabrador retrievermentally unstable womanspilled drinkdeath by stabbingbreaking a platepsychiatric evaluationabusive womanapple macintosh computergun pointed at faceviolent womanbrother sister reunionchained to wallcracked mirrorcursed objectchained womanvacuum cleaningyear 1864attacked by dogbarbellglowing eyeson hits fatherbroken platetraumatic memoryescape by the windowemotionally unstable womanhandcuffed mansitting on the floorsleeping in underwearvertigo shotbiting fingernailsfinger injuryhusband wife fightparanormal researchwoman wearing a negligeebottle of waterbrother kills sisterco worker co worker relationshipemergency callfilmed paranormal eventyear 1904house plantman's best friendreference to william tecumseh shermanscene repeated from alternative perspectiveyellow pagesdelusional manmysterious figureremoving a fingernailsanity hearingviolent fatherwatching a cartoonbroken lampchain around neckchanging a lightbulbcovering someone's mouthdestroying a cellphoneex mental patientmom and dadrelease from a mental institutionscared by a mirror imagescene told from more than one perspectivescreaming boy (See All) |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β¦ end up having to survive this swarm of evil until morning comes. (Read More)
Subgenre: | independent filmcult filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror |
Themes: | evilmurdersurrealismghostdancemonstermemorytime travelsadismbook of evil |
Mood: | gorenightmareavant garde |
Locations: | forestairplanewoodskitchencastlestormbackwoods |
Characters: | husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation |
Period: | year 19871980s1990s20th century |
Story: | demonic possessiondemonmirrorsurprise endingbloodsexnumber in titleviolencesequelkisschasethree word titlepantiesvoice over narrationsong β¦underwearblood splattershotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianohallucinationdecapitationgood versus evilaxestabbingstabbed in the chestsevered headanti herotreecursestabbed in the backpossessionskeletonbasementhauntingratcabinsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonshovelpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyecellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All) |
A sinister secret has been kept in the basement of an abandoned Los Angeles church for many years. With the death of a priest belonging to a mysterious sect, another priest opens the door to the basement and discovers a vat containing a green liquid. The priest contacts a group of physics graduate s β¦tudents to investigate it. Unfortunately, they discover that the liquid contains the essence of Satan himself, and they also discover that he will release HIS father - an all-powerful Anti-God! The liquid later comes to life itself, turning some of the students into zombies as the Devil comes forward to release his father. Will these students be able to stop him? (Read More)
Subgenre: | cult filmblack comedysuspensesupernaturalsupernatural horrorchristian horror |
Themes: | pregnancymurderdeathsurrealismsuicidereligionfearescapedeceptionsupernatural powerparanoiafaithunrequited loveapocalypsephilosophy β¦self sacrificedevilnear death experiencescience versus supernatural (See All) |
Mood: | nightmareambiguous ending |
Locations: | churchlos angeles californiapolice carcatholic church |
Characters: | father son relationshipafrican americanboyfriend girlfriend relationshipdoctorzombiestudentpriestbibleprofessorcatholicasian americanself mutilationcatholic priestengineerhomeless man β¦babe scientistreligious icon (See All) |
Period: | 1980s1990s |
Story: | looking at self in mirrordemonic possessionpower outagedemonmirrorsurprise endingknifebare chested malebloodfightcigarette smokingsingingchasethree word titlebeating β¦dreamcorpseblood splatterfistfightrescuepunched in the facecomputerbrawlsecretfalling from heightcollegeclassroomsciencescientistdecapitationgood versus evilsurvivalflashlightcandleaxeambulancethroat slittingimpalementstabbed to deathstabbed in the chestsevered headnundream sequencenews reporttransformationracial slurlimousinestabbed in the backkeypay phonepossessionrace against timecover upcollege studentlightningdiarydisappearancedeath of sonbasementneck breakingpremarital sexsevered armcult directortypewriterdismembermentundeadpizzaoccultcard gameelectronic music scorelooking at oneself in a mirrorcrucifixkicked in the stomachsevered handmind controlend of the worldfull moonwatching televisioncrime scenevisionblood on facestabbed in the throatgash in the faceinsecttitle appears in writingescape attemptreference to satanthrown through a windowdisfigurementsiegestabbed in the eyesevered legbruiseethnic slurtelekinesisplaying cardstranslatorliving deadcartoon on tvhiding in a closethit in the facedefecationcomputer crackerportalbugcomic reliefsecret societybroken mirrorinsomniainterracial kisslatinwormantphysicsstabbed in the shouldertitle in titlemaggotparasitehomeless persondead birdsymbolarm cut offhoboimprovised weaponbreaking through a dooralternate dimensionsectliquidantichristclimbing out a windowsocial decayregenerationstabbed with scissorsbeetlecard trickphysicisttranslationinvulnerabilitygraduate studenthomeless womantelling a jokequantum physicsmusic score composed by directorentrapmentsubliminal messagebroadcastevil godstabbed through the chestvagrantrecurring dreamabandoned churchdream within a dreampessimismtrapped in a buildingcontainerastral projectionshared dreamlovecraftianclaustrophobicreanimated corpsesupernovabreaking through a wallunicyclehit with a brickchinese takeoutuniversity campustheoretical physicsmarkresearch scientistcylinderyawntachyonradiologistscience vs religiondefying gravity (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r β¦eason too. (Read More)
Subgenre: | cult filmtragedy |
Themes: | murderdeathsuicideghostfuneralmagicangersupernatural powerdeath of mothergriefdeath of wife |
Mood: | gorenightmarenightdarkness |
Locations: | hospitalschoolchurchcarcemeteryairplanebathtubairportwoodsrural settingtrucknew england |
Characters: | suicide by hanginghusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipzombiepriestlittle girllittle boyfather in law son in law relationshipdeath of boy |
Period: | 1980s |
Story: | loss of sisterdeath of sisterhangingsurprise endingphotographbloodbased on novelviolenceflashbackdogexplosionfiretitle directed by femaledreamcorpse β¦rescuepunched in the facewatching tvcatsecrettearsbedbathroomneighbortelephoneflashlightold mandeath of friendwomanweaponchildcoffinpantyhosepainconfessiongraveperson on firedeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonmoonfemale stockinged legsburned alivegothicinjurylifting someone into the airhatloss of friendtoyhidingloss of wifedead womanback from the deadhitchhikingcamera shot of feetpromiseloss of sonpet dogresurrectionshovelpsychotronicdead childdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeupscalpelhit by a truckhead injuryloss of childkitenoosekiller childmurder of wifeorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmainesuicide noteswinginghouse firepet catdeath of loverglowing eyesevil childairlinerscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead songrave robbingkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |
In Pasadena, Mrs. Davis sends her daughter Aubrey Davis to Tokyo to bring her sister Karen Davis, who is interned in a hospital after surviving a fire, back to the USA. After their meeting, Karen dies and Aubrey decides to investigate what happened to her and gets herself trapped in the same situati β¦on, being chased by the ghost of the house. Meanwhile in Tokyo, the three high school mates Allison, Vanessa and Miyuki visit the famous haunted house and are also chased by the ghost. In Chicago, Trish moves to the apartment of her boyfriend Bill, who lives with his children, the teenager Lacey and boy Jake. On the next door, weird things happen with their neighbor. (Read More)
Subgenre: | ghost story |
Themes: | murderdeathrevengeghostfearangersupernatural powermysterious death |
Mood: | high school |
Locations: | hospitaltrainbathtubvillagerural settingjapancitychicago illinois |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother daughter relationshipteenage girlteacherpolice officernursestudentlittle boyterrorstepmother stepson relationship |
Story: | loss of sisterdead woman with eyes opendeath of sistermirrorcell phonesurprise endingphotographnumber in titlesequelflashbackpantiestelephone callcorpseurinationwatching tv β¦catcondomfalling from heightsecond partclassroomgood versus eviljournalistbraritualdrowningcursediaryneck breakingschoolgirlhaunted housepsychicspiritbreaking and enteringgothicphone boothdead womantokyo japanpastdead childnewspaper clippinggothreturning character killed offphysicianaltered version of studio logokiller childdarkroomvideo cassettewoman's neck brokenevil childdead woman on groundinter culturalremake by original directordefenestrationpasadena californiawraithurinating in fearfamily violencefemale urinatingestranged family memberrecords (See All) |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
Subgenre: | independent filmmockumentaryfound footagefake documentary |
Themes: | murderfearsupernatural powerpanic |
Mood: | nightmarenightdarkness |
Locations: | swimming poolkitchen |
Characters: | boyfriend girlfriend relationshipself mutilationself absorption |
Period: | 2000syear 2006 |
Story: | demonic possessionmale underweardemonsurprise endingknifephotographbare chested malebloodinterviewtwo word titlefirecomputercamerawritten by directorlow budget film β¦guitarf wordsubjective camerabedroomvideo camerahouseno opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguemicrophonescreamingsuburbfirst of seriescollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst partsevered armhaunted houseobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterladderbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All) |
Jonathan Harker is sent away to Count Dracula's castle to sell him a house in Wismar where Jonathan lives. But Count Dracula is a vampire, an undead ghoul living off of men's blood. Inspired by a photograph of Lucy Harker, Jonathan's wife, Dracula moves to Wismar, bringing with him death and plague. β¦.. An unusually contemplative version of Dracula, in which the vampire bears the curse of not being able to get old and die. (Read More)
Subgenre: | cult filmgothic horror |
Themes: | evildeathsurrealismmarriagefearlonelinessdepressioninsanityillnessamnesiaself sacrifice |
Mood: | nightmarehorror movie remake |
Locations: | hospitalbeachcemeterysmall townvillageseashipcastlegermanytown |
Characters: | husband wife relationshipdoctorvampirelustemployer employee relationship |
Period: | 19th century |
Story: | real estatereal estate agentmirrorsurprise endingknifephotographbloodbased on novelcorpsehorseremakecatarrestfalling from heightbook β¦beddead bodyvoyeurmansionwomanhousedinnernuncoffinforeign language adaptationjourneynecklacecurseevil mandiarycrosshorse ridingpigratcaptaininjuryagenthammervisitsheepviolinclockwoman in jeopardygypsyimmortalitysuperstitionshadowexistentialismhorse and carriagemelancholyviolinistbatcontractreflectionharbordraculaplaguemarried coupleinsane asylumkittensunrisefeverinnpsychotronic filmsleepwalkingescaped mental patientbitebaldnessfuneral processionblood drinkingtransylvaniadrinking bloodstakemaster servant relationshipbusiness tripnew neighborruinvampire biteriding a horsebaltic seanew german cinemacity councilblack seagerman expressionismestate agentgypsiespsychic linktown squarenosferatuwatching through a windowevil spellpallbearerpeststraitjacketlong fingernailssucking bloodmultiple language versionpointy earssigning a contractbiting someone's necksleeping in a coffin (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
Subgenre: | independent filmsuspense |
Themes: | pregnancymurderdeathlovesuicidekidnappingghostdrinkingfeardrunkennessfuneralmemoryobsessionsupernatural powerparanoia β¦drug usedysfunctional familyguiltafterlife (See All) |
Mood: | rainnightmaremurder suicide |
Locations: | cemeterybathtubchicago illinois |
Characters: | sister sister relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipchildrenboyteenage girlteenage boypolicemansuicide by gunshotbrother in law sister in law relationshipsuper hero β¦seeing a ghost (See All) |
Story: | looking at self in mirrorloss of sisterbabysitternonlinear timelineknifebare chested malebloodsexbased on novelgunfemale rear nudityfightpartyerectioncrying β¦songwoman on topcorpseshot to deathblood splattershot in the chestwatching tvdrinksecretshootingvomitingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backsubjective cameraflashlightbandambulancesuicide attempthousecoffinsearchgraveyardtalking to the cameragraveproduct placementmissing personcover upattempted rapedisappearancesleepinghaunted housepsychicgameguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewblood on faceunderage drinkingshoveldelusionhypnosissuperstitionfogsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismbreaking a windowhearsepsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
Themes: | evilmurderdeathrevengesuicidekidnappingghostfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of mother β¦insanityabductiontraumafear of water (See All) |
Mood: | gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore |
Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
Characters: | father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β¦serial murderer (See All) |
Period: | 2000s |
Story: | demonic possessioncomavirginfoot chasedemonsurprise endingphotographbloodcharacter name in titleviolencesequelflashbackexplosionpartypistol β¦showerfirevoice over narrationdreamcorpseblood splatterslow motion scenebrawlfalling from heightmaskcar crashdecapitationstabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialogueprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the airragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countcharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β¦ you? (Read More)
Subgenre: | independent filmcult filmslasher flickteen movieteen horroramerican horrorindependent horror |
Themes: | evilmurderrevengesurrealismfuneralpsychopathsupernatural power |
Mood: | gorehigh schoolnightmareavant gardeslasher |
Locations: | cemeterybathtubpolice station |
Characters: | husband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain β¦serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | hangingfoot chasedemonmirrorsurprise endingbare chested malebloodviolencecigarette smokingdreamcorpseblood splatterface slapslow motion scenearrest β¦falling from heightbedjailclassroomtelephonesubjective cameragood versus evilstrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shotevil manstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int β¦ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
Subgenre: | supernaturaltragedymedicalparanormalteen movieteen horrorpsychological thrillerpsychological horror |
Themes: | deathfriendshiprevengesurrealismfeardrunkennessescapeobsessionsupernatural powerparanoiaredemptionguiltbullyingpanicchildhood β¦near death experienceafterliferegret (See All) |
Mood: | nightmarehorror movie remake |
Locations: | hospitalbarswimming poolsnowmotorcyclebathtubbusnightclubwaterelevatorapartmentrooftopyacht |
Characters: | mother daughter relationshipafrican americandoctornursesecurity guardprofessorcrying baby |
Period: | 2000s2010s |
Story: | loss of sisterdeath of sisterpower outagecell phonesurprise endingknifebare chested maleone word titleflashbackkissinterracial sexshowerdreamcorpsecar accident β¦remakerescueslow motion scenefalling from heightsunglassescar crashpianohallucinationreference to jesus christsubjective cameraswimmingflashlightdeath of friendmontagebridgeapologyunderwater scenevoice overflash forwardlibrarydangerprologuefantasy sequencecharacter's point of view camera shotrace against timecover updeath of childinjectiontragic eventbasementlaptoppremarital sextwenty somethingsyringeelectronic music scorehypodermic needleloss of friendmorguecaucasianaccidental deathwristwatchparking garageback from the deadhaunted by the pastresurrectionfalling to deathaerial shotalternate realitydark pastlightmoral dilemmabullet timetext messagingmale objectificationstabbed in the handscene before opening creditsold flamebroken mirrordomineering motherhearing voicesmedical studentraveexperiment gone wronghigh techtragic pastcamera phonetaking off clothesmedical doctorpsychotronic filmbulldozercar rolloverhedonismscience runs amokwhite coatjellyfishflickering lightmedical experimentbritish actor playing american characterrubik's cubepagerwalking stickhouseboatscientific experimentguilty consciencedefibrillationdefibrillatorout of body experienceyear 2017inside the mindseeing dead peoplevirtualitybrain scancompetitivenessparanormal phenomenonreference to jesusside effectcyberbullyingremake of cult favoritemedical sciencemedical scannercar falling off a bridge (See All) |
A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old β¦televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)
Subgenre: | supernaturalfound footage |
Themes: | evilmurderdeathghostdrunkennessdeceptionsupernatural powerhome invasionreligious cult |
Mood: | goredarknessone night |
Locations: | barforestroad triplakemotel |
Characters: | husband wife relationshipzombiealienkillerghost in mirror |
Period: | year 1998 |
Story: | looking at self in mirrortelevisiondemonknifebare chested malebloodfemale nuditymale nudityviolencefemale frontal nuditymale frontal nuditymale rear nuditysex scenefemale rear nudity β¦female full frontal nuditytitle spoken by charactermale full frontal nuditylesbian kisstopless female nuditycorpserescuesubjective cameradecapitationhalloweenflashlightgangvideo camerathroat slittingimpalementcocainestabbed to deathsevered headritualanthologylooking at the cameratalking to the cameraskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love youhaunted houserevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmenthandheld cameraone daytitle at the endknife throwingcastrationlens flareabbreviation in titlecharacters killed one by onefortune tellermarijuana jointblood on camera lenswoman cryingwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All) |
A teenage girl, trying to enjoy her birthday, soon realizes that this is her final one. That is, if she can figure out who her killer is. She must relive that day, over and over again, dying in a different way each time. Can she solve her own murder?
Subgenre: | black comedyslasher flickteen horror |
Themes: | murderdeathsuicideinfidelityjealousyextramarital affairtime travel |
Mood: | slasher |
Locations: | hospitalcar explosioncar on fire |
Characters: | suicide by hanginghomosexualfather daughter relationshipmother daughter relationshipdoctorfemale protagonistpolice officerserial killerkillersecurity guardteacher student relationshipslasher killerteacher student sexpolice officer taken hostage β¦blonde asianasian girlteacher student affairsex with a studentasian boybaby mask (See All) |
Story: | falling out a windowalarmfoot chasecell phonesurprise endingknifebloodfemale nudityviolencemasturbationgunkissfemale rear nudityexplosionparty β¦chasethree word titlecryingshot to deathmaskbirthdaycollegef wordthroat slittingstabbed to deathdinerstabbed in the chestexploding carpolice officer killednews reportpublic nuditymini skirtbaseball batcollege studentamerican flagstalkingmurdererlove interestarsonbirthday cakecloseted homosexualcrying womanflatulenceteddy bearparking garagefemale killermasked manstealing a carmobile phoneplot twistblack brahit on the headtitle at the endalternate realitycasual sexcharacters killed one by oneglobal warmingmasked killerholding handsprequelparking lothit with a baseball batleather jacketserial murderfinal showdownhiding in a closetrepeated scenetwist endingsuit and tieblonde womanmini dresstelevision newsfemale friendshipyoung womanescaped convictsororityfriendship between girlspartial female nuditybaseball capshort skirtfemale villainmercedes benzcollege campusmusic boxmasked villainfart jokevending machinepsychotronic filmtime loopgrindhouse filmyoung adultmurder victimsurprise partyred herringknife held to throatdeja vudriver's licensealternate timelinemystery killerdyed hairmultiple outcomesfemale studentdoctor's officein the closetescaped prisonerrepeated eventdorm roomcupcakeco edhospital gowntime warpdead teenagerrun over by a carhit by a bustime travelercar alarmgay pornhorror iconbare midriffcheating on wifehanged by the necksurprise birthday partybell towermiddle fingerdisco ballcurly hairmarried mandying repeatedlypower cutpointing a gun on someonebirthday cardhighway patrolsorority houseblowing out candles on a birthday cakesorority girlcollege roommatedeath in titleman murders a womanteacher student romancehooded sweatshirtreference to harry houdinishooting a womanmontage with pop songempty gunlong haired mancake in the facesmashing a car windowblowing out a candlehair curlerschocolate milksmashing a windowstood uptrapped in a time loopbloody knifemobile telephonereference to janis joplinrunning mascaracutting own hairloose womanshort dresskilled on birthdaysetting a car on firehead traumapoisoned to deaththroat slitwhite boardhit on the head with a hammeropening creditspoisoned foodreliving the pastfemale flatulenceknife held to someone's throatbirthday candleboarded up windowpulled over by policekiss on the neckpushed through a windowthe morning afterarizona desertfemale college studenthair curlernight walkreference to ghostbusterscrush on teachereternal recurrenceknife held to one's throatthrown against a wallfat shaminggirl in jeopardyhalter topreference to bill murraywalking alone at nightwatching a gay porn videowatching gay porn (See All) |
John Constantine is approached by Det. Angela Dodson who needs his help to prove that her twin sister Isabel's death was not a suicide. The dead woman was a devout Catholic and Angela refuses to accept she would have taken her own life. She's asked Constantine for help because he has a reputation fo β¦r dealing with the mystical. In fact, he is a demon hunter whose sole purpose on Earth is to send demons back to the nether regions. John himself has been to Hell and knows that he is destined to return there on his death - but hopes his good deeds may find him a place in Heaven. As he looks into Isabel's death, he realizes demons are trying to break through to the human world, and his battles lead him into a direct conflict with Satan. (Read More)
Subgenre: | cult filmsuspensesuperherosupernaturalchrist allegorychristian horror |
Themes: | murderdeathsurrealismsuicidereligiondrunkennessinvestigationdeceptionsupernatural powercancerredemptionself sacrificedevilnear death experienceunlikely hero β¦the devilreligious faith (See All) |
Mood: | nightmaredarkness |
Locations: | hospitalbarswimming poolcarlos angeles californiabathtubbusnightclubwatertaxiapartmentmexicotaxi drivercatholic church |
Characters: | sister sister relationshippolice officerdetectivepriesttough guywarriorreference to godchristianitypolice detectivebiblecatholicself mutilation |
Period: | 2000s |
Story: | demonic possessionpower outagedemonmirrorsurprise endingknifebare chested malebloodone word titleflashbackguncigarette smokingtitle spoken by characterchasepistol β¦corpseshot to deathshot in the chestshotgunslow motion scenepunched in the facecatfalling from heightbookbased on comicshowdownheld at gunpointdead bodyhallucinationshot in the backgood versus evilflashlightbased on comic bookcaliforniaambulancedinerweaponanti heroone man armyhit by a carvandrowningconfessionsmokingcharacter repeating someone else's dialoguebeaten to deathelectrocutionpossessionangelstorytellingcrossexploding bodyautomobilebasementpolicewomanratdirectorial debuthandgunobscene finger gesturetwinbased on filmsacrificepsychicsubtitled scenestrong female characterterminal illnessprivate detectivesisteroccultgoldspearnipples visible through clothinggothiccomic booksurvivortied to a bedcrucifixmorguewristwatchclubback from the deadstealing a carlandscapecrossbowfight to the deathbroken glasstitle appears in writingreference to satanheavenscene after end creditsdark heroraised middle fingerasylumdc comicsexorcismfemale detectiveprivate investigatorsurprise after end creditsdrugged drinkalleycartoon on tvstabbed in the handmysticismhead blown offsuit and tiedual rolebroken mirrorburnt facehearing voicesfilm starts with textbowling alleywrist slittingburnt bodylighting a cigarettefemale police officerdumpsterblack catspitting bloodtwin sistercoughing bloodnight timepsychotronic filmbreaking through a doorelectric chairshot through a doorcut handelevator shaftholy waterzippo lightersurname as titlethrown from a carescaped mental patientbegins with textluciferdecomposing bodycrushed by a carelectroshock therapylifted by the throatbrass knuckleshand through chesttwin sisterslung cancersevered faceboiler roomvoodoo dollwoman in a bathtubfallen angelactress playing male rolepsychiatric wardlucid dreammiddle fingernazi flagsplit lipindoor swimming poolhare krishnathrown through a wallmelting facehalf breedjumping off a roofsprinkler systemdrinking watersplit headglass shardreality vs fantasychain smokinghead held underwaterdemon huntergood deedasking for helpfire sprinklerlast ritesleg blown offstopped timeguessing gameblowing smoke in someone's faceholding one's breath underwatervertigo comicsdripping waterelectroconvulsive therapyangel wingsone actress for twin sisterscrushed carfemale police detectivelighting someone's cigarettedeserted townshock therapyfalling into a pooljumping into a pool with clothes onfalling through a glass roofjammed guninsect attackfalling glassfloating in the airinsect swarmmotor carwhistling kettlemortal sinoccult detectivewalking on the ceilingcough medicinereflection in a rearview mirrorspear of destinyarchangel gabrielface blown offin bathtub with clothes onreligious womandropping deadfalling into poolheaven vs hellmelting womansetting off a sprinkler systemfriend killedid braceletwinged demon (See All) |
It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k β¦illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)
Subgenre: | independent filmcult filmslasher flickamerican horrorholiday horror |
Themes: | evilmurderpsychopathpanic |
Mood: | goreslasher |
Locations: | schoolcarsmall townpolice stationrooftop |
Characters: | sister sister relationshipteenagerteenage girlgirlserial killerslasher killermysterious villaincrying girl |
Period: | 1980syear 1988 |
Story: | alarmpower outagecomasurprise endingknifebloodcharacter name in titlenumber in titlesequeldoggundigit in titleshot in the chestfalling from heightmask β¦numbered sequelsubjective cameragood versus evilhalloweenflashlightambulancethroat slittingimpalementanimalpart of serieshit by a carpolice officer killedelectrocutioncharacter's point of view camera shotevil manhalloween costumemaniacpickup truckfalling down stairslifting someone into the airfourth parthitchhikingrampagepump action shotgunchild's point of viewseven word titlemanhuntatticbody countcharacters killed one by onekilling spreemasked killerpsycho killerdead dogserial murderpsychopathic killermadmanreturning character killed offhuman monstertrick or treatinghomicidal maniacelementary schoolteasingkiss on the lipsmatchillinoismasked villainknife murderoff screen murdermurder spreevillain not really dead clichecrime spreeescaped mental patientlifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecesmall town sheriffmichael myerschild murdererlifting male in airscarred facehalloween prankboogeymandeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldjumpsuitthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrailer narrated by don lafontainetrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowoctoberkilling the wrong personteenager in dangersanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclefoster sistergirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | independent filmcult filmpsycho thrillerslasher flickteen movieteen horroramerican horrorholiday horror |
Themes: | evilmurderdeathfearcorruptionpsychopathparanoiamurder of family |
Mood: | high schoolnightslasher |
Locations: | carsmall towncar theftkitchen knife |
Characters: | husband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirlserial killerlittle girlkillerlittle boyvillainpsychiatristterrordoctor patient relationship β¦slasher killerserial murderer (See All) |
Period: | 1970s1960syear 1963year 1978 |
Story: | falling out a windowbabysittingdead woman with eyes openbabysittertelevisionsurprise endingknifefemale nuditynudityviolenceone word titledogguncigarette smokingtitle spoken by character β¦shot to deathblood splattershot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelephonesubjective cameragood versus evilhalloweenstrangulationstabbingthroat slittingstabbed to deathchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shotevil manhalloween costumelong takestalkingmurdererfirst parthandgunkillingmaniacpot smokingteen angstbulletelectronic music scorelifting someone into the airmutilationstabbed in the stomachblockbusterpsychogrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endbody countkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killerbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorecarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessmurder spreevillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Subgenre: | found footageparanormal |
Themes: | pregnancymurdersuicideinfidelityghostsupernatural poweralien abduction |
Mood: | gore |
Locations: | hospitalswimming poolforestlakemotelwater gun |
Characters: | doctorbrother sister relationshipzombiealienself mutilation |
Story: | looking at self in mirrorfoot chasedemoncell phonebare chested malebloodfemale nuditymale nuditysequelfemale frontal nudityinterviewmale frontal nuditydogsex scene β¦male full frontal nudityexplosionpistolshot to deathblood splattershot in the chestshot in the headshotguncar crashbathroomshot in the backsubjective cameragay slurvideo camerathroat slittingstabbed to deathcultno opening creditschild in perilhit by a carbirthday partybreast fondlingspaceshipunderwater scenecreatureanthologydrowningpoint of viewpoisoncharacter's point of view camera shotmissing persondeath of childcollege studentprankexploding bodylaptopneck breakingcharacter says i love yousubtitled sceneufoundeadprivate detectivekilling an animalbarnnosebleedsevered handcovered in bloodteddy beareaten alivepump action shotgunmale masturbationsurveillance camerasevered fingerstabbed in the throatstabbed in the neckfalling to deathdisembowelmenttitle at the endeye gougingraised middle fingerstabbed in the eyelens flarehit with a baseball batblood on camera lensintestinesvideo tapehead blown offurinehead bashed inrazorplaying a video gamevhsshot through the mouthcrowbarcommunepeep holevcrdocumentary crewsleeping bagthroat rippingmedical experimentstrobe lightnational parkcult leadercyclistfemale vomitingbitten on the armghost childslumber partyvhs tapeburnt handimplantmass suicidevomiting bloodsleepoverhit on the head with a rockbitten in the facefinger bitten offbox cuttermountain bikingjaw ripped offcompoundwater balloonbitten on the legsleeping in a bathtubbarbecue grillhelmet camerahollywood hills (See All) |
A girl is mysteriously killed after recording herself playing with an ancient Ouija Board, which leads to a close group of friends to investigate this board. They later find out that some things aren't meant to be played with, especially the 'other side'.
Subgenre: | supernaturalparanormal activity |
Themes: | evilmurdersuicideghostfearfuneralinvestigationdeceptionsupernatural power |
Mood: | high schoolslasher |
Locations: | swimming poolbathtubwheelchair |
Characters: | sister sister relationshipteenagerfriendboyfriend girlfriend relationshipwaitressdeath of girlfriendbest friendsghost girl |
Period: | 2010s |
Story: | power outagemirrorcell phonesurprise endingphotographbloodone word titleflashbacktitle spoken by charactertelephone callwritten by directorbathroomflashlightdeath of frienddiner β¦no opening creditsdrowningcharacter repeating someone else's dialoguecharacter's point of view camera shothigh school studentdarkbasementhaunted housesisterspiritfireplaceelectronic music scoregroup of friendsloss of loved onemental institutiontitle appears in writingstairsatticshadowtitle at the endcharacters killed one by onebased on toyclose up of eyeslevitationclosethiding in a closetseanceevil spirityoung version of charactermediumouija boardphone callboard gamepsychotronic filmclose up of eyechristmas lightsbreaking a mirrorgrindhouse filmspiritualismevil childdeath by hangingflickering lightbased on gameghost childwoman in a wheelchairdead teenagerouijamidnight moviestartledfurnacehanged girljump scaremouth sewn shutblack and white photographcommunicating with the deadprimal screamopening credits (See All) |
In DELIVER US FROM EVIL, New York police officer Ralph Sarchie (Eric Bana), struggling with his own personal issues, begins investigating a series of disturbing and inexplicable crimes. He joins forces with an unconventional priest (Edgar Ramirez), schooled in the rituals of exorcism, to combat the β¦frightening and demonic possessions that are terrorizing their city. Based upon the book, which details Sarchie's bone-chilling real-life cases. (Read More)
Subgenre: | suspensesupernatural |
Themes: | evilmurderdeathsuicidekidnappingfearpsychopathhome invasionpolice brutalitypolice investigationmurder of a police officer |
Mood: | rainneo noir |
Locations: | new york citybardesertelevatorapartmentpolice stationcavetunnel |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshiptattoopriesthostagepolice detectivebiblecatholicpolice chaseself mutilationpregnantcatholic priestpregnant wifepolice sergeant β¦self cannibalism (See All) |
Period: | year 2010year 2013 |
Story: | demonic possessionpower outagefoot chasecell phonesurprise endingknifephotographbare chested malebloodflashbackdogcigarette smokingpistolbased on true storybeating β¦corpseshot to deathblood splattershot in the chestslow motion scenepunched in the facewritten by directorbattlearrestheld at gunpointinterrogationpianohallucinationhandcuffsflashlightaxestabbed to deathstabbed in the chesttied to a chairsnakeno opening creditspainterchild in perilpolice officer killedconfessioncharacter repeating someone else's dialoguebeaten to deathcharacter's point of view camera shotdeath of childlightningbasementthreatened with a knifemonkeychild murdermachismofalling down stairswhat happened to epiloguegothictape recordersecurity camerawalkie talkiecrucifixcovered in bloodanimal attackbroken legiraqmental institutioncrime scenehaunted by the pastitalian americanpartnerpool tablezoofalling to deathaquariumtime lapse photographylionjumping through a windowassault rifleknife fightbulletproof vesttough copbody landing on a carraised middle fingerabusive husbandexorcismbatbaptismplaying poolpistol whipspiral staircasenight visionhearing voicescatholicismlatinstrait jacketbleeding to deathtwo way mirrorsome scenes in black and whiteoverhead camera shotcarouseldead catbronx new york citypool of bloodwanted posterfinger gunhatchetsurveillance footageholy waterinfanticideescaped mental patientex marineexorcistdiscovering a dead bodycrossword puzzleflickering lightbloody facewriting in bloodbandaged handnypdu.s. marinestabbed in the sidechild killerdead babyfire fightwriting on a wallthick accentbitten on the armrottweilerdeath of partnerbad smellnight cityscapewalking in the rainjack in the boxsoccer gamefoaming at the mouthhandcuffed to a pipehearing noisesnight vision binocularshyenairaq veteranattacked from behindstaticdriving in reverseeating an applereference to jim morrisonbiting someonebitten on the legrecovering drug addictdishonorable dischargefalling on a carreference to the doorsafrican lionhome aquariumsecurity videosome scenes in muted colorbandaged armbrown bearwriting on a bodymale african lionhandcuffed to a chairlooking under a bedreference to the addams familygray tabby catswarm of batsreference to larry birdsymbol cut into skinblack mamba (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | independent filmmartial artscult filmblack comedysuspensesupernaturalparanormalamerican horror |
Themes: | evilmurderrevengefuneralpsychopathsupernatural power |
Mood: | gorerainhigh schoolnightmareslasher |
Locations: | hospitalbeachcemeterysmall townelevatorschool nurseblood in water |
Characters: | father son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshipserial killertough guylittle girlwaitresskillervillainterrorslasher killerserial murderer |
Period: | 1980s |
Story: | looking at self in mirrordemonsurprise endingphotographbare chested malebloodnumber in titlesequelfemale frontal nuditydogcigarette smokingfiredreamcorpsedigit in title β¦blood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequelambulancedeath of friendstabbed to deathdinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armsleepingkillingundeadpizzamaniacsurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherbroken armkilling spreepsycho killerserial murdervillain played by lead actorpsychopathic killerbad guyreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spirithomicidal maniacbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimmurder spreetime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
When a gang of masked, ax-wielding murderers descend upon the Davison family reunion, the hapless victims seem trapped... until an unlikely guest of the family proves to be the most talented killer of all.
Subgenre: | black comedyconspiracyslasher flickdeadpan comedy |
Themes: | murderdeathdeceptionpsychopathdeath of fatherdeath of motherhome invasiondeath of wifepanicinheritance |
Mood: | goreslasher |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipserial killeraustralian |
Story: | looking at self in mirrordeath of sisterfoot chasecell phonesurprise endingknifebare chested maleviolencebare breaststwo word titlecigarette smokingtopless female nuditycorpseshot to deathblood splatter β¦slow motion scenepunched in the faceneighborshot in the backflashlightwineaxemansionthroat slittingimpalementstabbed to deathstabbed in the chestno opening creditspolice officer killedshot in the foreheadargumentcharacter repeating someone else's dialoguebeaten to deathstabbed in the backcollege studentshot in the shoulderdeath of brotherbasementtrapclaim in titlefireplaceheroinemachetefaintingcovered in bloodmasked mancamera shot of feetcrossbowstabbed in the neckdark humorkicked in the crotchtitle appears in writingstabbed in the headsibling rivalryjumping through a windowthrown through a windowbooby traptitle at the endstabbed in the eyeaxe murdercharacters killed one by onearrowmasked killermale in showerclose up of eyesman cryingshot through a windowwoman cryingfamily reunionbroken windowstabbed in the armhired killerhead bashed inwoman in bra and pantiespatricidecrashing through a windowman punching a womancollege professordeath of boyfriendstabbed in the shoulderstabbed in the facehiding under a bedmasked villainmatricidefilm starts with sexbloody violencebutcher knifesole survivorwedding anniversaryflash camerafratricideleg woundsaying gracethroat cutbrickwoman wearing black lingeriejumping out a windowwoman punching a manstabbed multiple timeswriting in bloodstabbed in the footbig familybitten handrich familystartledloud musichit with a frying panmale in a showerno cellphone signalcleaversurvivalistblenderthrown through a glass doorfacial cutfamily portraithit in the throatstabbed with a screwdrivervictim invited to dinnervicodinclotheslinedvictim fights backpiano wirestabbed with a glass shardlooking under a bedstepping on a nailbreaking a lightbulb (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Subgenre: | independent filmcult filmsuspensefairy talepost modernpsychological thriller |
Themes: | murderdeathsurrealismkidnappingfearescapefuneralmonsterfilmmakingdeceptiondeath of fatherbrutalitysupernatural powerparanoiacourage β¦near death experience (See All) |
Mood: | gorenightmareslasher |
Locations: | hospitalswimming poolcarcemeterylos angeles californiawaterwheelchairtrucksinging in a cartruck accident |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboypolice officerserial killernurseactorpriesthostageactresssecurity guarddirectormaid β¦film directorself referentialcoroner (See All) |
Period: | 1990s |
Story: | demonic possessionbabysitterfoot chasetelevisiondemoncell phonesurprise endingknifebloodviolencesequelinterviewexplosionchasefire β¦dreamcorpseblood splattercar accidentblonderescueslow motion scenefalling from heightpaintingvomitingshowdownsunglassesrunningbedcar crashhallucinationtelephonegood versus evilambushcaliforniastrangulationmansionstabbingdeath of friendwidowstabbed to deathstabbed in the chestsnakebrunetteno opening creditsdream sequencechild in perilhit by a cartonguenews reporttransformationcoffeeparkattempted murderlimousinestalkercharacter repeating someone else's dialoguescreamingperson on firecharacter's point of view camera shotactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarinjectionstalkingfilm within a filmexploding bodydeath of husbandneck breakingactor playing himselfanswering machineburned aliveelectronic music scorewoundhypodermic needleslow motioninjurylifting someone into the airmorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundstabbed in the throatmovie setstabbed in the legfilm settitle at the endalternate realityeye gougingdisfigurementstabbed in the eyefemale doctorfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectshiding in a closetstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
Themes: | murderdeathsurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigationangercorruptionpsychopath β¦death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
Mood: | gorenightslasherdarkness |
Locations: | hospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car β¦cityitalytruck (See All) |
Characters: | homosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlserial killerpolicemanmusicianactress β¦killervillainpsychiatristmaidprofessorjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All) |
Period: | 1970s |
Story: | falling out a windowraincoatdead woman with eyes openhangingvirgintelevisionmirrorsurprise endingknifephotographbloodviolenceflashbacktwo word titlegun β¦kisscigarette smokingsingingchasetelephone callfiresongshootoutbeatingcorpseblood splatterface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelephonereportersubjective cameradecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxestabbingimpalementstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibrarydangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastbody countfemale reportergay stereotypeliving roomcharacters killed one by onekilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingsteamwife murders husbandfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo β¦od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
Subgenre: | ghost storyparanormal activity |
Themes: | evilpregnancymurderdeathfriendshipsuicidereligionghostweddinginvestigationpsychopathsupernatural powerhome invasioncrueltytrauma β¦self sacrificedevilpolice investigationnear death experience (See All) |
Mood: | nightdarknessmoving |
Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
Characters: | husband wife relationshippoliceafrican americanfrienddoctorfemale protagonistnursedetectivepolicemanbabypriestchristianreference to godlittle girlkiller β¦christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
Period: | 1970syear 1969year 1970 |
Story: | demonic possessionnonlinear timelinefoot chasedemonknifephotographbloodf ratedcharacter name in titleviolenceone word titleflashbackfighttitle spoken by characterchase β¦based on true storytelephone callfirecryingshot to deathblood splattershot in the chestslow motion scenepunched in the facewatching tvcamerashootingbookneighborhallucinationreference to jesus christgood versus evilflashlightname in titlestabbingthroat slittingsuicide attemptcultnunno opening creditsdrawingchild in perilritualnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollbaseball batscreamscargiftbasementhaunted housesacrificegraffitiblood spattercouplerecord playeroccultspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisithometaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaleblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voicesfilm starts with textlistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womanbechdel test passedsymboltraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their β¦ dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | independent filmcult filmsupernaturaldark fantasyurban fantasy |
Themes: | pregnancymurderdeathrevengesurrealismkidnappingbetrayalfearescapedeceptionextramarital affairangerbrutalitysupernatural powerdeath of mother β¦paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All) |
Mood: | gorenightdarkness |
Locations: | trainswimming poolairplanebathtubelevatorurban settingapartmenttruckrooftoprussiatunnelyachtfire escape |
Characters: | father son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherlittle boywitchrussian β¦pregnant womanself mutilation (See All) |
Period: | 2000s1990s20th century21st centuryyear 1992 |
Story: | power outagevirginfoot chasecell phonesurprise endingknifephotographbare chested malebloodfemale nuditybased on novelviolenceflashbackdogtwo word title β¦female rear nudityfighttitle spoken by characterexplosionchasevoice over narrationbeatingcorpseblood splatterhorserescueslow motion scenepunched in the facebattleswordarrestbrawlbare buttshowdownsunglassesneighborsubjective cameradecapitationgood versus evilflashlightsword fightambushconcertaxebridgearmyimpalementstabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguedangerstabbed in the backprologuescreamingcharacter's point of view camera shotmissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetlifting someone into the airexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingpsychotronic filmimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All) |
Two young rebellious scientists are told by their employers to halt groundbreaking work that has seen them produce new creatures with medical benefits by splicing together multiple organisms' DNA. They decide to secretly continue their work, but this time splicing in human DNA.
Subgenre: | black comedypost moderncreature feature |
Themes: | pregnancymurderdeathloveinfidelityrapedrinkingmonstermemoryseductiondysfunctional familyunfaithfulnessillnessfather daughter incest |
Locations: | apartmentfarmrooftoplaboratorysex in barn |
Characters: | mother daughter relationshipboyfriend girlfriend relationshipdoctorbrother brother relationshipdancerbabe scientistfemale scientistpregnant from rapefather daughter dance |
Period: | 2000s |
Story: | looking at self in mirrormale underwearmirrorcell phonephotographbare chested malebloodfemale nuditynuditymale nudityviolenceone word titlefemale frontal nudityflashbackmale rear nudity β¦sex scenedancingfirewoman on topunderwearsex on couchblood splatterfoodface slapcomputercatdrinkbare buttvomitingbeddead bodyscientistf wordsubjective cameraflashlightstrangulationmontageeatingimpalementbirdcreaturesearchvanflash forwardmicrophonedollknocked outrabbitspeechchildbirthrecord playerpizzaexperimentnerdsyringekilling an animalhypodermic needlelistening to musictape recorderrecordingred dressdiseasebarncaught having sexpatientloss of loved onesex on floorcovered in bloodburialambitionbroken glasshit on the headjumping through a windowautopsymother son incestbonfiretank toploss of brotherfast motion scenemotherhoodearphonesabandoned housepredatorgenetic engineeringsex changednaepilogueexperiment gone wronghit with a shovelsuperhuman strengthgeneticsdead catfully clothed sexparentingcloningfetusscience runs amokextreme close upphonographinfanticidedance lessonwingsbaldnessfemale executivecuriosityapple computercaught in the actmissionary positionmoral ambiguityanimated opening creditsinterspecies sexincest overtonesgender benderhazmat suitbreaking glasstiaraconvulsionloss of boyfriendhit with a rockchildhood homeeroticismbarbie dollscience experimentcanuxploitationpharmaceutical companykilling a catblue dressshallow graveuncertaintyreference to fred astaireforce feedingmonster rapeincest rapebald womanhormoneliquid nitrogensecret experimentskylightlecture presentationsecret projectstrained relationshipheadbangerhalf humanumbilical cordreflection in eyecowboy sex positionmedical ethicsspontaneous sexpatentupside down viewplaying godrapid agingreference to ginger rogersbiotechnologynews conferenceamphibianethical dilemmapants pulled downhuman cloningsentiencespecimenleakchimeradry humparm in a slingproteinnecklace yanked offhead smashed with a rocknature run amokabusive childhoodblurred boundariesdress ripped offhouse catmutant humanbiochemistbiochemistryclimbing on a roofstingerabandoned farmhousegenetic testingmaternal instinctmaternity revealedupward camera shotuncertain futurebioethicscommercializationdead body in a treehuman hybridimprintingnitrogensurrogate parentabandoned farmaccelerated growthcrashing through a skylightregenerated limbsex with monstertylenolgenetic mutant (See All) |
Subgenre: | independent filmmartial artssuspenseconspiracycorporate conspiracy |
Themes: | murderdeathrevengesuicidekidnappingbetrayalfearescapeinvestigationdeceptionangerbrutalityparanoiasurveillancepanic β¦artificial intelligence (See All) |
Mood: | car chase |
Locations: | forestwoodskitchenfarmlakelaboratoryresearch station |
Characters: | suicide by hangingboyfriend girlfriend relationshipdoctorhostageinterracial relationshippsychiatristchinesebabe scientistfemale scientistgeneticist |
Period: | near future |
Story: | foot chasemirrorcell phonesurprise endingknifebare chested malebloodcharacter name in titleviolenceone word titleinterviewflashbackfighttitle spoken by characterchase β¦pistolshowerbeatingcorpseblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facecomputercamerabrawlshowdownrifleheld at gunpointhand to hand combatbedinterrogationriversciencekung fuscientistshot in the backf wordbedroomassassinambushstrangulationdeath of friendimpalementstabbed to deathmixed martial artsdinerstabbed in the chestman with glassesdisarming someonedouble crossdrowningshot in the foreheadlatex glovesattempted murdertreecharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backkaratesuitcasecover upknocked outkicked in the faceshot in the shoulderinjectionisolationlaptopneck breakingsuspicionthreatened with a knifedirectorial debutsubtitled scenetrustfalling down stairssabotagerevelationhead buttelectronic music scorehypodermic needlelooking at oneself in a mirrorcatfightmutantjoggingcooksecurity camerabeardkicked in the stomachpsychologistcompassionfemale killerandroidpresumed deadfull moonrampagestealing a carblood on facefight to the deathgash in the facestabbed in the neckevacuationpunched in the chestaerial shotdeerstabbed in the eyefemale doctorpiertied feetcorporationmutationcharacters killed one by onekilling spreeclonestick fightmoral dilemmasouthern accentimprisonmentclose up of eyesfemale assassinforename as titlefinal showdownpistol whipsuper strengtheuthanasiaabandoned houseyoung version of characterbunkerstabbed in the armclimbing through a windowhired killergenetic engineeringmercy killingwoman kills a mandeath of boyfriendexperiment gone wrongfilmed killinghigh techmysterious womangeneticsdistrustcloningimprovised weaponunwanted kisslocked in a roombroken necksolitary confinementscience runs amokbilingualisminnocent person killedsurveillance footagebitten in the throatwoman's neck brokendeoxyribonucleic acidthroat rippingcorporate executivebritish actor playing american charactermanor househumanoidvideo recordingtranquilizer dartsuper soldierhybridlethal injectionscience experimentsecret laboratoryhunting rifleprototypehead held underwaterresearch facilitysmothered to deathhooded sweatshirttranquilizer gunstabbed with a pencar crashing into a treebloody hand printkilling a deerbehavioristmutant humanbody in waterstrapped to a bedwoman kills a womanrisk management (See All) |
Renai is interrogated by a police detective about the supernatural events in the house. While the police investigate the house, the Lambert family temporarily moves to the old house of Lorraine Lambert. Renai is haunted by a woman in white and Josh has a strange behavior at home. Meanwhile Lorraine β¦seeks out Elise's partners Specs and Tucker expecting to find answers. (Read More)
Subgenre: | supernatural |
Themes: | murdersuicideghostinvestigationpsychopath |
Mood: | nightmare |
Locations: | hospitalpolice station |
Characters: | husband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipboyserial killerbabypolice detectivegrandmother grandson relationship |
Period: | 1980syear 1986 |
Story: | nonlinear timelinefoot chasedemonsurprise endingknifephotographnumber in titlesequelflashbackcorpseface slappunched in the facesecond partinterrogationpiano β¦flashlightbound and gaggedstrangulationvideo camerachild abusechild in perilcharacter repeating someone else's dialoguepossessionevil manknocked outbasementhaunted housecross dressingmaniacsyringescene during opening creditsgas maskstabbed in the legthrown through a windowtitle at the endfemale doctordark pastlanternnewspaper clippingmannequinhit with a baseball batclose up of eyesbad guyfire extinguisherapparitiontaserhiding in a closethuman monsterseanceevil spiritpiano playinghomicidal maniacyoung version of characterwhisperingmediumvhshit with a hammerdicebreaking through a doorvcrabusive mothertoothhidden roomdollhousered lightgrand pianovhs tapestartledhit with a frying panwearing a sound wireout of body experiencetranquilizerbaby monitorlucid dreamabused childabandoned hospitalrocking horsemetronomeimposterbookcasebone sawbreaking through a wallother worldtea kettleattacked with a knifetooth ripped outboy dressed as a girlfalling chandelierwooden chestsurgical tooltalking dollpipe wrenchmoving furniturestabbed with a needletooth falling outbarricading a doorroshambo (See All) |
The hacker Josh invades the computer of Douglas Ziegler, who is developing a powerful wireless signal, and accidentally releases a mysterious force that takes the will to live of human beings, generating a suicide epidemic and increasing the force. His girlfriend and student of psychology, Mattie, s β¦ees each one of their common friends die and the destruction of the modern world, and together with her new acquaintance Dexter, they try to plan a virus developed by Josh in the network to shutdown the system and save mankind. (Read More)
Subgenre: | suspensesupernaturalteen movieteen horrorpsychological thriller |
Themes: | deathsurrealismsuicideghostfearescapeparanoiaguiltsurveillanceapocalypsetechnologynear death experience |
Mood: | nightmarehorror movie remake |
Locations: | barhelicopterairplanebathtubbuselevatorapartment |
Characters: | boyfriend girlfriend relationshipsecurity guardpsychiatristprofessor |
Period: | 2000s |
Story: | looking at self in mirrorpower outagehangingdemoncell phonesurprise endingone word titleflashbacktitle spoken by characterfireremakecomputerfalling from heightbeercar crash β¦collegehallucinationsubjective camerasurvivaldeath of friendimpalementdinerinternetfalse accusationbathnews reportcoffeelibraryscreamingkeylocker roomfantasy sequencecharacter's point of view camera shotrace against timecollege studentscreamstalkinghandgunpizzaanswering machinevirussecurity camerapsychologyjumping from heightend of the worldinterracial friendshipsocial commentarymechanicalien invasionreverse footagestealing a carblack bratime lapse photographyairplane crashe mailduct tapealarm clockmedia coveragepostertext messaginggothdeadvideo surveillancelaundryohioepidemiceyecockroachevil spiritcomputer crackerportaltelevision newsrestroomlaundromatbubble bathcomputer hackerlandladydeath of boyfriendcampusfilmed killingmetal detectormaggotnewscastcollege campusopen endedparasitesome scenes in black and whitecar radiopsychotherapyoverhead camera shottapeexploding airplanepeep hole555 phone numberstairwellvolkswagen beetlecomputer virusdecomposing bodyrunning for your lifeflash drivevideo recordingstartledmass deathhanged by the neckinstructionconquestlaundry roompersonal computeruh 60 blackhawk helicopterinstant messagingdisintegrationlovecraftianbead curtainthe color redremake of japanese filmremake of asian filmcall for helplesionspecterhigh jumpsome scenes in sepiano cell phone signalriding buswashing laundrybounced checkapplying mascaracolor redbook bagdripping faucetlife force sucked outmap of united statespsychology classbehavior changeplead for helptransomwalking alone at night (See All) |
For nineteen-year-old Jay, Autumn should be about school, boys and week-ends out at the lake. But after a seemingly innocent sexual encounter, she finds herself plagued by strange visions and the inescapable sense that someone, something, is following her. Faced with this burden, Jay and her friends β¦ must find a way to escape the horrors, that seem to be only a few steps behind. (Read More)
Subgenre: | cult filmsupernaturalsupernatural horrorcult horror |
Themes: | evilmurderdeathfriendshipghostfearinvestigationvoyeurismsupernatural powerparanoiapanicsupernatural beingsupernatural rape |
Mood: | rainhigh schoolambiguous ending |
Locations: | hospitalbeachschoolswimming poolforestcarboatbicyclewaterwheelchairpolice carlakesex in carsex in hospital |
Characters: | sister sister relationshipteenagerfriendteenage girlprostituteteenage boyfemale protagonistneighbor neighbor relationshipsex with a strangersupernatural killer |
Story: | looking at self in mirrorfoot chasedemonphotographbare chested malebloodsexviolencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditytwo word titlesex scene β¦kissfemale rear nuditymale full frontal nuditychasepantiespistoltopless female nuditycorpseshot to deathblood splatterurinationshot in the headwatching tvwritten by directorbikinibookcar crashlow budget filmcafebathroomneighborvoyeurclassroommale pubic hairf wordsubjective camerabedroomflashlightbanddeath of friendhousetied to a chairwhite pantiesunderwater scenesearchshot in the legold womanpublic nuditycursedangersuburbelectrocutionknocked outcollege studentlightningstalkingautomobilethreatdatelove interestteenage sexcard gamegameelectronic music scorelooking at oneself in a mirrorsexual attractiongroup of friendsmovie theaterpooldesperationflatulenceswimsuitstrangervictimteenage protagonistpeeping tombroken leggirl with glassesvisiontarget practiceplaygroundthunderstormboyfriendswingtied feetbroken armliving roomneighborhoodchloroformbeing followedabandoned buildingsuffocationgirl in bra and pantiesinvisibilityporn magazineapparitionshot in the neckhead wounddetroit michiganreading aloudabandoned housebroken windowhospital bedswimming underwaterbreaking a windowhallwaycowgirl sex positionshot in the handfrightmenaceshape shiftertied up while barefoottalking about sexpsychotronic filmscaregrindhouse filmyoung adultoverhead shotsexual intercoursehit with a chairrunning for your lifefalse nameentityhead bandageloss of innocencetarget shootinggirl next doorsexually transmitted diseasemidnight movieporchnipple sliparm castindoor swimming poolwashing a carincest subtextconsequenceshape shiftingmotor boatsleep overmysterious personcollateral damagefootstepsguessing gamebare breastnear drowninghigh school yearbookneo 80schevrolet impalaopening creditstimelessnessdemonic presencesex horrordead woman on a beachdemonic entityelectric typewriterhorror movielounging on a beachtied to a wheelchair (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Subgenre: | tragedypsycho thrillerslasher flickamerican horror |
Themes: | evilmurderdeathsuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismhome invasionpolice investigationmurder of a police officer β¦mysterious death (See All) |
Mood: | goreslasherdarknessblood and gore |
Locations: | small townstrip club |
Characters: | teenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagekillervillainpsychiatristsheriffterrorslasher killerserial murderer |
Period: | 1970s |
Story: | loss of sisterbabysittinghangingtelevisionknifephotographbloodsexfemale nuditymale nudityviolencefemale frontal nudityfemale rear nudityfemale full frontal nuditytitle spoken by character β¦chasepistolwoman on topbeatingcorpseblood splatterremakeshot in the headfalling from heightmaskdead bodystrippershot in the backf wordsubjective camerastrangulationmassacrestabbingthroat slittingimpalementstabbed to deathstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball batshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplattermaniackilling an animalelectronic music scoremass murderlifting someone into the airrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbody countbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womankiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
Subgenre: | independent filmcult filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror |
Themes: | evilmurderdeathrapeghostdancesupernatural powersadismsupernatural rapebook of evil |
Mood: | goreslasherone night |
Locations: | forestcarwoodssinging in a car |
Characters: | friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism |
Period: | 1980s |
Story: | demonic possessiondemonsurprise endingbloodfemale nudityviolencekissthree word titlefireblood splatterremakeshot in the headshotgunwritten by directorshooting β¦booklow budget filmcollegeriversubjective cameradecapitationaxestabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegesexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | cult filmcoming of ageblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof |
Themes: | murderdeathfriendshiprevengeinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother β¦paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | goresatirehigh schoolslasherdarkness |
Locations: | forestsmall townwoodskitchenpolice stationschool bus |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistserial killervillainsheriff β¦single fatherslasher killerself referential (See All) |
Period: | 1990s |
Story: | power outagehangingvirginfoot chasetelevisioncell phonesurprise endingknifebare chested malebloodf ratedviolenceone word titlecigarette smokingtitle spoken by character β¦partychasepistolfirecorpseshot to deathblood splattercar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelephonef wordsubjective camerasurvivalflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkerdangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p β¦revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
Subgenre: | independent filmcult filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
Themes: | evilmurderdeathfriendshipsurrealismfeardrunkennessescapedancedeceptionvoyeurismbrutalitysupernatural powerparanoiaillness β¦sadismunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All) |
Mood: | gorerainnightavant gardeslasherdarknessstylization |
Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
Characters: | sister sister relationshipteenagerfrienddoctorboyteenage girlfemale protagonistteachergirlpolice officerstudentkillerpsychiatristprofessorwitch β¦germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
Period: | 1970syear 1977 |
Story: | dead woman with eyes openpower outagehangingfoot chasedemonsurprise endingknifebloodviolenceone word titleflashbackdogcigarette smokingdancingexplosion β¦chasetelephone callfirevoice over narrationcorpseblood splatterslow motion scenesecretfalling from heightshowdownbathroompianohallucinationvoyeurtelephonesubjective cameraswimminggood versus evilwineambushstrangulationstabbingdeath of friendthroat slittingimpalementstabbed to deathtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotmissing personcover upcollege studentlightningscreamdisappearanceinjectionsuspicionmurdererfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnessstabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.
Subgenre: | cult filmparanormal investigation |
Themes: | ghostvoyeurismsupernatural powerdysfunctional familyafterlifemissing childscience versus supernatural |
Mood: | moving |
Locations: | swimming poolcemeterykitchen |
Characters: | sister sister relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlgirlphotographerlittle girllittle boyemployer employee relationship β¦blonde girl (See All) |
Period: | 1980s |
Story: | real estatereal estate agenttelevisionmirrorone word titleinterviewpantiescorpseblondewatching tvcameralingeriemarijuananeighborhallucination β¦voyeurgood versus evilcleavagevideo camerahousewhite pantiesscantily clad femalecoffinchild in perilclownsuburbfirst of seriesskeletonhauntingfirst parthaunted houseobscene finger gesturecult directorpsychicgirl in pantiespot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamapparitionlegstornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieverlifting a female into the airsource musicparanormal investigatoranimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All) |
Jill Johnson is being forced to babysit at a BIG house all by herself for exceeding her telephone minutes. Then all of a sudden a stranger calls making these weird remarks. Jill decides to call the police to trace the call. Jill is freaked out when she finds out that the call is coming from inside t β¦he house! Jill runs in a hurry trying to get the children and leave. Will Jill make it out of the house in time? Will she live? Well you just have to watch the movie to find out! (Read More)
Subgenre: | suspensepsychological thriller |
Themes: | murderdeathfearescapeparanoiahome invasion |
Mood: | high schoolnightmarehorror movie remake |
Locations: | hospitalwoodsfire truck |
Characters: | husband wife relationshipfather daughter relationshipteenagerboyfriend girlfriend relationshipdoctorteenage girlpolice officermaid |
Story: | babysittingalarmbabysittercell phonesurprise endingknifecharacter name in titlechasefirecorpseremakeslow motion scenearrestfalling from heighthandcuffs β¦survivalstrangulationambulancedeath of friendmontagebirdchild in perilunderwater scenecharacter repeating someone else's dialogueperson on firehigh school studentchild murderfireplaceslow motionjumping from heightcarnivalmasked manbarefootgash in the faceaquariumone daybonfirestabbed in the handhiding in a closethair pullingclimbing through a windowcoloradoferris wheelpondfacial scarpsychological tortureblack catstupid victim555 phone numberfairgroundsecurity systemstopwatchdead body in waterlake housethreatening telephone callprank callfire pokertelephone terrorguesthousemental torturemysterious telephone callbased on urban legend (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | martial artscult filmcoming of ageblack comedysuspensesupernaturalheist |
Themes: | evilmurderdeathfriendshiprevengesurrealismsuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of father β¦supernatural powerparanoiasurveillancehome invasionpanic (See All) |
Mood: | gorenightmare |
Locations: | schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church |
Characters: | father daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest |
Period: | 2000s |
Story: | hangingfoot chasemirrorsurprise endingknifephotographbare chested malebloodsexcharacter name in titlenumber in titleviolenceflashbackgunfight β¦explosionpartylesbian kisschasepistoldreamcorpseshot to deathblood splatterfistfightshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalbedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightningsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
Subgenre: | independent filmcult filmsupernaturalpsychologicalpsychological horrorsupernatural thriller |
Themes: | murderdeathdrugsreligioninvestigationmagicincestmemorycorruptionsupernatural powerblackmailgamblingcannibalismamnesiadevil β¦murder investigationdeath of daughterfather daughter incest (See All) |
Mood: | goreneo noir |
Locations: | hospitalnew york citybarbeachrestauranttrainchurchhotelsnowbathtubbuselevatorfarmtrain station |
Characters: | father daughter relationshipdoctorsingerteenage girlsoldierserial killernursedetectivemusicianbabypriestlawyerinterracial relationshiplustpolice detective β¦biblemaidfrenchself discoverypolice arrestfather daughter sex (See All) |
Period: | 1950s |
Story: | looking at self in mirrorcomafoot chasedemonmirrorsurprise endingphotographbare chested malebloodcharacter name in titlebased on novelfemale frontal nudityflashbackmale rear nuditydog β¦two word titlesex scenefemale rear nuditycigarette smokinginterracial sexdancingnipplessingingpantiespistolcryingdreamcorpseshot to deathblood splatterfistfightcatwritten by directorvomitingtearsrunninginterrogationpianohallucinationrevolverrivermanhattan new york cityflashlightbracandleold manmansionbridgestabbed to deathdinertoiletstabbed in the chestsevered headnundream sequenceritualsearchgraveyarddrowningbartenderracial slurgunshotgravedrug addictmicrophonekeyuniformstatuemissing personscreamringscene during end creditspianistpursuitcountrysideglassesratstagechickenjazzprivate detectiveapplauseoccultidentityspiritkilling an animalhead buttbreaking and enteringcophypodermic needleeggtape recorderperformancemutilationpatientguitaristbuttocksmovie theatersevered handtimecovered in bloodnew year's eveaudiencebrooklyn new york cityparadeanimal attackpreachermental institutionwatching televisionfannew orleans louisianajunkiescene after end creditssuperstitiondisembowelmentheartblood on shirtchoirsoulrainstormcanecastrationpastorfortune tellervoodooblack magicmusic bandprivate investigatorposteratheistwoman in bathtubdrumsgarterbeing followedceremonyinvestigatorfountainbaptismlouisianaspiral staircasehorse racingperformerarcadeanimal crueltysatanismbroken mirrormaking outclinichearing voicesinterracial kissgramophoneshot in the eyelistening to radiowhistlingrazormarching bandafrican american womanstablecleaning ladyolder man younger woman sextimes square manhattan new york citycrabbettingritecrowbarmorphinesymbolheart ripped outhorse and wagoniconpentagramaltarprivate eyecut handmurder of a nude womankicking in a doorpart of the body in titletrenchcoatharlem manhattan new york citydeal with the devillockworld war two veteranstraight razortap dancingevil childgenital mutilationfuneral processionluciferphonograph recordshackstreetcarbody part in titlesatanic ritualincestuous sexdevil worshipcajunconey island brooklyn new york citydog bitenylonswashroomsouthern gothicafroelectric fananimal sacrificeblood on the floorcockfightyear 1955ice pickpriestesssoul transferencemarqueeherbincantationtarot cardsbloodstainoccult ritualmedicine cabinetfreight elevatorlost soulconey islandpit bullharlemfaustianjubilationscaldingpalm readerpick up truckfoot bridgeslumscongafather murders daughteroccult detective17 year old girlbongosposing as a doctorid tagsearch for selfbreaking a lockhoodoopoughkeepsie new yorkfaustian bargaingumboself search17 year old daughterfather kills daughter (See All) |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
Subgenre: | cult filmconspiracytragedyasian horror |
Themes: | deathlovefriendshipsurrealismsuicidebetrayalghostjealousypoliticsmemorybrutalityobsessionparanoiacancerredemption β¦guiltinsanitysexualitymental illnesstheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All) |
Mood: | rainnightmaredownward spiral |
Locations: | small townbuselevatorvillagewheelchairrooftop |
Characters: | suicide by hangingsister sister relationshipchildrenboyfemale protagonistnursedancerlove trianglestepmother stepdaughter relationship |
Story: | death of sistermirrorsurprise endingphotographbloodf ratednumber in titleviolenceinterviewflashbackfightcigarette smokingpunctuation in titlecryinghorse β¦remakelierunningdead bodyhallucinationcolor in titlenewspaperorphanflashlightstabbingmontagehouseaccidentdream sequencedrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicionhaunted housecult directorheroinhatechild murderchesssistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatpatientdemonstrationloss of loved onedrug abusecommunityhomehomicidepresumed deadmental institutionreverse footagesevered fingernostalgiamental hospitaldelusionscissorsbribemedicationblack brasibling rivalrydead childperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationdockcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All) |
The sixteen year-old aspiring model Jesse arrives in Los Angeles expecting to be a successful model. The aspirant photographer Dean takes photos for her portfolio and dates her. Jesse befriends the lesbian makeup artist Ruby and then the envious models Gigi and Sarah in a party. Meanwhile the agency β¦ considers Jesse beautiful with a "thing" that makes her different and she is sent to the professional photographer Jack. Jesse attracts he attention of the industry and has a successful beginning of career. But Ruby, Gigi and Sarah are capable to do anything to get her "thing". (Read More)
Subgenre: | independent filmcoming of ageblack comedyexperimental filmsuspenseconspiracydark comedyfish out of waterarthousemurder conspiracymodern fairy tale |
Themes: | murderdeathrevengesurrealismsuiciderapebetrayaljealousylesbianismfeardeceptionseductionpsychopathbrutalityobsession β¦youthrivalryunrequited loveexploitationpaniccannibalismfashiongetting away with murderfear of sex (See All) |
Mood: | goreneo noirnightmareavant gardestylization |
Locations: | beachrestaurantswimming poolmotorcyclelos angeles californiabathtubnightclubdesertmotel |
Characters: | artistteenagerboyfriend girlfriend relationshipteenage girlfemale protagonistphotographerwaitresslustaustraliancoronersuicide by stabbingmake up artist |
Period: | 2010s |
Story: | virginfoot chasedemonmirrorcell phonesurprise endingknifephotographbloodfemale nuditynudityviolencebare breastsfemale frontal nudityflashback β¦female full frontal nuditypartylesbian kisschaseshowertopless female nuditydreamcorpseblood splatterblondeface slapslow motion scenepunched in the facecamerawritten by directorundressingsunglassesbeddead bodyf wordorphanflashlightbracaliforniamansiondinertoiletstabbed in the chestmodeldouble crosslesbian interestfemme fatalenecklacelatex glovesdangerfantasy sequencecover upbaseball batfull frontal female nudityscene during end creditsattempted rapelong takegardenthreatened with a knifecult directorlgbtwarehouseelectronic music scorelooking at oneself in a mirrorsociopathbeardmorguegossipcovered in bloodrapistburialsocial commentarychokingfull moonphoto shootbackstagecannibalmercilessnessrejectionimmortalitydeath of protagonistrivalsexploitationliondisembowelmentlipstickmustachedressing roomlens flaresports carsymbolismmain character diestaking a photographnecrophiliaforced to striphuman monstereyemetaphormotel roomvery little dialoguefemale psychopathnaivety16 year oldfashion designernarcissismbeach houseoffscreen killingeyeballfemale villaindesignerfuneral homefatal attractiontragic pastnude modelingcamera phoneblack dresskicking in a doormortuarybreaking a mirrortechno musicregenerationstabbed with scissorswomen's bathroomfetishismstrobe lightsurprise during end creditsbody imageplastic surgeonnarcissistred lightcatwalkphoto studiogiallo esquefake bloodwild animaltriangleneonvomiting bloodneon lightfashion industryfemale murdererpasadena californianecrophiliacamoralitypuritysheetempty swimming poolpushed into a swimming poolfemale sociopathfemale virginguilt riddendream likedriving licencemodel agencyvitalityfemale rapistpumapremeditated murderbathorypukingnaked female corpseevil winsfemale rivalryspringboardmotel ownerkissing a mirrormurder cover uppushed to deathrevitalizationaspiring modeleating eyegag reflexremorselessness (See All) |
It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation β¦at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)
Subgenre: | independent filmslasher flickamerican horror |
Themes: | evilmurderdeathfriendshipfearescapeself sacrifice |
Mood: | slasherdarkness |
Locations: | hospitalforestcarbathtubbuspolice stationpolice carrunning in the forest |
Characters: | policefrienddoctorgirlpolice officerserial killernursevillainpsychiatristuncle niece relationshipslasher killer |
Period: | 1980s20th century |
Story: | hangingmirrorsurprise endingknifephotographbloodcharacter name in titlenumber in titleviolencesequeldoggunkissexplosionparty β¦chasecryingcatfalling from heightmaskrunningsubjective cameragood versus evilhalloweencandleambulancestabbingdeath of friendweaponexploding carchildanimalcoffinchild in perilpolice officer killedattempted murdertreedangercostumescreamingcharacter's point of view camera shotscreambraceletautomobilethreatneck breakingtrapratmurderersplatterhateholidayropehuggingheroinelooking at oneself in a mirrorslow motionlifting someone into the airbarnloss of friendhidingmasked manpresumed deaddeath threatpsychotronicscissorsstairsdead manbody countfieldlaughingfifth partsequel to cult favoritekilling spreepumpkinlightsirenmasked killerdead dogreflectionserial murderpetbad guypresentyellingtablereturning character killed offlaundrydead animalold dark househuman monsterdiscoveryclimbingkittenglasslocked doorhanged mancapemasked villainpitchforkscythemass murdererliquidstabbed with scissorssittingemergencydustlight bulbpolice officer knocked unconsciousmichael myerscarrying someonelifting a female into the aircrawlingboogeymanpleadingcrying childjumpsuitunmaskingopening a windowstringcult film referencestrawpink dressserial teen killertrailer narrated by don lafontaineattempted child murderpolice officer strangulatedkilled with a forkteardropwhite maskblack masklaundry chuteevil unclehiding behind a treenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All) |
When a younger girl called Emily Rose dies, everyone puts blame on the exorcism which was performed on her by Father Moore prior to her death. The priest is arrested on suspicion of murder. The trail begins with lawyer Erin Bruner representing Moore, but it is not going to be easy, as no one wants t β¦o believe what Father Moore says is true. (Read More)
Subgenre: | christian horror |
Themes: | evilmurderdeathreligiondrinkingdrunkennessinvestigationsupernatural powerillnessmental illnessfaithtraumastarvationthe devil |
Mood: | rainnightmare |
Locations: | hospitalbarrestaurantchurchsnowrural settingfarmcourtroom |
Characters: | family relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctorteenage girlfemale protagonistpolicemandancerpriestlawyerchristian β¦christianitybiblecatholicanthropologistreligious statue (See All) |
Story: | falling out a windowdemonic possessiondemonsurprise endingknifephotographcharacter name in titleflashbackdancingtitle spoken by characterbased on true storytelephone callhorsecar accidentwatching tv β¦catdrinklettercafecollegepianohallucinationreference to jesus christprayersciencegood versus evilhalloweenstabbingsnakejudgetrialhit by a carritualgraveyardgravescreamingpay phoneumbrellapossessiondolllightningcourtpianistcrosswitnesssubtitled sceneocculttv newsspiritinjurytape recordertied to a bedjail cellcrucifixpsychologypsychologistschizophreniaclockdebatethunderministerstabbed in the neckbroken glassreference to satanvoice over letterpsychoticexorcismreflectiondormitorytestimonytombstonefarmhousejurytape recordinghearing voicesinsane asylumcatholicismcornfieldtavernpsychiatrycoincidencestableprosecutorseizurescholarshipanthropologychapelriteanorexiaspoondetentionreference to the virgin maryschizophrenicmolestationepilepsylocketpsychosisholy watermartinispiritualismburningwomen's bathroomlaw firmforkmoral ambiguitytv cameradorm roomelectroshock therapyverdictsnorricammysticserpenttrick or treatreligion versus sciencethrown through a windshieldexpertomenmedical examinercrisis of consciencemalnutritiontranquilizerneurologycatatoniafly the insectstigmataneurologistagnosticbarbed wire fencespeaking in tonguesmethodistepitaphreference to neroeating an insectabnormal psychologyhypersensitivityvocal cordsaramaicinitialsreference to belialarchdioceseunseen forcewitching hour (See All) |