Best popular movies like Imagine That:

Do you need specific genre & keyword selection to find films similar to Imagine That?
<< FIND THEM HERE! >>

Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Imagine That (2009)

Themes:
home invasion
Characters:
employer employee relationshipnative americanfamily relationshipsfather daughter relationshiphusband wife relationship
Story:
school programhigh financeworkplace bullyingred bullsleepoversolopancakeblanketprivate schoolfeathertrampolineimaginary friendchild abusecompetitiondancing

A Little Princess (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Little Princess (1995)

When her father enlists to fight for the British in WWI, young Sara Crewe goes to New York to attend the same boarding school her late mother attended. She soon clashes with the severe headmistress, Miss Minchin, who attempts to stifle Sara's creativity and sense of self-worth. Sara's belief that "e β€¦very girl's a princess" is tested to the limit, however, when word comes that her father was killed in action and his estate has been seized by the British government. (Read More)

Themes:
friendshipfearmagicracismlonelinesspovertyabusebullyingcrueltychildhoodamnesia
Mood:
rain
Locations:
new york cityschoolwheelchairshipindiaschool bully
Characters:
father daughter relationshipafrican americanfemale protagonistteachergirlsoldiersister sister relationshipbest friendlittle girlteacher student relationshipfrenchsingle fatherfather daughter dance
Period:
1910s20th century
Story:
private schoolimaginary friendchild abusedancingbased on novelthree word titlevoice over narrationcryingunderwearrescuebirthdaybritishclassroomgood versus evilorphan β€¦bedroomcandlenew yorkold manchild in perilbirthday partyprincesspainuniformstorytellingdollstatuereunionschoolgirlworld war oneflowerclass differencesmonkeybattlefieldhatesingle parentbirthday cakeballoondressslow motionrace relationslifting someone into the airelephantmouseservantinterracial friendshiprealityindianpresumed deadgirl with glassesimaginationchild's point of viewhatredchild protagonistrejectiondespairthunderstormschool uniformroseatticboarding schoolrainstormhorse and carriagedead motherseparationloss of jobbirthday presentnarratorfriendship between girlskindnessfriends who live togethercruise shiprainingbomberbowwindowclimbing out a windowlockettrenchletter writinglifting female in airnightgownresignationchild laborgirls' schoolmissing fatherfather daughter reunionbilingualbombardmentturbanlonginginkasian indianchimneyheadmistressbratorphan girldeitystarving childbad temperriches to ragsballadeerfantasy lifemilkmanrich poorstory within a storyarmy captainsinger offscreenhot temperjourney shown on mapblowing out a candlegirls' boarding schoolmotherless childshawlchild exploitationdenunciationlosing temperharpistrejectrejectedchimney sweephelping otherspair of shoesaggressiveservant girlcrueldenouncementwood plankman versus beastramayanablind man's bluff gamemilk manserioussocial rejectbad temperedliving in an attic (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

School Of Rock (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

School Of Rock (2003)

Down and out rock star Dewey Finn gets fired from his band, and he faces a mountain of debts and depression. He takes a job as a 4th grade substitute teacher at an uptight private school where his attitude and hijinx have a powerful effect on his students. He also meets Zack, a 10-year-old guitar pr β€¦odigy, who could help Dewey win a "battle of the bands" competition, which would solve his financial problems and put him back in the spotlight. (Read More)

Subgenre:
cult film
Themes:
friendshipdrinkingdrunkennessdeceptionangerillnesseducationdyingfashion
Mood:
high school
Locations:
barschoolsnowsmall townlos angeles californianightclubschool busschool teacher
Characters:
family relationshipspolicefriendsingerboyteachergirlstudentmusicianbest friendalcoholicteacher student relationship
Period:
2000s
Story:
private schoolcompetitiontitle spoken by charactersingingtelephone callsongfoodurinationcomputerdrinksecretlierock musicpianoclassroom β€¦guitarbandnew yorkmontagedinertoiletrock bandapologychildroommatevanfired from the jobliarscene during end creditspianistcheerleadercontestrock 'n' rolldarkschoolgirlclassterminal illnesseyeglassesrockfarcewoman with glassesscene during opening creditsguitaristrehearsalimpersonationrebellionembarrassmentrock concertbootsimpostordrummerschool uniformdeceitslackerraised middle fingermusic bandsurprise after end creditsposterdrumsjoyvideo surveillancehangovertween girlidealismboy with glassesdrumschool principalschoolboysororitymtvelectric guitarblackboardcellomale protagonistdeskrock musiciangroupiecommitmentmusic historydiarrheakeyboardrock singermusical instrumentrock groupreference to led zeppelinlazinesspreparatory schoolclarinetweightfield tripsubstitute teacherroadiebass guitarknee socksband managerbattle of the bandsanti authoritysong lyricsrock clubmusic competitioncrowd surfingmusic clubbreaking the rulesbroken rulecymbalmosh pitreference to liza minnellirock guitarfaculty loungereference to stevie nicksreference to aretha franklinreference to puff daddyschool recesscode of conductfreeloading (See All)

Matilda (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Matilda (1996)

Matilda Wormwood is an exquisite and intelligent little girl. Unfortunately, Matilda is misunderstood by her family because she is very different from their ways of life. As time passes, Matilda finally starts school that has a kindly teacher, loyal friends and a sadistic principal. As she gets fed  β€¦up with the constant cruelty, Matilda begins to realize that she has a gift of telekinetic powers. After some days of practice, Matilda suddenly turns the tables to stand up to her parents and outwit the principal. (Read More)

Subgenre:
cult filmblack comedydark comedy
Themes:
friendshipangersupernatural powerdysfunctional familyadoptioncruelty
Locations:
schoolwater
Characters:
family relationshipsfather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipfemale protagonistteacherbabybest friendlittle girlsingle mothervillainteacher student relationshipaunt niece relationshipbaby girl
Story:
pancakechild abusef ratedcharacter name in titlebased on novelone word titletitle spoken by charactercryingbased on bookcatbookclassroomcookinglibraryfbi β€¦dollreadingdirected by starsingle parentflyingdresswoman with glasseslifting someone into the airfbi agentstealingoverallsvillainessmilkgirl with glasseswatching televisionchild's point of viewmisunderstandingchild protagonistironytime lapse photographythrown through a windowtelekinesisgeniusclose up of eyesforename as titlereading aloudsarcasmmathematicslibrarianelementary schoolschool principalcottageprincipalblackboardglassfemale heroroller skatingadopted daughtercarrotfemale athleteswingingprecocious childchild prodigyfat womanglobewagonhung upside downcerealfederal bureau of investigationphone bookhula hooplifting a female into the airbraided hairgluefirst day of schoolchalkspellingpsionic powerneglected childribbonchild neglectreference to moby dickadoptive motherhopscotchoverweight childdisbelieving adultsiren the alarmadoptive mother adopted daughter relationshipspinningdedicated teacherprincipal's officechocolate cakelibrary bookthrowing foodroller bladessix year oldchild geniussleepmaskbad parentssupergluecharacter calls female sirhair ribbonshot putbad parentingegg beatermunich olympicsnewtfirst grade teacherhammer throwreference to ishmaelteaching oneself to read (See All)

Big (1988) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Big (1988)

Josh Baskin would do anything to be big to hang out with his crush at the carnival. He finds a Zoltar machine, and he wishes to be big. After Zoltar tells him, "his wish is granted", Josh notices the machine is unplugged. He wakes up the next morning in an adult's body but he still has the same pers β€¦onality. With the help of his best friend, Billy, Josh learns how to act like a grown up. But as he gets a girlfriend and a fun job, he doesn't want to be a kid again. Will Josh stay big or become a 13 year old boy again? (Read More)

Subgenre:
coming of agefish out of water
Themes:
friendshipseductionhope
Mood:
affection
Locations:
new york cityhotelbicycleofficeoffice party
Characters:
employer employee relationshippolicemother son relationshipfriendboyfriend girlfriend relationshipteenage boybest friendbullychildhood friend
Period:
1980s
Story:
trampolinesexf ratedone word titlebare chested malekisstitle spoken by charactertitle directed by femaleunderwearmirrorneighborpianomanhattan new york citybasketballchild β€¦birthday partygunshotlimousineringhairy chestgameloss of virginitylifting someone into the airwalkie talkietoyblockbusterhomecarnivalbossmale underwearchild's point of viewco workerthirty somethingclassmatecareerfemale directorwishjobage differencepiano playeradolescencebaseball gamebunk bedrole reversalbronx new york citymarketingbody swapduettap dancingjob promotionfunfairwish fulfillmentpinball machinetoy storeloftbody switchingshaving creamtap dancewhat ifracquetballbody transformationtoy makerswitching bodieschild as adulthomesickpiano duetyankee stadium bronx new york citybirthday songunplugged electronic workscheap hotelquarterdo oversilly stringchild as an adultface on a milk carton (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

What Women Want (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

What Women Want (2000)

Nick, a somewhat chauvinistic advertising exec hot shot, has his life turned haywire when a fluke accident enables him to hear what women think. At first all he wants to do is rid himself of this curse, until a wacky psychologist shows him that this could be used to his advantage! His first target i β€¦s Darcy McGuire, the very woman that got the promotion he wanted. But just as his plan is beginning to work, love gets in the way... (Read More)

Themes:
drinkingdrunkennessdanceweddingdeceptionseductiondivorce
Mood:
rain
Locations:
bathtubchicago illinoisoffice politics
Characters:
employer employee relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlpsychiatristex husband ex wife relationship
Story:
competitiondancingsexf ratedbare chested malesex scenekisstitle spoken by characterthree word titletitle directed by femalecatdrinkbramontagesuicide attempt β€¦bathpantyhosecoffeelibraryelectrocutionproduct placementmoaninglightningcross dressingpsychicteenage sexmachismosabotageblockbusterwomanizervirginitycameothunderstormadvertisingpassionate kissmisogynytelepathycoffee shopmisogynisthoneymoonloud sexprompsychic powerbattle of the sexesremarriageman wearing towelimplied nuditypretending to be gaywoman moaning from pleasurejob promotionwoman moaningmoaning womangender roleshair dryeradvertising executivealliterative titlesuicidal tendencyman in towelman wearing a towelebayelectrocutedmistaken for gaychauvinisthunkcorporate ladderelectrocuted in bathtubimplied male nudityman in woman's underwearsensitivityseducerelectrocuted in a bathtubshopping montagebusiness officehair dryer falling into a bathtub (See All)

Click (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Click (2006)

Michael Newman (Sandler) is a hard working family man, who must please his boss (Hasselhoff), in order to get promoted. Problem is he gets less time with his family, and wishes for a remote in which he can control his life. This soon comes true for Newman, when he meets Morty (Walken), a crazy sales β€¦ clerk, who has the ultimate remote. A remote in which he can do anything, including muting, skipping and dubbing his life. He finds this to be the opportunity in which he can not only skip every argument, but also skip to his promotion. He sees this as a good idea, until the remote goes horribly wrong. (Read More)

Subgenre:
allegory
Themes:
deathfriendshipchristmasjealousyweddingmagicdeath of fathertime traveldrug usedysfunctional familycancerredemptioncampingregret
Mood:
rain
Locations:
hospitalnew york citybarrestaurantswimming poolsnowcemeterybicyclebaseballofficesinging in a carwater gun
Characters:
employer employee relationshipfamily relationshipsfather daughter relationshiphusband wife relationshiphomosexualfather son relationshipmother son relationshipmother daughter relationshipfriendsingerboydancerbabytranssexual β€¦japaneseasiansecretaryex husband ex wife relationshipgrandfather grandson relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipgrandmother granddaughter relationshipgrandfather granddaughter relationshipcrying baby (See All)
Period:
1990s1970s1960s2000s2010s2020s2030s
Story:
sleepoverdancingsexflashbackdogkisstitle spoken by charactersingingsurprise endingerectiontelephone callvoice over narrationcryingcell phone β€¦songdreamfoodmirrorurinationface slapslow motion scenewatching tvcomputerundressingsex in bedtearscafecleavagegay slurbandbridgeeatingsuicide attemptbrunettegraveyardcigar smokingflash forwardgraveargumentsuburbfactoryproduct placementangelmassagetentloss of fatherreunionobscene finger gesturefireworkskissing while having sexsacrificeheart attackeavesdroppingdestinyhypodermic needlelistening to musicarchitecturemagicianarchitectflatulenceswimsuitbirthcelebrationremote controlreverse footagesurveillance camerainventorobesityshopping mallkicked in the crotchdespairarabsexual harassmentfrustrationdivorceetank topwedding receptionfast motion scenet shirtmagic trickcartoon on tvbonglost lovetombstonecoca colatraffic jamlistening to a radiostrokemoroccosex changebathroberesponsibilitysecond chanceromantic rivalrycadillactreehousefeetfourth of julyparallel universewatching a videoreference to michael jacksonlong brown hairlifting person in airspeedofirecrackerkicked in the groindying wordswedding cakemcdonald's restaurantoverhead shotchemotherapyjoggerfattoy carcamperadult humorworkaholicchild swearingjob promotionwish fulfillmentchevroletsnowballbritish actor playing american characterrepeated eventpenis sizecamping tripfrench friesfat suitanimal sextime warpdark futurereference to britney spearsbad smelltoyotarich snobit was all a dreamnew york yankeesasian stereotypeobese manphotocopierwalking a dogyear 2017sleeping on a sofabaseball glovechevrolet corvetteadvanced technologycosmetic surgeryjunk foodmarriage counselorangel of deathpost coital scenewhat ifloss of petplaying catcharchitectural modelpool boysonycat scancheeseburgerremote controlled toy carstopped timelistening to a car radiorobot dogpants pulled downabsent mindednesspink shirtsalesclerkdog humping someone's legtime reversalarab stereotypepopulismfrozen timeindestructibilitytwinkiegarage doorjapanese stereotypemakeup sexswim meettoyota corollacoin trickhamptons long island new yorkliposuctioncommon coldquickieearmuffschevrolet impalaoglingpallorreference to calvin kleinswim coachjumping over a fenceemotionlessnessbaseball balldepantsingsensitivity trainingstuffed birdtivotoy helicoptertwinkiesdragged by one's hairirish setterreference to rosie o'donnelldog defecationplaying cowboys and indiansreference to moroccowendy's restaurantlays potato chipsobject returns after rejectedquarter the coinremote controlled toy helicopter (See All)

Happy-go-lucky (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Happy-Go-Lucky (2008)

Poppy Cross is happy-go-lucky. At 30, she lives in Camden: cheeky, playful, frank while funny, and talkative to strangers. She's a conscientious and exuberant primary-school teacher, flatmates with Zoe, her long-time friend; she's close to one sister, and not so close to another. In this slice of li β€¦fe story, we watch her take driving lessons from Scott, a dour and tightly-wound instructor, take classes in flamenco dance from a fiery Spaniard, encounter a tramp in the night, and sort out a student's aggressive behavior with a social worker's help. Along the way, we wonder if her open attitude puts her at risk of misunderstanding or worse. What is the root of happiness? (Read More)

Themes:
friendshipjealousypregnancydrinkingdanceparanoiamental illnessbullyinghomelessness
Locations:
barbeachschoolcarbuslondon englandbicyclekitchenurban settinglakegas stationschool teacher
Characters:
family relationshipshusband wife relationshipmother son relationshipfriendboyfriend girlfriend relationshipchildrensingerboyfemale protagonistteacherdancersister sister relationshiplittle girlbullylittle boy β€¦teacher student relationshiphomeless man (See All)
Story:
trampolinechild abusedancingbare chested malekissfightcigarette smokingnipplessingingchasepantiestelephone callcell phonesongunderwear β€¦foodslow motion scenedrinkundressingmaskbooklierunningmarijuanaclassroombracookingwomaneatinginternetdrivingbirddrawingpantyhoseparkargumentsuburbuniformflowerslong takesplit screendatechickenclasspubhappinesseccentricclubimprovisationstreet lifebootsplaygroundspanishironymiami floridarowboatscissorsschool uniformbookstorenintendothirty somethingbarbecuepiersocial workerowlabandoned buildingyellingteachingbag over headdockfirst dateplaystationfriendship between womenstreet marketshoutingclinicdenialbumravebackyardlearningoptimismdance lessonsex on first dateglobedance classflamencofake breastsspaniarddriving lessoncar keyslessonpink braprimary schoolchildren's bookflatmatelearning to drivetouching breastsclappingpiggy back ridepalm readingthree sistersseat beltafrican anglo30 year oldchiropractordriving instructorpaper bagart projectoptimiststolen bicyclereference to pinocchioarts and craftspicture booktoucanback painshadow boxingcheerfulnessrowing boatcamden town londonosteopathreference to kate winsletnorth londontraffic signanglo african (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Peter Pan (2003) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Peter Pan (2003)

In stifling Edwardian London, Wendy Darling mesmerizes her brothers every night with bedtime tales of swordplay, swashbuckling, and the fearsome Captain Hook. But the children become the heroes of an even greater story, when Peter Pan flies into their nursery one night and leads them over moonlit ro β€¦oftops through a galaxy of stars and to the lush jungles of Neverland. Wendy and her brothers join Peter and the Lost Boys in an exhilarating life--free of grown-up rules--while also facing the inevitable showdown with Hook and his bloodthirsty pirates. (Read More)

Subgenre:
martial artsswashbucklersword and fantasy
Themes:
murderdeathfriendshipbetrayaljealousyfearheromagicangerlonelinesstheftadoptioncouragefirst love
Locations:
schoolsnowbathtublondon englandwatershipcastlejunglestormcity of children
Characters:
native americanfamily relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenagermother daughter relationshipfriendbrother brother relationshipboybrother sister relationshipteachergirlstudent β€¦thieftough guyvillainaunt niece relationshipaunt nephew relationshipmermaidboy hero (See All)
Period:
1900s
Story:
feathercharacter name in titlebased on novelviolencedoggunkissfighttitle spoken by charactervoice over narrationcryingrescueslow motion scenebattlesword β€¦lettershootingshowdownhand to hand combatbedislandclassroomfightingcombatbound and gaggedsword fightgangambushmixed martial artsweaponman with glassesno opening creditschilddisarming someoneone man armydrawingduelattempted murderone against manydangerpoisonstorytellingtough girlskeletonglassestrapunderwaterclassrecord playericepirategoldcaptainbow and arrowflyinghead buttheroinelifting someone into the airhattreasurehidinggossipteddy bearfemale tied upcannonbarefoottelescopechild's point of viewfairychild protagonistrowboatlostrivalshadowyoung lovegrowing upsword duelparrotwilhelm screamnannyclose up of eyesflagswordsmangatecrocodiletween girladventure heroboy with glasseshanging upside downbankerfencingcloudwhistlingsiblingmusketsewingcomettop hathookshot with a bow and arrowflintlock riflenightgownflintlock pistolsolar systemwire fubig ben londonchild heromale tied upreference to cinderellapleadingchild in dangerteepeehook for handplay fightvictrolamake believepirate captainnightshirtwooden swordsaint bernard dogpulling hairflying boygirl in dangerwalking the plankjolly rogerskull and crossbonesboy in dangerfantasy landflying shipblushingmagical dustthimblecrowingfairy dustbarefoot boy (See All)

Sunshine Cleaning (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sunshine Cleaning (2008)

A family. Rose and Norah, in Albuquerque, lost their mother when they were young. Rose is responsible - a housecleaner, raising her seven-year-old son Oscar. She's also having an affair with Mac, a married cop, her high-school sweetheart. Norah can't hold a job. Their dad, Joe, is quirky. When Oscar β€¦ is expelled for odd behavior, Rose wants to earn enough to send him to private school. Mac suggests she clean up after crime scenes, suicides, and deaths that go undiscovered for awhile. Rose enlists Norah, and Sunshine Cleaners is born. Norah bonds with the dead, Rose finds out that it's a regulated business, and complications arise. Can a family marked by tragedy sort things out? (Read More)

Subgenre:
independent filmblack comedy
Themes:
murderdeathsuicideinfidelitymoneyadulterypregnancymemoryextramarital affairdeath of motherdrug usedysfunctional familyunfaithfulnessbreak uppolice investigation β€¦suicide of mother (See All)
Locations:
restauranttrainschoolswimming poolcarbathtubelevatortruckmotelfire trucknew mexicosea foodsex in a motel
Characters:
family relationshipsfather daughter relationshiphusband wife relationshippolicemother son relationshipmother daughter relationshiptattooboyteacherpolice officerpolicemansister sister relationshipreference to godsingle motherwaitress β€¦police detectivemaidgrandfather grandson relationshipaunt nephew relationshiptruck driversuicide by gunshottalking to oneself in a mirrorbaby shower (See All)
Story:
private schoolsexf ratedbloodmale nudityflashbackkissphotographtitle spoken by characterpartypantiespistolshowertelephone call β€¦firelickingcryingcell phonetitle directed by femalecorpseblood splattercar accidentmirrorshotgunslow motion scenewatching tvundressingbare buttshootingvomitinglietearssunglassesbirthdaybeddead bodymarijuanabedroomflashlightbracandleold manwomanmontagedinerdrivingapologybirthday partyvanold womanbartenderlatex glovesgunshotbinocularskeyfired from the jobliaruniformstorytellingbusinessamerican flagautomobiledeath of husbandbirthday caketv newspot smokingsupermarketcakebabysitterworking classfollowing someonescamembarrassmentcrime sceneremote controlgrocery storeshoessevered fingermobile phonegunshot woundmedicationheavenschool uniformsalesmanslackerswingdead motherchildhood memoryfiremanbeing followedreal estate agentcandytriple f ratedfire extinguisherbirthday presentmathematicsmotel roomvacuum cleaneramputeepopcornelementary schoolblood stainschool principalkittenbusiness cardtrailer parktrain trackssense of smellcleaning ladymaggotcadillaccleaninglesbian subtextmattresshouse on firefast food restaurantdressinghousemaidprecocious childfordillegitimate sonwomen's bathroomcontaminationhigh school frienddecomposing bodychildhood photogun held to one's headsmall businessburning househazmat suitmodel airplaneshelllawn sprinklertoyotaseminarproblem childbiohazardbelief in heavenone armed manshrimpeight year oldmementoalbuquerque new mexicoreference to coca colatrailer housenewspaper adpost mortemreference to disneylandcandy storeloss of parentused car salesmanblood donationcb radiomexican restaurantstuck in an elevatorgun shopcigarette buttsiamese cathigh school sweethearthouse cleanersporting goods storecleaning crewmodel buildersmall business ownerfanny packfinancial problemsrailroad trestleshooting oneself in the headwealthy womantoy helicopterex cheerleaderhorse ridebed framecrime scene cleanupdonating bloodford econolinehazardous materialtemporary tattoo (See All)

One Hour Photo (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

One Hour Photo (2002)

Middle aged Sy Parrish works as a technician at a one hour photo lab located in a SavMart store in a suburban mall. Sy is a lonely man, never having had any friends. He knows much about his customers through the photographs they have developed. But he knows more about the Yorkin family - specificall β€¦y Nina Yorkin and her adolescent son Jake Yorkin, the two in the family who drop off and pick up the family's photofinishing - the family about whom he is obsessed, than anyone else. Nina's husband, Will Yorkin, is incidental to his obsession since Sy has only seen him in photographs. Sy's obsession includes fantasizing about being their favorite "Uncle Sy". He has even been making an extra set of prints for himself of all of their photographs since Jake was a newborn. After an incident at work and after Sy finds out more about the family through a set of photographs, he decides to right the injustices he sees in the only way he knows how. His actions demonstrate his true mental state. (Read More)

Themes:
home invasionmurderdeathrevengemarriageinfidelitychristmasbetrayaladulteryfeardrunkennessvoyeurismmemoryextramarital affairanger β€¦lonelinesstheftpsychopathobsessionparanoiadepressioninsanityunfaithfulnessmental illnessphotographytheatrecheatingaffair (See All)
Mood:
nightmare
Locations:
restauranthotelbicycleelevatorkitchenpolice stationofficelaboratory
Characters:
employer employee relationshipfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipchildrentattoopolice officernursedetectivephotographerbabythiefwaitress β€¦little boysecurity guardalcoholicolder man younger woman relationshipuncle nephew relationshipself mutilationpolice arrest (See All)
Story:
child abusesexfemale nuditynuditynumber in titlebloodmale nudityfemale frontal nudityinterviewflashbackmale frontal nuditymale rear nuditydogbare chested male β€¦gunfemale rear nudityfightfemale full frontal nuditycigarette smokingnipplesphotographknifepistolshowervoice over narrationcryingcell phonedreamcorpsecar accidentmirrorwatching tvcomputercameraarrestsecretbookheld at gunpointtearsrunningbirthdayinterrogationcafehandcuffsvoyeurmale pubic haircleavagesoccervideo camerafootballdinertoiletfemale pubic hairman with glassesno opening creditschilddream sequencescantily clad femalebirthday partyvoice overlatex glovesargumentstalkerkeysuburbfired from the jobfantasy sequenceproduct placementscreammanagerthreatened with a knifehandgunbare chested male bondageclass differencesbirthday cakecoacheyeglassespornographysabotagefireplaceno pantiesbreaking and enteringtoywatching a moviebuttocksimpersonationtimecovered in bloodbossrealityremote controlsurveillance camerapet dogshopping malldelusionplaystation 2evidencelonerfemale in showerbeing followedceremonycartoon on tvloss of jobbirthday presentforced to striprunning awayescalatorrepressionsecurityfilm cameradepartment storedripping bloodhandcuffedmonitorshockdarkroombadgecustomermagnifying glasshamstertrophy wifeborderline personality disorderfilm reelnude photo shootchild pornographyprinterpracticerepairmanspeakerfiredflea marketcash registercosmeticsocdoral rapebleeding from eyesphoto montageone way mirrorprojectorprocessphoto labphoto shoppsychopath as protagonistgerbilphotograph on wallfixationmiranda warningroll of filmstepladdermondaydiscount storenegativephotograph negativereference to deepak choprasnapshotfood courtinsurance adjuster (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Proposal (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Proposal (2009)

For three years, Andrew Paxton has slaved as the assistant to Margaret Tate, hard-driving editor at a New York publisher. When Margaret, a Canadian, faces deportation for an expired visa, she hatches a scheme to marry Andrew - he agrees if she'll promise a promotion. A skeptical INS agent vows to te β€¦st the couple about each other the next Monday. Andrew had plans to fly home that weekend for his grandma's 90th, so Margaret goes with him - to Sitka, Alaska - where mom, dad, and grams await. Family dynamics take over: tensions between dad and Andrew, an ex-girlfriend, Andrew's dislike of Margaret, and her past color the next few days, with the INS ready to charge Andrew with fraud. (Read More)

Themes:
travelhumiliation
Locations:
new york cityalaskaboat accident
Characters:
employer employee relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipfemale protagonistex boyfriend ex girlfriend relationshipfiance fiancee relationship
Period:
2000s
Story:
workplace bullyingdancingfemale nuditymale nudityinterviewdogtwo word titlekisstelephone callcell phonetitle directed by femalealcoholstripperwomanimmigrant β€¦brunetteconfessionmassagescene during end creditspremarital sexgrandmotherkissing while having sexheart attackbeer drinkingsexual harassmentvegetarianwedding dressbonfireferryflightmoral dilemmamale objectificationwedding ceremonydeportationmale stripperpartial female nudityrole reversaleaglechick flickfemale bosswet clotheslong brown hairproposalimplied nuditysexual innuendodouble entendreseaplaneillegal alienfemale star appears nudemankissing in publicinternet cafewealthy familycovered female frontal nuditybachelorette partysmart phonefake marriagesham marriagesleeping on the floorbuoyimmigration officerbook editorcanadian stereotypeimmigration agentstarbucksstruggling writercross examinationhigh school sweetheartman overboardspilled coffeeleft at the altarshoulder massageboss secretary relationshipmale star appears nudecanadian expatriatepartial male nudityfake engagementimmigration fraudmidnight sunfamily heirloomthreat of deportationimacresentment toward bossspeed boat (See All)

Girl, Interrupted (1999) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Girl, Interrupted (1999)

Unable to cope with reality and the difficulty that comes with it, 18 year old Susanna, is admitted to a mental institution in order to overcome her disorder. However, she has trouble understanding her disorder and therefore finds it difficult to tame, especially when she meets the suggestive and un β€¦predictable Lisa. (Read More)

Subgenre:
coming of agemelodramaautobiographicalbased on autobiographycoming of age film
Themes:
friendshipsuicideinfidelitydrugsadulteryescapeincestextramarital affairracisminsanityunfaithfulnesssexualitymental illnesswritingfather daughter incest β€¦self harm (See All)
Mood:
high school
Locations:
bathtubtaxiroad triptaxi driver
Characters:
employer employee relationshipfather daughter relationshiphusband wife relationshipmother daughter relationshipfrienddoctorteenage girlfemale protagonistnursepsychiatristself mutilationdoctor patient relationshipsuicide by hangingteacher student sex
Period:
1960ssummer of love
Story:
child abusesexf ratednuditymale nuditymale frontal nuditymale rear nuditybare chested malecigarette smokingbased on true storyvoice over narrationcryingbased on bookcatbook β€¦birthdayguitartelevisionf wordsuicide attemptracial slurscreamingfired from the jobhangingdiarychickenbirthday cakeshavingteen angstsociopathpatientguitaristhidingeccentricpsychologyvietnam warschizophreniamental institutionwatching televisionreverse footagehippiesexismmental hospitalpost traumatic stress disordersocial workerclassmatepromiscuityphysical abusepillfemale bondingadolescenceinsane asylumrazorlollipoprehabilitationrainingbourgeoisieeating disorderintimacymedical professionidentity crisisborderline personality disordermemoircamaraderiedouble standardreference to walt disneyauthorityrich snobpsychiatric wardfemale psychiatristaspirindeliberate crueltymilitary draftbarkingdangerous friendice cream parlorreading bookescape from mental institutionpsychiatric nursecat hissingreference to jan vermeerinstitutional life (See All)

Glengarry Glen Ross (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Glengarry Glen Ross (1992)

The real story behind the world of sales. This is a realistic portrayal of what it is to try making a life in high pressure sales with all its highs and lows; promises of fortunes and deliveries of dross. Red-leads and dead-leads are to blame for life's outcomes. Living with "Objection, Rebuttal, Cl β€¦ose". (Read More)

Subgenre:
independent filmcult filmconspiracy
Themes:
moneydrinkinginvestigationdeceptionrobberyangergreedcheatingpolice investigation
Mood:
rain
Locations:
hospitalnew york citybarrestaurantpolice carofficechicago illinoischinese restaurant
Characters:
employer employee relationshipfather daughter relationshiphusband wife relationshippolice officerdetectivethief
Story:
competitionsexinterviewcigarette smokingbased on playtelephone calldrinkliecafegay slurdinersubwayman with glassesfired from the jobliar β€¦pay phoneumbrellabusinessspeechcontestmanagerpowercloseted homosexualbreaking and enteringrepetition in titlewristwatchfloridaphone boothdesperationbossscammoralitydespairco workerarizonaone daysalesmansuspectmeetingcapitalismhustlercon mancontractall male castreal estate agentethicsschemestrategymen's bathroomtelephone boothreal estateblackboarddocumentillinoisnegotiationdignityscreenplay adapted by authorruthlessnesspsychological manipulationconferenceinvestmentemploymentpulitzer prize sourcepressurepropertywashroomsignaturecompetitorpessimismsalesambiguous titlecommissiontelephone bookpitchdoor to doorcorrupting influence of capitalismgraftmislaid trusttelephone saleshustlebrochureoffice managerrefundwage slave (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Rushmore (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rushmore (1998)

Max Fischer is a precocious 15-year-old whose reason for living is his attendance at Rushmore, a private school where he's not doing well in any of his classes, but where he's the king of extracurricular activities - from being in the beekeeping society to writing and producing plays, there's very l β€¦ittle after school he doesn't do. His life begins to change, however, when he finds out he's on academic probation, and when he stumbles into love with Miss Cross, a pretty teacher of the elementary school at Rushmore. Added to the mix is his friendship with Herman Blume, wealthy industrialist and father to boys who attend the school, and who also finds himself attracted to Miss Cross. Max's fate becomes inextricably tied to this odd love triangle, and how he sets about resolving it is the story in the film. (Read More)

Subgenre:
cult filmcoming of ageteen moviecoming of age film
Themes:
friendshipinfidelitychristmasjealousydivorceobsessiondepressionwrestlingunrequited lovetheatrevengeance
Mood:
high schoolaffection
Locations:
hospitalrestaurantswimming poolhotelhelicoptercemeterybicycleelevator
Characters:
teenage girlteenage boyteacherstudentlove triangle
Story:
private schooldancingone word titletitle spoken by characterblondeslow motion scenearrestjailalcoholkung fucleavagebasketballwidowno opening creditsdream sequence β€¦birthday partysmokinglibrarywidowerspeechgiftunderwaterclass differencesflirtingsabotageteen angstvandalismcrushhaircutdivinginterracial romanceexplosivebreakupbackstagemillionaireaquariumflamethroweradolescentgeniusirreverencehappy endingunhappy marriagevietnam veteranbarberfish tankplaywrightmisfitfencingstrokekiteidentical twinsscholarshipchapelman wearing glassesunwanted kissschool playbarbershopschool lifeindustrialistpreparatory schoolteenage angstpetitionyearbooksteelexpulsionbackgammonbeekeepingscience fairtv dinnermale cheerleadergirl wearing glassesboy wearing glassesair riflespringboardremote control airplaneacademic fraudpea shooterred haired twins (See All)

Dan In Real Life (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dan In Real Life (2007)

Single father Dan Burns dedicates his life to his children, but one day he meets Marie at a bookstore. They get to know each other, but then Dan finds out that Marie is actually dating his brother, Mitch.

Themes:
weddingdeath of motherbreak updeath of wifefalling in lovewriting
Mood:
rain
Locations:
new york citybeachrestaurantschoolbathtubbuspolice carschool busnew england
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorchildrensingerbrother brother relationshipboybrother sister relationshipgirlpolice officerpoliceman β€¦dancerwriterlove triangleuncle nephew relationshipsingle father (See All)
Story:
pancakedancingfemale nuditycharacter name in titlekissphotographsingingshowertelephone callcryingcell phonesongfoodmirrorpunched in the face β€¦computerfalling from heightbooktearscafepianovoyeurguitarnewspaperwomaneatingmapdinnerapologyconfessionprologuewidowervacationgympianistloss of motherguitaristamerican footballloss of wifebreakfastbloody nosenew jerseyfrustrationbookstorebowlingfamily dinnerdead motherreckless drivinglighthouselaundryfamily reunionparenthoodcanoebowling alleyaerobicsstation wagonwashing machinegame playingtalent showdead wifetreadmillfamily historyhide and seekduetdriver's licensefalling off a roofcrossword puzzlecerealwashing dishesfamily photographplastic surgeonshorerhode islandlaundry roomlife jacketcolumnistspeeding ticketnewspaper boymotherly loveadvice columnistvacation homeimitating a dogreference to anna kareninasecret ingredientcharades the gamefamily gamemotherly instinctwearing clothes in a shower (See All)

The Shining (1980) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Shining (1980)

Signing a contract, Jack Torrance, a normal writer and former teacher agrees to take care of a hotel which has a long, violent past that puts everyone in the hotel in a nervous situation. While Jack slowly gets more violent and angry of his life, his son, Danny, tries to use a special talent, the "S β€¦hining", to inform the people outside about whatever that is going on in the hotel. (Read More)

Subgenre:
cult filmamerican horrorbritish horrorcult classic
Themes:
murdersurrealismmarriageghostpsychopathsupernatural powerdysfunctional familyinsanitycannibalismwritingwilderness
Mood:
nightmareambiguous ending
Locations:
barhotelhelicoptersnowairplanebathtubairportelevatorkitchen
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipdoctorwriter
Period:
1980swinter
Story:
imaginary friendchild abusefemale nuditybased on novelbloodfemale frontal nuditytwo word titlefemale full frontal nudityphotographtitle spoken by characterchasesurprise endingmirrorslow motion scenebathroom β€¦hallucinationgood versus evilaxewomanfemale pubic haircultchild in perilbartenderracial slurcostumepossessionbaseball batskeletonactor shares first name with characterdomestic violencelong takeisolationhauntingtypewriterpsychicchild murdermaniactv newsfalling down stairselectronic music scorelifting someone into the airice creamcookblockbusternew year's evehomereincarnationjob interviewmiami floridabutlerhit on the headabusive fatheraxe murdertelepathyvillain played by lead actorpsychopathic killercartoon on tvmazehomicidal maniacrestroomcoloradopremonitionwriter's blockidentical twinssole black character dies clichefamous scoreoverhead camera shotcaretakerchapter headingsbutcher knifemass murdererfamous linetranceradio broadcastvolkswagen beetleballroom dancinglabyrinthtoy carsnowstormfreezerfrozen bodyextrasensory perceptiontricyclebreaking down a doorghost childtwin sistersfilicidedenver coloradorepetitionable to see the deadbased on the works of stephen kingrocky mountainshorror movie remadehypothermialifting a male into the airpediatricianuxoricidestore roomcanned foodforest rangeralcoholic relapsefreezing to deathpantryshot in sequencemagical negro stereotypehaunted hotelhedge mazehome sweet homebear suitpsychological disintegrationcabin feverfilmed in mirrorwriting backwardsadvice from bartenderescape through a bathroom windowtwo way radio (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dolores Claiborne (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dolores Claiborne (1995)

Dolores Claiborne works as a maid for a wealthy woman in remote Maine. When she is indicted for the elderly woman's murder, Dolores' daughter Selena returns from New York, where she has become a big-shot reporter. In the course of working out the details of what has happened, as well as some shady q β€¦uestions from the past and Selena's troubled childhood, many difficult truths are revealed about their family's domestic strife. This is cleverly portrayed with present reality shot in cool blue tones blending seamlessly into flashbacks shot in vivid color. As small town justice relentlessly grinds forward, surprises lie in store for the viewers.... (Read More)

Themes:
murdersuicidemarriageinvestigationincestmemoryangerpsychopathdysfunctional familywritingmurder investigation
Locations:
barrural settingpolice station
Characters:
employer employee relationshipfather daughter relationshiphusband wife relationshipmother daughter relationshipfemale protagonistdetectivewriteralcoholicmaidterrormother versus daughter
Story:
child abusesexf ratedcharacter name in titlebased on novelviolenceflashbacktwo word titletitle spoken by characterinterrogationislandreporteraxewomanaccident β€¦false accusationjudgechristmas treedomestic violencestrong female characterfalling down stairssexual abusedysfunctional marriagestrong female leadwatching televisioncameopillsjob interviewfalling to deathpedophilehousekeeperabusive fathernervous breakdownferryabusive husbandmusic bandhairlast will and testamentchild molestationeditorwelldrunkardmooningaudio cassettemurder suspectman wearing glassesmailmaninspectormainesadistic psychopathmolestationreputationeclipsemarinaeye witnessdocksferry boatsmall communitysolar eclipsebad motherinvalidbased on the works of stephen kingbank accountmagazine editoranti depressantmale chauvinismwoman wearing glassesprescription drugsmother daughter estrangementscotchwinchrolling pinfalling down a shaftbossa novastate policelawn partyfax transmissionbangor mainereligious medal (See All)

Slow West (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Slow West (2015)

'Slow West' follows a 16-year-old boy on a journey across 19th Century frontier America in search of the woman he loves, while accompanied by mysterious traveler Silas.

Subgenre:
suspense
Themes:
murderdeathmoneydrinkingdrunkennessescaperobberylonelinesstheftdeath of fatherunrequited lovedyingmurder of father
Mood:
rain
Locations:
beachforestwoodscampfirestorm
Characters:
native americanfamily relationshipsfather daughter relationshiphusband wife relationshipafrican americanboyfriend girlfriend relationshipsingerboyteenage boygirlsoldierbabywriterthiefreference to god β€¦little boyfrenchgermanuncle nephew relationship (See All)
Period:
19th century
Story:
blanketbloodviolenceflashbackdogtwo word titlegunkisscigarette smokingsingingknifechasepistolfirevoice over narration β€¦cryingsongshootoutdreamcorpseshot to deathblood splatterfoodhorsemirrorshot in the chesturinationshot in the headshotguncatdrinkgunfightbare buttshootingrifleheld at gunpointtearsrunningbeddead bodyshot in the backf wordorphanmountainbridgeeatingimpalementchilddream sequencesearchcigar smokingshot in the legcoffeeshot in the foreheadgunshotflash forwardprologuestorytellingrabbitshot in the shoulderpursuithorse ridingirelandcabinmercenarydirectorial debutsleepingsubtitled sceneblack americanmooneyeglassesteabow and arrowbulletegglooking at oneself in a mirrorhatcowboy hathammeraccidental deathirishwhiskeyfloodbootsministerblood on facemercilessnessdrummeroutlawaccidental killingbounty hunterfieldbonfirehorseback ridingmysterious manpeasantdrifterhit in the facedead animalwalletamerican indianvery little dialogueshot with an arrow17 year oldnaivetydrumfalling into waterwhispering16 year oldgun violencemushroomreverendscarecrowbleeding to deathold westhold uphiding under a bedreference to shakespeare's romeo and julietoutlaw gangchild abandonmentcardinal direction in titlekiss on the cheekreference to charles darwinwanted posterman hits a womancompassattempted robberystory tellingoverhead shotrewardcaterpillarscottishfloodingtied to a treebanjobloody facescotsmanlordfrontierflaming arrownailshot through a wallladystar gazingabsintheirishmanbegins with narrationteepeeaccidental murderdead rabbithorseshoeashchaperoneempty gunlong underwearbiscuitamerican westfalling to the groundshaving someoneshushingrolling down a hillstealing from a dead bodyblood on floorhit with a gungun sightblack bearwrapped in a blanketfalling to one's kneesonce upon a timewanted dead or alivecalling someone a son of a bitchrolling downhillreference to canadareference to irelandburned villagegreenhornthreat to murdertwo narrators (See All)

Hide And Seek (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hide And Seek (2005)

Hide and Seek revolves around a widower and his daughter. They move to upstate and Emily soon creates an imaginary friend named Charlie... but this act takes an unexpected and terrifying turn, where her father and doctor start to worry about Emily's gruesome habits.

Subgenre:
psycho thriller
Themes:
murdersuicideinfidelitydeath of motherdeath of wifetraumapolice investigation
Locations:
new york cityforestsmall townbathtubcave
Characters:
father daughter relationshipdoctorpolicemanlittle girlsheriffsingle fatherparent child relationship
Story:
imaginary friendflashbackguntitle spoken by characterpartythree word titlesurprise endingcorpseshootingbookneighborflashlightpolice officer killedwidowerdoll β€¦basementloss of motherfalling down stairshidingloss of wifepsychologistschizophreniatensiontelescopechild's point of viewunfaithful wifeplot twistshovelthrown through a windowtuxedoclosettween girlsplit personalitycrazinessmoving inmusic boxvolkswagen beetlenew year's eve partyfreight trainfake suicideparking ticketnew year's dayrealizationpicking a lockfishing rodsmothered with a pillowsmothered to deathguessing gamechild psychologistdeath of a pethand cutmonarch butterflycandle lit bathbloody bathtubpushed out a windowpumping gasfootpathrunning through wood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Harvey (1950) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harvey (1950)

The classic stage hit gets the Hollywood treatment in the story of Elwood P. Dowd who makes friends with a spirit taking the form of a human-sized rabbit named Harvey that only he sees (and a few privileged others on occasion also.) After his sister tries to commit him to a mental institution, a com β€¦edy of errors ensues. Elwood and Harvey become the catalysts for a family mending its wounds and for romance blossoming in unexpected places. (Read More)

Subgenre:
screwball comedycomedy of manners
Themes:
friendshipdrunkennessinsanitymental illnessalcoholism
Locations:
barnightclubtaxitaxi driver
Characters:
mother daughter relationshipdoctorsingerbrother sister relationshippolice officernursepsychiatristmaiduncle niece relationshipaunt nephew relationship
Period:
1950s
Story:
imaginary frienddancingcharacter name in titleone word titletitle spoken by charactersingingpartybased on playpaintingpianoalcoholtelephonenewspaperjudgebartender β€¦rabbitpianistflowerhypodermic needlelifting someone into the airhateccentricclockrealitymental institutionguestmisunderstandingdelusionanimal name in titlechauffeurforename as titlesandwichbandagenurse uniformbusiness cardshocksiblingnurse outfitcommitmentlifting female in airfired from a jobpulitzer prize sourcefemale nurselifting an adult into the airremadesanitariumfree spiritencyclopediafantasy lifeend credits roll callsiren the alarmreference to jane austenafipsychiatric nursehidden characterimaginary creaturetitle character not the main characterolder sister younger brothercarefreesanity hearingpooka (See All)

Away We Go (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Away We Go (2009)

Burt Farlander and Verona De Tessant are a couple steeped in eccentricity and irregularity but are very much in love. So when they find out that Verona is pregnant they seem to be taking it in their stride. Verona is enjoying pregnancy, Burt is already practicing skill that he believes a good father β€¦ should have, and they living in the same state as Burt's parents, Jerry and Gloria, so that their prospective daughter can have grandparents. However, things are shaken up when Burt and Verona go to dinner at Jerry and Gloria's house, as Burt's parents reveal a surprising piece of news. They have decided to move to Antwerp in Belguim a month before the baby is due, scuppering Burt and Verona's plans of having their children's grandparents around. Because Verona lost her parents when she was relatively young, she finds this news very hard to take, but the resilient couple quickly find a way to turn it in to a positive. It becomes obvious that this is what the pair needed, as they decide to embark on a search for the right place for them to raise their daughter. They go to every place they can think of, meeting family and friends along the way, with laughter and sadness, this is a road trip the couple will never forget. (Read More)

Themes:
friendshipmarriagepregnancylesbianismdrinkingadoptionself obsession
Mood:
train travel
Locations:
barrestauranttrainswimming poolhotelairplanebathtubnightclubdesertairportroad tripbaseballmotel
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipchildrensingerbrother brother relationshipboygirlbabysister sister relationship β€¦artistinterracial relationshipbibleprofessoruncle niece relationshipaunt niece relationshipchildhood friendmother in law daughter in law relationshipinsurance agentself righteousnessstudent protest (See All)
Story:
pancaketrampolinesexinterviewkissphotographsingingthree word titletelephone callcryingcell phone β€¦songunderweartesticlesfoodwatching tvdrinkbeertearssunglassescafeprayerstripperflashlightcandleeatingman with glassessearchjourneytreeprologueon the roadstorytellingchildbirtheyeglassesice creammonologuedemonstrationbeardblack humorhomepromiseinterracial romancecynicismmobile phonejob interviewironymiami floridasexual humorclassmatedead motherbrushing teethpajamasmiscarriagebreast feedingepisodic structuredead fathergolf clubfruitflaskcoloradowhisperingmale stripperbelgiumbunk bedtrain ridebourgeoisieinterracial couplehiding under a bedparentingbiracialcross countryroadtripgogglesinterracial adoptionexpectant mothersaying gracefather in law daughter in law relationshipbedtime storysing alongexpectant fatherwhite male black female relationshipphoenix arizonamidwifereference to bob dylanliving togetherdead parentsheartbeatwood carvingstar spangled bannerchildhood homelullabymontrealillustratorpineapplestuffed animal toytucson arizonacross country tripsonogrampole dancetrain compartmentknotjazz combobaby strollerunborn childdog racedog racinginsurance salesmanantwerp belgiumreference to huckleberry finngreyhoundorange the fruitsugar cubeunderachievergreyhound racingsense of tasteuterusslippersheaterpregnant sisterself examinationmadison wisconsinmaple syrupunmarried coupledisguised voicereference to simone de beauvoirorange treecobblerheart rate monitoridiosyncrasypeople mover (See All)

The Celebration (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Celebration (1998)

The Father turns 60. His family, which is a big one of the kind, gathers to celebrate him on a castle. Everybody likes and respects the father deeply...or do they? The youngest son is trying to live up to the father's expectations. He is running a grill-bar in a dirty part of Copenhagen. The oldest  β€¦son runs a restaurant in France, while the sister is a anthropologist. The older sister has recently committed suicide and the father asks the oldest son to say a few words about her, because he is afraid he will break into tears if he does it himself. The oldest son agrees without argument. Actually he has already written two speeches. A yellow and a green one. By the table, he asks the father to pick a speech. The father chooses green. The oldest son announces that this is the Speech of Truth. Everybody laughs, except for the father who gets a nervous look on his face. For he knows that the oldest son is about to reveal the secret of why the oldest sister killed herself. (Read More)

Subgenre:
cult filmblack comedyfamily drama
Themes:
murderfriendshipsuiciderapepregnancydrinkingdrunkennessfuneralincestmemoryracismdepressiondysfunctional familysexualityhumiliation β€¦abuseabortionprejudicehuntingdeath of daughterfather daughter incestsuicide of daughter (See All)
Mood:
satire
Locations:
restauranthotelbathtubwaterairportkitchen
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerbrother brother relationshipbrother sister relationshipdancerchristianbullywaitress β€¦interracial relationshipdaughterfatheruncle nephew relationshipgrandfather grandson relationshipgrandmother grandson relationshipgrandmother granddaughter relationshipuncle niece relationshipgrandfather granddaughter relationshipparent child relationshipsuicide by drowningalcoholic drink (See All)
Story:
imaginary friendchild abusedancingsexfemale nuditymale nudityviolenceone word titlebondagekissfightcigarette smokingsingingparty β€¦telephone callcryingcell phonesongbeatingunderwearfoodblondeface slapdrinksecretlettervomitingshowdowntearsbirthdaybathroompianohallucinationalcoholcookingwinecandleold maneatingdinnerapologychilddrawingbirthday partybathcoffeeracial slurknocked outspeechpianistdisappearancereunioncharacter says i love youtwinpsychicscandalsexual abuseragecookservantbreakfastembarrassmentcelebrationinterracial romancehaunted by the pasttensionhypocrisysonkickingdespairpedophiledrunkdeath of sisterfallracistboarding schooltuxedofamily secretpedophiliacafeteriafamily reunionlectureblonde womanestatedrunken manwhistleshoutingreceptioniststonedtoastgiving a toastman punching a womanrespectloss of sistercountry housespitanthropologynervousnessgravestonecircular staircasehypocriteriddletwin sisterretributionfather son conflictchild rapeman hits a womansocialistman slaps a womanman slaps womantied to a treepatriarchcaught in the actfamily gatheringsenilitydogme 95danish blondeman hits womantaxi ridecar keysalcohol abusefalling asleeprestaurant ownerreference to alfred hitchcockcountry estatewine cellarostracismdawnman punches a womancompanionlodgefreemasoncognacprodigal sondirty old mandisgracedisrespectdisgustshower curtaindrowning in a bathtubupstairs downstairsspontaneous sexwearing clothes in a bathtubbirthday dinnerfather son incestdeath of twinbanging on a doordanish culturefather sondismaysuicide of sisterdisdaindaybreakexcessive drinkingvenison60th birthdayhotelierpater familiasreference to little black sambo (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Surf's Up (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Surf's Up (2007)

This story follows a teenage rock hopper penguin named Cody Maverick from his hometown of Shiverpool, Antarctica, where all of the other penguins think he's nothing but a surfing fool, to the "Big Z Memorial Surf Off" on Pen Gu Island. Young Cody is determined to win the most important competition i β€¦n the world of penguin surfing in honor of "Big Z," a deceased surfing legend whom he has idolized since childhood. But the waves in Pen Gu are different than in Shiverpool, and the competition is steep. The current champ, egotistical Tank Evans, isn't just about to let this little penguin knock him from first place without a fight. When Cody wipes out and encounters Geek, a recluse aging former surfer, living in the jungle, he learns some important lessons about life and surfing, and even teaches Geek a thing or two. (Read More)

Subgenre:
mockumentarycomputer animationfake documentarycgi animation
Themes:
friendshipsurrealismrivalry
Mood:
breaking the fourth wall
Locations:
beachoceanjungle
Characters:
family relationshipsmother son relationshipsingle mother
Story:
competitionflashbacktitle spoken by characterpunctuation in titleurinationsecretapostrophe in titleislandbirdscene during end creditschickensurfingvolcanotrophysurprise after end credits β€¦whalepenguinsurfersurfboardlifeguardrescue from drowningscatological humorantarcticaanimal protagonistukuleleotterigloosea urchinsportsmanshipinstant replaywipeout (See All)

Spanglish (2004) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Spanglish (2004)

John Clasky is a devoted dad whose skills as a chef have offered his family a very upscale life, including a summer home in Malibu and a breathtaking new Mexican housekeeper, named Flor. She and her daughter Cristina have recently emigrated to L.A. from Mexico and are trying to find a better life. W β€¦hen they move in with the Claskys for the summer, Flor has to fight for her daughter's soul as she discovers that life in a new country is perilous! (Read More)

Subgenre:
independent film
Themes:
marriageinfidelitymoneyadulterydrinkingdrunkennessextramarital affairdysfunctional familyguiltunfaithfulness
Locations:
beachrestaurantcarlos angeles californiabuskitchenmexicoschool bus
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipsingerboygirlreference to godalcoholicmaidcatholichispanicself esteem
Story:
private schoolsexdogkisssingingshowertelephone callvoice over narrationcryingcell phonesongunderwearfoodwatching tvdrink β€¦lettertearsrunningcafecollegeprayernewspaperwomaneatingimmigrantimmigrationscreamingstorytellingmanipulationconvertibleautomobileclass differencessingle parentflirtingjeepjoggingcooknosebleeddysfunctional marriagechefculture clashspanishobesityjob interviewshoppinghousekeeperillegal immigrantpromiscuityvodkainsecuritylanguage barriercadillacrealtorneuroticemigranttranslationaudimalibu californiamexican immigrantplaying against typedry cleanersreference to george lucasmonopoly the board gamefood criticprinceton universityenglish lessonsummer homenight jobspanglishreference to herbert hooverchild translates for adultcadillac escaladeaudi a4college admissionjeep grand cherokeeunable to speak english (See All)

Shine (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Shine (1996)

As a child piano prodigy, 'David Helfgott' (qv)'s musical ambitions generate friction with his overbearing father, Peter. When Helfgott travels to London on a musical scholarship, his career as a pianist blossoms. However, the pressures of his newfound fame, coupled with the echoes of his tumultuous β€¦ childhood, conspire to bring Helfgott's latent schizophrenia boiling to the surface, and he spends years in and out of various mental institutions. (Read More)

Subgenre:
independent filmtragedy
Themes:
loveweddingmental illnessabuse
Mood:
rainnight
Locations:
beachrestaurantswimming poolbathtubtaxiaustraliacity
Characters:
family relationshipsfather son relationshipmusicianjewishreference to godjewyounger version of characteraustralian abroad
Period:
1950s
Story:
trampolinechild abusenudityone word titlecigarette smokingblondecomputercatcameraletterpianonewspaperconcertapologyman with glasses β€¦bathunderwater scenecigar smokingmarriage proposalumbrellapianisttypewriterrecord playerscene during opening creditsjoggingblockbusterpoolsouth australiaclassical musicvisitschizophreniamental institutiongirl with glassesabusive fatheropening a doornervous breakdownriding a bicycleplaying pianotelling someone to shut uplooking out a windowboy with glassesknocking on a doortaking a bathlying on bedlighting a cigarettepostmanjumpingwaking uphandbagdriving at nightchild prodigydomineering fatherscrapbookchopping woodreading a letterjewish familylooking at picturehair dryershaking handswoman driverlooking in a windowplaying chessconcert hallclipboardclimbing stairsgoing homeabusive parentastrologeraustralian manreference to liberaceknocking on a windowelectroconvulsive therapycheck booklighting a cigarpiano concertoletterboxschizoaffective disorder (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Antwone Fisher (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Antwone Fisher (2002)

A sailor prone to violent outbursts is sent to a naval psychiatrist for help. Refusing at first to open up, the young man eventually breaks down and reveals a horrific childhood. Through the guidance of his doctor, he confronts his painful past and begins a quest to find the family he never knew.

Subgenre:
autobiographicalblack independent film
Themes:
murderrobberyangerredemption
Locations:
restaurantchurchhotelairplanenightclubshipmexico
Characters:
mother son relationshipafrican americanjapanesepsychiatrist
Story:
pancakechild abusecharacter name in titleflashbackkissfightbeatingjailgay slurdream sequenceracial slurdirected by stardateex convictblack american β€¦poemconvenience storebookstoresailorextortiongunfirethanksgivinggraduationfamily reunionchild molestationnavyu.s. navysan diego californiachild abandonmentcleveland ohiofoster homemother son reuniontemperdirected by co starwheatlocustbrigsearch for familydemotiondisciplinary hearingshore leave (See All)

Lars And The Real Girl (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lars And The Real Girl (2007)

In this comedy, Lars Lindstrom is an awkwardly shy young man in a small northern town who finally brings home the girl of his dreams to his brother and sister-in-law's home. The only problem is that she's not real - she's a sex doll Lars ordered off the Internet. But sex is not what Lars has in mind β€¦, but rather a deep, meaningful relationship. His sister-in-law is worried for him, his brother thinks he's nuts, but eventually the entire town goes along with his delusion in support of this sweet natured boy that they've always loved. (Read More)

Subgenre:
coming of ageblack comedydark comedy
Themes:
deathfriendshipjealousypregnancydrinkingfearfunerallonelinessguiltgriefmental illnessdyingdeath in childbirth
Locations:
hospitalrestaurantchurchsnowcemeterysmall townbathtubrural settingwheelchairlakeofficeoffice party
Characters:
family relationshipshusband wife relationshipfather son relationshipboyfriend girlfriend relationshipdoctorsingerbrother brother relationshipdancerpriestlove trianglebrother in law sister in law relationship
Period:
winter
Story:
blanketdancingcharacter name in titlephotographsingingpartytelephone callsongfoodcomputerdrinkcafeneighborflashlightambulance β€¦eatinginternetdinnerbathgraveyardmarriage proposalflash forwardgravedollreadingflowersisolationgaragerecord playerpsychologistteddy bearrejectionanxietyheadphonesco workerdelusionfirst kisschoirsnowingbowlinggrowing updead motherbrushing teethsirenearphoneshandshakeshynesswebsitephysiciantombstonebowling alleyreverendresponsibilitynoosetolerancewakegravestonetreehousehymnvending machineschizophrenicscrabblechurch servicechopping woodemergencysex doll911phonograph recorddoctor's officeaction figureintrovertcounselingchurch choiranxiety attacklutheranartificial respirationspring the seasonmother dies in childbirthmail orderchild likeineptloss of confidenceaphephobiagrowing painsimaginary girlfriendin love with an inanimate objectlifesize dollcommunity support (See All)

Dinner For Schmucks (2010) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dinner For Schmucks (2010)

Tim (Rudd) is a rising executive who "succeeds" in finding the perfect guest, IRS employee Barry (Carell), for his boss's monthly event, a so-called "dinner for idiots," which offers certain advantages to the exec who shows up with the biggest buffoon.

Themes:
friendshipjealousyhumiliationbullyingexploitationblindnessobsessive compulsive disorder
Characters:
employer employee relationshipfriendboyfriend girlfriend relationshipbullyex boyfriend ex girlfriend relationshipfrench kiss
Story:
competitiondancingnuditymale nuditymale frontal nuditybare chested malekisslieclitorisdinnerman with glasseshit by a carbusinessmanhairy chest β€¦eyeglassesnerdmousesevered fingervegetarianchairpublic humiliationsports carnaivetyxbox 360porschebow tievulturedareidiotjob promotionreference to john lennonventriloquistremake of french filmhobbytaxidermyridiculecorporate worldinternal revenue servicefemale stalkerreference to nelson mandelairsauditdioramadead mousereference to morgan freemanventriloquist's dummyart curatorfalse pretensereference to baudelairefencerfake british accentmental disabilityindignityswedish accent (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kiss Kiss Bang Bang (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kiss Kiss Bang Bang (2005)

A petty thief posing as an actor is brought to Los Angeles for an unlikely audition and finds himself in the middle of a murder investigation along with his high school dream girl and a detective who's been training him for his upcoming role...

Subgenre:
cult filmblack comedy
Themes:
murderdeathfriendshipsuicidekidnappingchristmasmoneydrinkingtorturedrunkennessfuneralfilmmakingincestrobberytheft β€¦surveillancehomophobiachildhood (See All)
Mood:
satireneo noircar chase
Locations:
hospitalnew york citybarbeachswimming poolhotelairplanelos angeles californiabusnightclubairportpolice carlakerooftopmotel
Characters:
employer employee relationshipnative americanfather daughter relationshiphomosexualfather son relationshippolicemother daughter relationshipfriendboyfriend girlfriend relationshipteenage girlteenage boyteacherdetectivepolicemanactor β€¦sister sister relationshipthiefactresslustuncle nephew relationshippolice shootoutsuicide by gunshotold frienddream girlairplane stewardesshomosexual kissgay detective (See All)
Period:
christmas party
Story:
child abusefemale nuditybased on novelbloodviolencefemale frontal nudityflashbackdoggunkissfightcigarette smoking β€¦partyleg spreadingsurprise endingerectionpantiespistolvoice over narrationfondlingcell phoneshootoutbeatingcorpseshot to deathunderwearblood splattercar accidentshot in the chesturinationblondeshot in the headshotgunpunched in the facewatching tvdrinkundressingfalling from heightshootingbooklierunningdead bodybathroomrobotrevolvermanhattan new york cityshot in the backswimmingcleavagegay slurambushvideo camerabridgefemale pubic hairfishnonlinear timelineanti heroscantily clad femalecoffindrawingunderwater scenevantalking to the cameraattempted murderprologueelectrocutionauditionreadingchristmas treebaseball batshot in the shoulderfemale removes her clothescheerleaderwitnessdirectorial debutshot in the armbearsleepingcross dressingtrustgirl in pantiesrunawayprivate detectivechainsawicetv newsdestinyno pantiesnipples visible through clothingbreaking and enteringwoundrepetition in titlecookelephantmagicianpatientstealingsanta clausspidercarnivalfatechokingmental institutionretirementburglarsevered fingerbuddyburglarykicked in the crotchmental hospitalnovelistframe upaccidental killingdeath of sisterfilm producercanered pantiesabusive fatherreckless drivingdead girlvideo surveillancemental patientface masknotebookrobberset uppedophiliacremationnovelpistol whipfemale removes her dressfilm crewchild molestationtv commercialyoung version of characterlawsuitcliniccredit cardbeach housecookiemissingswimming underwaterepiloguehearserussian roulettecluetimes square manhattan new york cityrainbowhiding under a bedchapter headingsbaltimore marylandborn again christianportdiceprivate eyecasketfinding a dead bodyfleeingindianaluggagepassing outfingerhigh school friendcricketsearch for fatherfoster careanimated opening creditsfalling asleepplastic bagbiological fatherrobbery gone awryreference to marlon brandogay straight relationsdenver coloradochristmas decorationmorse codeneonscreen testhotel desk clerkvenice beach californiadead body in a car trunkfalling off a balconyi.d.reference to imdbairplane ticketreference to kurt cobainderringerelectrical torturemagic actartificial respirationmethod actingelvis presley impersonatortheatre marqueetv announcerstage nameparking attendantdetective sergeantreference to gene kellybirth control pillgay straight alliancedoodlingsawed in half magic actwood pilebreaking someone's noselunch wagonprobabilitythe one that got awayaging parentdemerolreference to joe pesciwiping off fingerprintspie eating competitionreference to olivia newton johnpain pillreference to drew barrymoreslamming a door on someone's fingersthrowing a drink glassurinating on a dead body (See All)

Antitrust (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Antitrust (2001)

This movie is the fictional story of computer programming genius Milo Hoffman after graduating from Stanford and getting out into the competitive world of computer software. In his contemplation of where to begin his career, he is contacted by Gary Winston whose character is loosely based on Bill Ga β€¦tes. Winston is the CEO of a company called NURV, and they are on the brink of completing the global communication's system, Synapse. They need Hoffman to help them meet their launch date, so after much thought and with the full support of his girlfriend Alice, he accepts the job. Tragedy soon after strikes and Milo becomes suspicious of the company he has been wrapped up in. He learns that trusting anyone could be a mistake, and that nothing is as it seems. (Read More)

Subgenre:
conspiracy
Themes:
home invasionmurderdeathfriendshipbetrayalinvestigationdeceptionparanoiasurveillancewealth
Mood:
car chase
Locations:
barrestaurantroad trip
Characters:
employer employee relationshipboyfriend girlfriend relationshipartistbest friendsecurity guardvillainbabe scientist
Period:
2000s
Story:
competitionviolenceone word titlephotographexplosionpartychasesurprise endingpistolbeatingcomputerarrestkissingpaintingheld at gunpoint β€¦bombcafehandcuffsfoot chaseflashlightcookingdeath of friendmontageinternetman with glassesdouble crossfemme fatalenews reportracial slurcharacter repeating someone else's dialoguebeaten to deathfbiproduct placementrace against timecover upbaseball batbusinesssuspicioncharacter says i love youex convictnewspaper headlinetrustgaragehenchmanscandalsabotageheavy rainsecurity cameravandalismhidingeccentricwristwatchphone boothpress conferenceinterracial friendshipbossconstruction sitesenatorcorporationsecret identityjobalarm clockgovernment agentgeniusmedia coveragetracking devicehit with a baseball batsatellitevideo surveillanceex copadvertisementwebsitecomputer crackeridealismbillionaireboy with glassessecurityhate crimeentrepreneurtimes square manhattan new york citytv studiohigh technewscastinternet domain in titleallergymugshotfundraiserceofingerprintportland oregonevil corporationcorporate crimechopsticksmob of reportersnight watchmanvisionarycomputer programmerracist commentnurserymotivational speakeridealistgraduatewebcastcomputer discsoftwarecollege graduatecollege graduationmicrosoftsilicon valleyemployee employee relationshippirate broadcastingbomb makingfirst jobcommunicationsinformation technologywriting on wallcomputer geniuscomputer roomu.s. justice departmentwhiz kidweb designercomputer programmingcommunication satellite (See All)

Au Revoir Les Enfants (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Au Revoir Les Enfants (1987)

In 1944, upper class boy Julien Quentin and his brother Francois travel to Catholic boarding school in the countryside after vacations. Julien is a leader and good student and when the new student Jean Bonnet arrives in the school, they have friction in their relationship. However, Julien learns to  β€¦respect Jean and discovers that he is Jewish and the priests are hiding him from the Nazis. They become best friends and Julien keeps the secret. When the priest Jean discovers that the servant Joseph is stealing supplies from the school to sell in the black market, he fires the youth. Sooner the Gestapo arrives at school to investigate the students and the priests that run and work in the boarding school. (Read More)

Subgenre:
semi autobiographical
Themes:
deathlovefriendshipchristmasreligionbetrayaljealousydrinkingfearescapetheftbrutalitycommunismwealthcourage β€¦starvation (See All)
Mood:
nightmare
Locations:
restauranttrainschoolchurchsnowmotorcycleparis francebathtubbicycle
Characters:
husband wife relationshipfather son relationshipmother son relationshipfrienddoctorsingerbrother brother relationshipboybrother sister relationshipteachernursepriestthiefchristianjewish β€¦reference to godbullybiblejewcatholicrussiangermanamericangerman soldier (See All)
Period:
world war two1940s
Story:
blanketprivate schoolcompetitionbloodmasturbationfightcigarette smokingphotographsingingchaseerectiontelephone callcryingsongunderwear β€¦foodmirrorurinationdrinkarrestundressingsecretletterbooklietearsbombrunningbathroompianobritishreference to jesus christclassroomprayerorphanflashlightwinecandlewidowprisonermapdinnernunchilddrawingbathsearchconfessionfired from the jobliarreadingrabbitpianisttragic eventpigclasssleepinghatetraitorwolflistening to musicfaintingcookmouseexercisestealingcommunisthidingwatching a moviemagazineviolinmonktowelanti semitismbombingresistancehatredironycharitynewsreel footagelostbathingatticboarding schoolcapturevoice over lettersnowingclassmatelanternbrushing teethpajamasviolinistheroismpiano playersermondormitoryaccountantcrucifixiongreekbandagepostcardlockerblackoutbreadmathematicsmilitiafilm projectorjerusalemblack marketconventrumorschoolboypush upsteasinglatintreasure huntmaileasterauschwitzcowardnazismbourgeoisiepersecutionroofair raidinformernazi occupationprophetpotatoheadmastermassdressingmusic teachergestapoboarcowardicetied to a treebarracksprotestantred crossgerman occupationholy communionreference to charlie chaplincurfewromanfreezinglord's prayerwet dreamboy scoutdining hallpiano teacherstovegraceinfirmarylimpingwehrmachtkiss on the foreheadcollaboratorpiano lessonschoolmatefrench resistanceknife woundwashroomplayingbed wettingreference to allahmalnutritionfastingfrostbiteiciclestampodorhereticfood shortagesabbathdraft dodgerpublic bathhard onjamconfirmationhail maryvichyair raid sheltercombing hairpiano duetmoor the landscapeprovincial settingstiltssugar cubearabian nightschoir practicewild pigthree musketeersalsatianbavariananemiajuvenile bedwettingfrench literaturemauthausenalgebraass kissingboogie woogiepiano accompanistsaracencarmelitehorse meatsalamiblack knightcod liver oilarithmeticreference to richard the lionheartschool vacationwhooping cough (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

August: Osage County (2013) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

August: Osage County (2013)

Violet Weston ('Meryl Streep' (qv)) has cancer and a propensity for pills and alcohol. She's a difficult woman to deal with and her husband has finally had enough. Violet's family gathers including middle daughter Ivy, youngest daughter Karen (with her new fiance), eldest daughter Barbara (with her  β€¦separated husband and teenage daughter), and her sister Mattie Fae (with her husband and son in tow). A family tragedy causes tensions to run high and secrets to come out. The Weston women will be forced to examine themselves and their lives whether they want to or not. Welcome to Osage County, Oklahoma in the sweltering heat of August. (Read More)

Themes:
deathsuicidemarriageinfidelitydrugsmoneyadulterydrinkingfearfuneralincestmemoryextramarital affairangerdivorce β€¦death of fatherdrug usedysfunctional familycancerguiltunfaithfulnesshumiliationpoetryalcoholismdrug addictionsuicide of father (See All)
Locations:
churchbusmotel
Characters:
native americanfamily relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipdoctorsingerteenage girlsister sister relationshipreference to godsheriffcousin cousin relationshipuncle nephew relationship β€¦grandmother granddaughter relationshipuncle niece relationshipaunt niece relationshipsuicide by drowningself righteousnessmother with cancer (See All)
Story:
child abusekissfightcigarette smokingphotographsingingthree word titleerectionbased on playtelephone callcryingsongcorpsefoodmirror β€¦face slapdrinksecretbookvomitingliebeertearssunglassesplace name in titledead bodypianoreference to jesus christprayerfightingtelephonef wordsubjective camerafoot chasewinefalse accusationapologydrowningpaindrug addictprologueliarstorytellingdisappearancewigcrossdeath of husbandpoetrecord playerterminal illnesspickup truckeyeglassespoempot smokingaddictionlooking at oneself in a mirrorlistening to musicsociopathrecordinghammerwristwatchbrother sister incestcheating husbandcrying manwatching televisionwhiskeypillssufferingbootsthundercynicismshovelensemble castsibling rivalrypedophiletitle at the endvegetariancellphonemarital separationfamily secretmarital problemsports carswearinglocation in titleauctionpedophiliascene before opening creditslast will and testamentmeatbitternessundertaker14 year oldknocking on a doorcowboy bootsgramophoneteenage daughtersense of smellhit with a shovelbechdel test passedfamily homesuicide notegrudgehalf brotheroklahomaverbal abusesaying graceabusive motherchemotherapymissing fatherreference to santa clausfamily gatheringbritish actor playing american characterhusband wife conflictmatriarchwearing sunglasses insidelove songsweatingorganistemotional abusebook burningreference to elizabeth taylorimplied incestprecociousnessthree sistersoverhearing a conversationsecret revealedprescription drugsabusive parentapple pielesbian slurc wordincestuous relationshipfamily argumentparent grown child relationshipreference to liberaceend credits roll callmissing husbandparakeetthree generationsephebophileclaw hammermother slaps daughteroversleepingsiblings living togetherchicken as foodliving in a carcharacter says go to hellsuicide of husbandcounty name in titlecousins in lovetony award sourcehysterectomyreference to eric claptonreference to sophia lorenbroken marriagefish as foodrebellious teenagerbreaking dishescasserolefamily matriarchhair falling outfamily mealfemale slaps femalehired helpwarmthorgan the musical instrumentdeath in the familymeannessreference to lena hornecervical cancercharacter says i hate youcheyenne tribereference to pippi longstocking (See All)

Little Women (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Little Women (1994)

'Louisa May Alcott' (qv)'s autobiographical account of her life with her three sisters in Concord, Massachusetts in the 1860s. With their father fighting in the American Civil War, sisters Jo, Meg, Amy and Beth are at home with their mother, a very outspoken women for her time. The story tells of ho β€¦w the sisters grow up, find love and find their place in the world. (Read More)

Subgenre:
coming of age
Themes:
deathmarriagechristmaspregnancydysfunctional familyillnesstheatrehopewritingfirst love
Mood:
affection
Locations:
new york citysnowparis francerural settingusa
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipmother daughter relationshipdoctorsingerteenage girlfemale protagonistgirlsoldierbabywritersister sister relationshipartistlittle girl β€¦maidprofessorpregnant wife (See All)
Period:
winter19th century1860s
Story:
child abusedancingf ratedbased on novelsingingpartytitle directed by femalecatletterpaintingtearsneighborpianooperacandle β€¦old manpaintervoice overmarriage proposalbinocularscostumechristmas treepianistchildbirthreunionstageactingtwinreference to william shakespearecivil warfireplacedressbirthrealitypet dogfeministchristmas evemay december romanceice skatingyoung loveboarding schoolgrowing upplayhorse and carriageviolinistvictorian eragiving birthtriple f ratedepidemicpublisherreading aloudtween girltomboysicknessenvykittenmailboxtutoramerican civil warbroken heartloss of sistermassachusettsmanuscripttelegramhorse and wagonpet catexpectant motherchristmas carolhomeworkboarding housechristmas decorationsnightgownsheet musicreference to charles dickensgovernessoil lampstorytellerchalkboardfalling through icebuggyboarderu.s. civil warpost civil warfood shortagecurlingcanvasreference to walt whitmanreference to goethepantaloonemotional healingpregnant sisteremotional depressionreference to friedrich schillerscarlet feversnow sleddingbirth of twinsdance ball (See All)

Two Days, One Night (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Two Days, One Night (2014)

Sandra Bya, married with two children, has been off work from her job at Solwal on medical leave for depression. During her absence from work, her boss, M. Dumont, on the suggestion of her immediate supervisor, the shop foreman Jean-Marc, figures that her section of the company can function with six β€¦teen people working full time with a bit of overtime instead of seventeen with no overtime, that seventeenth person being Sandra. Because of the global competition the company faces, Dumont decides the company can only finance the annual bonuses for those sixteen employees, which are EUR1,000 per person, or Sandra's job, leaving the decision to those sixteen. On a Friday near the end of her medical leave, Sandra learns of this situation from her friend and co-worker Juliette after the "show of hands" vote is held, the result a 13-3 decision for the bonuses over Sandra's job. Because Juliette knows Jean-Marc, who is determined to get rid of Sandra, influenced the vote by scare mongering through misinformation, Juliette and Sandra, at the end of the working day on Friday, are able to convince Dumont to hold another secret ballot on Monday morning, with Sandra needing a majority to keep her job, meaning nine votes. By Saturday morning, Sandra's supportive husband, Manu, convinces her that over the weekend she should speak to each and all of the thirteen who voted for the bonuses to get them to change their minds. The Byas not only need the income from Sandra's job but Manu believes th… (Read More)

Subgenre:
independent film
Themes:
friendshipmarriagemoneyfearpovertydepressionguiltillnessgreedunemploymentregrethospital food
Mood:
nightmarenight
Locations:
hospitalbarrestaurantbussinging in a car
Characters:
employer employee relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipdoctorboybrother sister relationshipfemale protagonistgirlbabyreference to god β€¦asking for forgiveness (See All)
Period:
2010s
Story:
competitionf ratednumber in titlekissfighttelephone callcryingcell phonemirrorpunched in the facecomputervomitingliebathroomsoccer β€¦braambulancewomaneatingfour word titlesuicide attemptapologybirdlocker roomfired from the jobfactoryrace against timecharacter says i love youeuropestrong female characterpizzaitalianhugginglooking at oneself in a mirrorice creamcookcrying womanproduced by directorstrong female leadfatemoralitydrug overdosegrocery storepillspower outageanxietydespairco workermedicationpridelooking at self in mirrorinjusticejobmarital problemabusive husbandshamecontractman cryingmental healthelectricityloss of jobstuffed animalcafeteriamoney problemseconomydoubteconomicslockerstairwaytime in titlelaundromathospital bedyoung womanknocked unconsciousbelgiumworkshopfactory workerkindnessauto mechanicsleeping in a carweekendlabor unionnervousnesscar radiovotedeterminationintercompanic attackmortgagebottled watereconomic crisishumanismdoor bellhousing projectlooking for a jobhospital visitpitystubbornnesssoccer coachaddressworking momanxiety attackauto repaireuropatiotwo directorsbonusnight drivingbolt upright after nightmareasking for helpforemantelephone bookballotshot in sequencexanaxsalarysolar panelentitlement48 hoursfather son fightsick leaveliege belgiumcollapsing to floormanufacturing plantprescription drug overdosebenzodiazepinekitchen workersecond job (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Maps To The Stars (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Maps To The Stars (2014)

The Weiss family is the archetypical Hollywood dynasty: father Stafford is an analyst and coach, who has made a fortune with his self-help manuals; mother Cristina mostly looks after the career of their son Benjie, 13, a child star. One of Stafford's clients, Havana, is an actress who dreams of shoo β€¦ting a remake of the movie that made her mother, Clarice, a star in the 60s. Clarice is dead now and visions of her come to haunt Havana at night... Adding to the toxic mix, Benjie has just come off a rehab program he joined when he was 9 and his sister, Agatha, has recently been released from a sanatorium where she was treated for criminal pyromania and befriended a limo driver Jerome who is also an aspiring actor. (Read More)

Themes:
murderdeathsuicidemarriagedrugsmoneyghostjealousydrinkingfearfilmmakingincestmemoryseductionanger β€¦theftpsychopathparanoiadrug usedysfunctional familyhumiliationillnessmental illnessaidsdrug addiction (See All)
Mood:
satirenightmare
Locations:
hospitalrestaurantswimming poolairplanelos angeles californiabathtubbussex in a car
Characters:
employer employee relationshipfamily relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipsingerbrother sister relationshipteenage boydanceractorwriterthiefactress β€¦reference to godlittle girllittle boyjewfilm directormother daughter incest (See All)
Story:
child abusedancingsexfemale nuditynuditybloodmale nudityviolencethreesomeinterviewmale frontal nuditymasturbationmale rear nudity β€¦doggunkisscigarette smokingmale full frontal nuditysingingerectionlabiafirecryingsongblood splattertesticlesmirrorurinationwatching tvdrinkundressingbookvomitingliebeertearssunglassescafehallucinationreference to jesus christmale pubic hairrevolversubjective camerastrangulationtoiletapologychilddrowninglimousineargumentscreamingauditionmassagestorytellingreadingringdiarytragic eventfilm within a filmdeath of sonhauntingprofanitysleepinggrandmothertherapyarsonpoemanswering machinebabysittersexual abusepatientdrug abusehollywood californiakicked in the stomachcrying womantherapistpsychologyflatulencebrother sister incestyogahaunted by the pastmale masturbationblood on facehatredshoppingblack and white scenemakeupdead childfilm setmurder of a childwedding ringcellphoneinsulthousekeeperabusive fatherdead mothersports carblack bra and pantiesarrogancepillchauffeurinterrupted sexshynessmenstruationnotebookapparitioncastingreference to facebookkilling a dogglovesreading aloudlooking out a windowvulgarityshouting18 year oldburnt faceknocking on a door13 year old16 year oldaccidental shootinghead bashed innarcissismhollywood signsense of smellfilm studiourinalreference to googlereference to twitterfacial scarnervousnesssleeplessnessman on firewhite dressblack dressschizophrenicburn victimrehabbludgeoningescaped mental patientoverhead shotaspiring actorcowardicesafe sexdriver's licenselibertybeverly hills californiapersonal assistantfired from a jobanswering machine messagedoorbellreference to oprah winfreyjoke tellingman punches a womanrudenesssmoking in bedpenis slursuicide pactabusive stepfatherkiss on the foreheadred bra and pantiestheatrical agentfalse memoryinfluenzarestraining ordercasting directoroverbearing fatherreference to mother teresabludgeoned to deathmenstrual bloodwatching a movie on tv9 year oldchild starlaxativeaccidental incest23 year oldmenopauseageismreference to imdbsobrietybloodstaindouble suicideprescription drug abuseenergy drinkfan the personhollywood walk of famecellular phonesex in limousineanti semitic slurgreen pantiesreference to ebaydetoxwoman sitting on a toiletname droppingreference to harvey weinsteinslurmassage therapistreference to the academy awardsreference to the internetself indulgenceconstipationdysfunctionalityjewish slurreference to carl jungreference to shirley templesheepdogburning bodychoking someonereference to al gorereference to the dalai lamachild ghostthrowing a cell phonewoman on firereference to ryan goslingwet dressincest overtonereference to hboreference to jim carreyreference to lance armstrongreference to robert downey jr.applying for a jobflushing drugs down a toiletreference to ryan seacrestreference to the golden globesbronchitisdrowned bodymeannessreference to nicole kidmanschadenfreudestage mothertampaxcraft service tabledoting mothermale divapersonal managerreference to halle berrysexual insultreference to bernardo bertolucciwedding vowsbreakfast burritolong black glovesreference to anne hathawayreference to drew barrymoresex with a client (See All)

The Tailor Of Panama (2001) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Tailor Of Panama (2001)

John LeCarre's spy thriller is brought to the big screen. A British spy is banished to Panama after having an affair with an ambassador's mistress. Once there he makes connection with a local tailor with a criminal past and connections to all of the top political and gangster figures in Panama. The  β€¦tailor also has a wife, who works for the canal administrator, and a huge debt. The spy's mission is to learn what the President intends to do with the Panama Canal, but he's really in business for himself, blackmailing the tailor into spinning a fantastic tale about the canal being sold to China and former mercenaries ready to topple the current government. (Read More)

Subgenre:
political satiredocumentary footage
Themes:
deathlovesuicidemarriagemoneypoliticsdrinkingdrunkennessescapeseductioncorruptionblackmailinheritance
Mood:
rainnightmarecar chase
Locations:
restauranthelicoptercemeteryairplanefarmbrothelgay bar
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipchildrensingerdancerjewuncle nephew relationshipengineersuicide by gunshot
Story:
pancakedancingbased on novelbloodmale nudityviolencefemale frontal nudityflashbacksex scenecigarette smokingsingingchasetelephone callfire β€¦songbeatingunderwearmirrorcomputercameraliebirthdaycafesex standing upneighborhallucinationswimmingspynewspaperbandbridgemapbirthday partygraveyardgraveliarpay phoneumbrellasuitcasedebtbankpresidentex convictsecret agentfireworksbuttockswatching televisionintrigueschool uniformdressing roomlandlordmisogynistspiral staircaseterritory name in titlesuitbankerdrug traffickingembassyambassadormotorboatmoney launderinghammockhoaxtailorcanalmortgagecountry in titlereference to frankensteinfollowingbritish secret serviceirishmansweatshoppanamainsurance scamshippingmen's clubpanama canaltalk to the deadvibrating bedpentagon buildingbritish embassybritish ambassadorpanama city panama (See All)

Charlie Bartlett (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Charlie Bartlett (2007)

Although cheerful, friendly, intelligent, well-dressed, authentic and wealthy, Charlie Bartlett has problems. With his father gone and his mother loopy and clueless, he's been expelled from every private school for his victimless crimes. Now he's in a public school getting punched out daily by the s β€¦chool thug. He ever longs to be popular - the go-to guy - and the true crux of his troubles is that he invariably finds the means to this end, whatever that might be. At Western Summit High, he makes peace with his tormentor by going into business with him - listening to kids' problems and selling them prescription drugs. Charlie's a hit, but attraction to Susan (daughter of the school's laissez-faire principal), new security cameras on campus, a student's overdose, and Charlie's open world view all converge to get him in serious trouble. Can this self-made physician possibly heal himself and just be a kid? (Read More)

Subgenre:
coming of ageteen movie
Themes:
friendshipinfidelitydrugsmoneyadulteryprisondrinkingdrunkennessextramarital affairdivorcedepressiondrug usedysfunctional familyunfaithfulnessdating β€¦humiliationbullyingabductionalcoholismwealth (See All)
Mood:
high school
Locations:
barrestaurantswimming poolsmall townpolice carschool bussex in a carschool bus driver
Characters:
father daughter relationshipfather son relationshippolicemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerteenage girlteenage boyteacherstudentpolicemandancerwriter β€¦bullysingle motheralcoholicpsychiatristtalking to oneself in a mirrorstudent protest (See All)
Story:
private schooldancingsexfemale nuditycharacter name in titlebloodbare chested malegunkisscigarette smokingtitle spoken by charactersingingpartypistoltelephone call β€¦cryingcell phonesongbeatingunderwearmirrorpunched in the facecomputerdrinkarrestundressingbooktearssunglassescafemarijuanapianojailclassroomrevolverguitartelephonewinebandconcertmansionbasketballdrug dealermontagesuicide attempttoiletrock bandinternetman with glassesanti herounderwater scenelimousinemicrophonevirgincoming outprotestfired from the jobfantasy sequenceauditionbodyguardcheerleadersplit screendateloss of fatherhandgunclassclass differencesteenage sexgarageriotteen angstloss of virginityice creamjail cellvandalismdemonstrationamerican footballassaulttherapistfraudtennisskateboardcompassiondrug overdoserampageremote controlpillssurveillance cameraresearchbackstagepool tablefootball playermedicationfirst kissschool uniformdaydreamblack eyelonerclassmatebriefcasebrushing teethpajamaschauffeurpiano playervideo tapeteenage loveoverdoseconfessionalplaywrightpeer pressurebare chested boymegaphonepopularitylollipoppsychiatryfootball teamsexual repressionwatching a videorescue from drowningteen suicideloudspeakersuicidal thoughtsvillain turns gooddriver's licensefrench accentbritish accenthigh school principalsocial outcastpetitionfake idsedativepenitentiarytoilet stallfalling into a swimming poolanti depressantdestruction of propertystreakingtoilet bowlgiving the fingerschool expulsionmentally challenged personprescription drugsfake doctortax evasionboys' bathroomsexual confusionprozacchauffeured limousineattention deficit disorderhead in toiletkid outsmarts adultrailroad tracksritalintoy boatgarage doorxanaxdrive in movie theatrepsychiatric institutionbackseatmodel boatzoloftschool blazerdestructivenessfight in men's roomnicotine gumpassing notehigh school playrave the partysocial acceptanceschool superintendentchuck taylor gym shoesfake psychiatristmisdiagnosis (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Blue Crush (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blue Crush (2002)

Nothing gets between Anne Marie and her board. Living in a beach shack with three roommates including her rebellious younger sister, she is up before dawn every morning to conquer the waves and count the days until the Pipe Masters surf competition. Having transplanted herself to Hawaii with no one' β€¦s blessing but her own, Anne Marie finds all she needs in the adrenaline-charged surf scene ... until pro quarterback Matt Tollman comes along. Like it or not, Anne Marie starts losing her balance - and finding it - as she falls for Matt. (Read More)

Themes:
friendshipdrinkingprejudice
Mood:
nightmare
Locations:
barbeachschoolhotelseaoceangas station
Characters:
mother daughter relationshipfriendtattoobrother sister relationshipteenage girlstudentdancerphotographersister sister relationshipmaiduncle niece relationship
Story:
competitiondancingsexbloodflashbackdogkissfightshowertelephone callcell phonemirrorwatching tvcomputercamera β€¦drinkcondombikinivomitingrunningcolor in titlecleavagemontageunderwater sceneprologuelocker roommassagecontestfirst partobscene finger gesturetwenty somethingathleteinjuryjoggingexerciseamerican footballswimsuitsurfingskateboardgrocery storemobile phonefootball playerskateboardinghawaiibrushing teethreckless drivingfast motion sceneunderdogsurfertween girldolphinhead injurysurfboardwatching a videofemale athletewavejet skiskateboarderwomen's bathroomsleeping bagbased on articleoverheard conversationfoosballreefpull upssports announcerwriting on mirrorlipstick on mirrorsurfing contesthulasports competitionsurfing lessonfemale surferluauhitting one's head on a rocksolarisationsurfing accident (See All)

Jane Eyre (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jane Eyre (2011)

After a bleak childhood, Jane Eyre goes out into the world to become a governess. As she lives happily in her new position at Thornfield Hall, she meets the dark, cold, and abrupt master of the house, Mr. Rochester. Jane and her employer grow close in friendship and she soon finds herself falling in β€¦ love with him. Happiness seems to have found Jane at last, but could Mr. Rochester's terrible secret be about to destroy it forever? (Read More)

Subgenre:
coming of ageperiod drama
Themes:
friendshipsuicidereligiondeceptionmemoryparanoiainsanityillnessmental illnessabusecrueltyblindnessinheritancemadness
Mood:
rain
Locations:
schoolchurchsnowenglandstorm
Characters:
employer employee relationshipfriendchildrenbrother sister relationshipteenage girlfemale protagonistteachergirllittle girlolder man younger woman relationshipfrenchaunt niece relationship
Period:
19th century1840s
Story:
child abusedancingf ratedcharacter name in titlebased on novelbloodflashbackdogtwo word titlegunkisstitle spoken by charactersingingfirecrying β€¦horsesecretletterpaintingbookpianoclassroomprayerorphanbedroomcandledeath of friendbridgedrawingcigar smokingmarriage proposalgunshotflash forwardreadingcountrysidehuggingfireplacedesirewounddressgothicheavy rainhatservantforbidden lovehaunted by the pastthunderministerfirst kisshit on the headschool uniformbelief in godboarding schoolwedding dresssnowinghousekeeperfieldhorse and carriagechildhood memoryhorseback ridingdormitorysexual awakeningauntwedding ceremonyestatecorporal punishmentabandonmentstrokelocked doorbroken heartguardiancountry housestar crossed loverscaretakerlocked in a roomhouse fireveilcanceled weddingsaying graceglobenightgown19 year oldgirls' schoolcapgovernesscountry estatedollhouserite of passageorphan girlbelief in heavenfalling off horsebelief in hellribbonfree willbadmintonenglish countrysidebonnettyphuswedding veilgirls' boarding schoolmoor the landscapedying in someone's armswardyearningkeeping a secretone room schoolhouseservitudebridal veilhair ribbonhit with a booknursing someone back to healthhit on the head with a book (See All)

Burnt (2015) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Burnt (2015)

Chef Adam Jones ('Bradley Cooper (I)' (qv)) had it all - and lost it. A two-star Michelin rockstar with the bad habits to match, the former enfant terrible of the Paris restaurant scene did everything different every time out, and only ever cared about the thrill of creating explosions of taste. To  β€¦land his own kitchen and that third elusive Michelin star though, he'll need the best of the best on his side, including the beautiful Helene ('Sienna Miller' (qv)). (Read More)

Themes:
revengedrugsprisondrunkennessangerpsychopathredemptionhumiliationrivalrybullyingunrequited lovehomophobiacrueltytraumavengeance
Locations:
restaurantbuslondon englandkitchenrestaurant kitchen
Characters:
employer employee relationshipfamily relationshipsmother daughter relationshipboyfriend girlfriend relationshipdoctorgirlgay kissbullysingle motheralcoholicterrorgermandaughteramerican β€¦american abroadgerman abroadcolleague colleague relationshipself pityamerican in the ukamerican in europeformer alcoholicfrench abroad (See All)
Story:
workplace bullyingviolenceone word titleinterviewbare chested malekissfightknifevoice over narrationcryingbeatingfoodwatching tvlettervomiting β€¦birthdayjailf wordnewspaperjournalistcookingmontagesmokingdrug addictdebtevil manmanagerreunionprofanitytherapybirthday cakesabotagewoundgay charactercakecooktherapistchefcrying manprison guardcynicismblood on facenew orleans louisianaplot twistrivalfemale doctormale male kisspassionate kisscareerriding a bicyclearrogancephysical abusetaking a showerhysterianew jobnotebookdrunken mangay crushvulgarityfast foodhamburgertaking off shirtmale protagonistxenophobiasecond chancereading a newspaperdivamanipulative behaviortv interviewreference to star warsriding a bikecriticpsychological torturetraumatic experienceman childfeet on tablefast food restaurantmale vomitingverbal abusewrapped in a towelstockholm syndromecrying malesnobfired from a jobpassive aggressive behaviorreference to the rolling stonespassive aggressive womanhomophobehysterical outburstantiherobeaten uprudenessegoismmisanthropeemotional abuseincompetencepsychotherapistblood samplevulgar languageworkplace romancefish marketirresponsibilityoutburstlove hate relationshipmale chauvinismchauvinismegocentrismemotional blackmailmartyrdommisanthropyabused womancynicreference to darth vadermentally unstableviolent behavioregoistreleased from prisondrug testinghickmale chauvinistrecklessnessfood criticsubmissive womanabusive manviolent manwomanchildabusive bosscultural differenceshysterical mantelevision interviewmentally unstable protagonistrestaurant managercareerismman kissing mannarcissistic personality disorderantagonist as protagonistunpunished antagonistex drug addictmartyr syndromepsychopath as protagonistfemale therapistburger kinganger issuesgaslightingmaitre d'egocentricviolent outburstchildish behaviorreference to luke skywalkervulgar womansuperiority complexarrogant womanworking abroadselfish mandelusion of grandeurnationality slurrestaurant criticforced apologymentally unstable manforced to apologizemale divaformer addictweaklingabuseramerican in londoncomplexmale sexismmale sexistreference to alec guinness (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Coyote Ugly (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Coyote Ugly (2000)

Sexy, romantic comedy about a girl in her early 20s named Violet Sanford going to NYC to pursue a dream of becoming a songwriter. Violet gets a "day" job as a bar maid at a nightclub called Coyote Ugly. Coyote Ugly is the city's newest hot spot where the employees are a team of sexy, resourceful wom β€¦en that provoke the clientele and press with their mischief. (Read More)

Subgenre:
fish out of water
Themes:
friendshipdancewedding
Mood:
night
Locations:
new york citybarnightclubkitchenwheelchairapartmentrooftop
Characters:
employer employee relationshipfather daughter relationshipboyfriend girlfriend relationshiptattoosingermusicianwaitresssingle father
Period:
2000s
Story:
dancingsexf ratedmale nuditybare chested malesingingpantiesfirefistfightblondepunched in the faceundressingpianoguitarmanhattan new york city β€¦cleavagenewspaperwomandinersubwaywhite pantiesscantily clad femalebartenderargumentblack pantiesstripteasefired from the jobmini skirtauditionproduct placementfemale removes her clothesloss of mothernewspaper headlinegirl in pantiessexual attractionchefclubbossbar fightbroken legplayboy magazinenew jerseyburglaryobesityshoppingkaraokefat manwedding dresssongwriterred pantiesworld trade center manhattan new york citynew jobdrifterfemale removes her dressblue pantiescrutchesmini dressautographfriendship between womenbrooklyn bridgethong pantiesnaivetypartial female nuditymusic industrywet t shirtacoustic guitarbouncerfemale bartenderimplied sexrecord storemoving outbarmaidshort shortsapple computerfire breathingstripper polehot pantsgigstage frightfish marketpart time jobrecord labelrulessprayed with waterphone messageattitudetrying on clotheslift skirttollboothaustralian accentsmall town girlbiddingapple laptopdemofishmongerreading a porn magazineopen mike nightcomic book collectorpursue a dreamdate auction (See All)

Pitch Perfect (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pitch Perfect (2012)

The Barden Bellas are a collegiate, all-girls a cappella singing group thriving on female pop songs and their perfect looks. After a disastrous failing at last year's finals, they are forced to regroup. Among the new recruits is freshman Beca, an independent, aspiring DJ with no interest in the coll β€¦ege life. But after she meets Jesse, from the rival all-male a cappella group, Beca has a new outlook and takes it upon herself to help the Bellas find their new look and sound and get back into the competition. (Read More)

Themes:
gamblingrivalry
Locations:
singing in a carsinging on bus
Characters:
father daughter relationshipfemale protagonistaustralian
Story:
competitionf ratedtwo word titlekissbased on booksongvomitingcollegeroommateauditionfirst partgroup of friendsasian womansexism β€¦djmisogynistfemale friendshipradio stationconservativehazingbechdel test passedignorancered hairboy girl relationshiprunning out of gasfemale vomitingdorm roombickeringsinging contestfemale musiciana cappellacollege girlcollege freshmansocial differencescollege roommatesinging competitionfilm scorecollege kidfemale rapperobese girlgroup leadermusic education (See All)

Ex Machina (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ex Machina (2014)

Caleb, a 26 year old programmer at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he will have to participate in a strange and fa β€¦scinating experiment in which he must interact with the world's first true artificial intelligence, housed in the body of a beautiful robot girl. (Read More)

Subgenre:
suspensepsycho thriller
Themes:
murderdeathfriendshipdrunkennessescapedeceptionmemoryangercrueltyartificial intelligenceevolutionclaustrophobia
Locations:
helicopterlaboratory
Characters:
employer employee relationshipself mutilationself injuryself awarenessrobot human relationship
Story:
competitiondancingfemale nuditybloodfemale frontal nuditytwo word titlebare chested malefemale rear nudityknifesurprise endingshowerblood splattermirrorpunched in the facecomputer β€¦written by directorundressingpaintingliebeerbedrobotriveralcoholscientistf wordwinemountainstabbed to deathstabbed in the chestinternetno opening creditsdrawingcharacter repeating someone else's dialoguestabbed in the backfantasy sequencemanipulationwigisolationwaterfallsevered armhatestrong female characterflirtingexperimentshavingelectronic music scoredressclassical musicstrong female leadmoralitylandscapesurveillance camerainventorpower outageblack and white scenetime lapse photographylooking at self in mirrorexistentialismvodkaclose up of eyescontractvideo surveillanceinsecurityminimal castestateknocked unconsciousrazor bladepunching bagsome scenes in black and whiteconsciousnesshitchcockianchapter headingsdistrustcolorbreaking a mirrorcctvinner title cardcat and mouseoverhead shotarm ripped offcut armpsychological manipulationlocked inwatching someonebeing watchedreference to frankensteinhumanoidpokieshidden truthsingle set productionred lightcomputer programmerstabbed in the bellylie detectorpassed out drunksource musicseclusionreference to mozartsex with robotunderground bunkerupside down camera shotjaw ripped offresearch facilityfemale androidhuman android relationshiplockdowncontainmentreference to jackson pollockremote locationfembotgynoidscenic beautybaroque musickey cardalgorithmreference to depeche modereference to j. robert oppenheimermineral waterartificial armreference to ludwig wittgensteinnon disclosure agreementturing teststabbed in back (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Knocked Up (2007) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Knocked Up (2007)

When Alison Scott is promoted in E! Television, she goes to a night-club to celebrate with her older married sister Debbie. Alison meets the pothead reckless Ben Stone and while having a small talk with Ben, Debbie's husband Pete calls her to tell that their daughter has chicken pox. Debbie leaves t β€¦he place but Allison stays with Ben, drinking and dancing along all night; completely wasted, they end up having a one night stand. Ben does not use condom and eight weeks later, Allison discovers that she is pregnant. She calls Ben and they decide to try to stay together and have the baby. However, Ben needs to grow-up first to raise a family of his own. (Read More)

Subgenre:
sex comedy
Themes:
lovemarriageinfidelityjealousypregnancydrunkennessdrug usedatingunemployment
Locations:
hospitalbarrestauranthotellos angeles californiabathtubnightclubapartmentstrip club
Characters:
father daughter relationshiphusband wife relationshipfather son relationshipmother daughter relationshipfriendsister sister relationshiplustjewbar mitzvah
Story:
trampolinedancingfemale nuditymale nudityfemale frontal nudityinterviewmasturbationmale rear nuditybare chested malesex scenepartylesbian kisspanties β€¦woman on topcondomsex in bedbare buttvomitingbedmarijuanahallucinationstripperf wordcleavagegay slurwomandinerinternetwhite pantiesdinnerscantily clad femalebirthday partyroommatemarriage proposalpublic nudityargumentblack pantiesactor shares first name with characterchildbirthpremarital sexprofanitylas vegas nevadagirl in pantiesmachismobirthday cakeactor playing himselfpornographypot smokingmachetebeardone night standclubbirthearthquakegas maskcameorear entry sexbreakuphit in the crotchsex talkshoppingbookstoreslackercasual sexwoman in bathtubcannabiswebsiteweedclose upthong pantiesroller coastervulgaritystonerbubble bathtelevision showunplanned pregnancyreference to googlebouncergrassfart jokedrug humorgynecologistping pongdoormanpaintballman in a wheelchairunwed pregnancyfemale sitting on a toiletgross out humorjob promotionpenis jokefemale explicit nuditymissionary positiongynecological examunprotected sexcribmultiple cameosdrunken sextelevision producertalking during sexmagic mushroomreal life mother and daughter playing mother and daughterganjacatch phraseman wearing a towelreference to stephen hawkingreference to pubic hairtelevision networkreference to pepsicirque du soleilhallucinogenic drugobstetricianporn actor in mainstream moviecanadian stereotypemessy apartmentgynecologyplayhouseplaying ping pongsex with pregnant womantelevision executivecanadian expatriatejumping into a poolnatural childbirthworld wide webhand on breastreference to costcobellyblowing smoke ringultrasound imaginggiggleawakened by a childpink eyepregnant woman in bathtub (See All)

The Devil's Own (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Own (1997)

A thriller about an IRA gunman who draws an American family into the crossfire of terrorism. Frankie McGuire is one of the IRA's deadliest assassins. But when he is sent to the U.S. to buy weapons, Frankie is housed with the family of Tom O'Meara, a New York cop who knows nothing about Frankie's rea β€¦l identity. Their surprising friendship, and Tom's growing suspicions, force Frankie to choose between the promise of peace or a lifetime of murder. (Read More)

Subgenre:
tragedy
Themes:
home invasionmurderdeathfriendshiprevengemoneybetrayalpoliticsterrorismguilt
Mood:
neo noir
Locations:
new york citybarchurchhelicopterairplaneairportpolice stationship
Characters:
family relationshipsfather daughter relationshippolicemother daughter relationshipsoldierpolice officersister sister relationshiplittle girlpolice chasepolice sergeant
Period:
1990s
Story:
dancingbloodviolencegunexplosionpartyshootoutshot to deathblood splattermachine gunshot in the chestremakeshot in the headgunfightshowdown β€¦revolvershot in the backfoot chaseorphannew yorkterroristtankopening action scenestreet shootouttragic eventdie hard scenarioirelandhandgunobscene finger gestureuzimale bondingsergeantirishmoralitypassportitalian americanbilliardsbulletproof vestferrybag of moneyterrorist groupirish americanarms dealerdouble lifebritish armyski maskdeath of familymain character shotnew york skylinenorthern irelandtragic villainfoot pursuitirish republican armyjumping on a bedirish catholicdouble identitybelfast northern irelandstinger missile (See All)

Dogtooth (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dogtooth (2009)

Three teenagers are confined to an isolated country estate that could very well be on another planet. The trio spend their days listening to endless homemade tapes that teach them a whole new vocabulary. Any word that comes from beyond their family abode is instantly assigned a new meaning. Hence 't β€¦he sea' refers to a large armchair and 'zombies' are little yellow flowers. Having invented a brother whom they claim to have ostracized for his disobedience, the uber-controlling parents terrorize their offspring into submission. The father is the only family member who can leave the manicured lawns of their self-inflicted exile, earning their keep by managing a nearby factory, while the only outsider allowed on the premises is his colleague Christina, who is paid to relieve the son of his male urges. Tired of these dutiful acts of carnality, Christina disturbs the domestic balance. (Read More)

Themes:
deathmoneyfeardancedeceptionincestparanoiadysfunctional familymental illnesssadismcrueltyfather daughter incest
Locations:
swimming poolcarairplanebathtub
Characters:
family relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenagermother daughter relationshipsingerbrother sister relationshipprostituteteenage boydancerhostagesister sister relationshipsecurity guard β€¦fatherself mutilation (See All)
Story:
child abusecompetitiondancingsexfemale nuditynuditybloodmale nudityviolenceone word titlebare breaststhreesomefemale frontal nudity β€¦male frontal nuditymasturbationmale rear nuditydogbare chested malesex scenekissfemale rear nudityfighttitle spoken by charactermale full frontal nuditysingingpartyknifeerectionpantiestelephone calltopless female nuditylickingcryingsongbeatingdreamunderwearblood splatterfoodmirrorface slapslow motion scenecatundressingbare buttsecretpaintingbooklietearsrunningbedpianoprostitutionmale pubic hairguitartelephonemenage a troisvideo camerawomaneatinghousefemale pubic hairfishbathritualunderwater scenesearchpantyhosestrippingscreamingliarfactoryreadingscreamflowersscarpianisthairy chestfilm within a filmbrothergardenblindfoldsleepingtwinrecord playertopless womaneyeglassesapplausegamekilling an animallooking at oneself in a mirrorcakelistening to musictape recorderrecordingexercisehammerplanetvideotapebarefoot maleswimsuitbrother sister incestsharkhome movieteenage protagonistsocial commentarymale underwearsubmissioncelebrationrear entry sexboxer shortsblood on facegreecehit on the headsibling rivalrysuperstitionknife fightalternate realitylooking at self in mirrorfamily dinnerunsimulated sextrophyalienationolder woman younger man sexexplicit sexceremonypiano playermale objectificationsexual awakeningearphonesbarking doggategreekdead animalfencefilm in filmvacuum cleanerguitar playingmasochismsex educationfantasy worldman in swimsuitmercedes benzperfumeslappinggame playingdead catwatching a videotaking off clotheshit with a hammersaltshared bathignorancecreationismpencildressingspeedowedding anniversarykeyboardwalkmanhide and seekvcrguard dogsex with socks ontoothsister sister incestreference to frank sinatrabody part in titleperson in a car trunkbottled waterfemale objectificationheadbandcountry estateorange juicecprharpoonneurosisoverprotective fatherdictionarydobermankeyholefake bloodlooking through a keyholeknife attackperson in car trunktouching someone's breastskilling a cattaking off pantstaking off underwearseclusiondog traininggarden shearserect penismale bare feetbrother sister sexdoor lockbarkingthrowing a rockwashing a carisolated housecar washingcartwheelwatching a porn videoanestheticblood on handarm woundface woundhiding in a car trunktoy airplaneattacked with a knifedog trainerholding one's breath underwaterartificial respirationdeath of catsocial isolationtape measurepost punksleepmaskstomachachenordicmemorizationwatering a planthair gelpolishing shoesswimming gogglesstickermouthwashanother planetdog cagelistening at a doorfemale security guardarm bandageisolationismclipping toenailsmisinformationbroken toothpretending to drownarm cutcutting one's armhome securitybreath holding contestlearning to fightmutilated doll (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Peter Pan (1953)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Peter Pan (1953)

An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.

Subgenre:
coming of age2d animationdisneyswashbuckler
Themes:
friendshipsurrealismkidnappingjealousyheromagicangerchildhoodmythology
Locations:
boatlondon englandseaenglandcavejunglecity of children
Characters:
native americanfamily relationshipsfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipchildrenbrother brother relationshipboybrother sister relationshipgirllittle girllittle boymermaid
Period:
1900s
Story:
character name in titlebased on noveldogfighttitle spoken by characterbased on playdreamrescueswordbedislandgood versus evilorphansword fightmap β€¦journeycigar smokingprincessduelattempted murderumbrellarabbitfirst partwaterfallbearmonkeypiratecaptainflyingwoundlifting someone into the airblockbusterimpersonationteddy bearclockexplosivefairychild protagonistshadowpipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassesseagullcloudfantasy worldfriends who live togetheraltered version of studio logoskyoutlaw gangracial stereotyperaccoonhookpirate shiprhinocerosbig ben londonskunkhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandseashell bikinimagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All)

The Cannonball Run (1981) is one of the best movies like Imagine That (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Cannonball Run (1981)

This comedy film brings Burt Reynolds, Roger Moore, Farrah Fawcett, Dom DeLuise, Dean Martin, Sammy Davis Jr. and an all-star cast to the starting line of the ultimate auto race, a madcap cross-country scramble that roars full-speed ahead. This action-comedy was inspired by an actual event: the Cann β€¦onball Baker Sea-To-Shining-Sea Memorial Trophy Dash, an anything goes, all-stops-out - and very much illegal - competition that has grown to legendary proportions within the last ten years. (Read More)

Subgenre:
martial artsslapstick comedy
Themes:
rivalryabduction
Mood:
rainparodycar chasejames bond spoof
Locations:
bartrainswimming poolcarmotorcycleairplaneroad triptruckmotelgas stationroad movie
Characters:
policemother son relationshipdoctorphotographerwaitressjewpolice chase
Story:
competitiondoggunfightchaseblondepunched in the facecamerabrawlmaskbeerkung fucleavagedisguiseambulance β€¦exploding carbrunettebinocularsmicrophonecostumeon the roadmartial artistautomobilepolicewomanflirtingpickup trucksyringehypodermic needlevideotapeblockbusterpart of trilogyinterracial friendshipredneckensemble castarabparachutehighwaygadgetsmokeflat tirecamelharassmentdirector cameobloopers during creditscar racetelephone boothfalling into waterroadblocktelevision showmotorboataltered version of studio logoheiralter egobettingstutteringferraricar racingtoy gunbiker gangdriving at nightgadget carflying carautomobile racingmotorcycle crashpokieswatching pornographyfirst of trilogyreference to allahlamborghinidriving in the rainillegal street racingracercantonesepornographic filmhighway patrolsheikhcb radiocarsploitationdangerous drivingejector seatwheeliechinese manoil slickwoman wearing a bikinirat packsmokescreencannonball runcar moviecross country racestudio logo parodycar in a swimming poollight airplanedriving at night in the rainreference to roger mooreillegal grand prix race (See All)

North Country (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

North Country (2005)

1989. Josey Aimes takes her two kids, Sammy and Karen, and leaves her abusive husband Wayne, to return to her northern Minnesota home town. On a chance meeting with her old friend Glory Dodge who works as a driver and union rep at the mine operated by Pearson Taconite and Steel, Josey decides to wor β€¦k at the mine as well, work that is dominated by men in number and in tone. She does so to be able to stand on her own two feet for the first time in her life, something she probably could not have done if she remained in a job washing hair at a beauty salon. Working at the mine does not sit well with her father, Hank Aimes, who also works at the mine and who, like the other male workers, believes she is taking a job away from a man. Hank has believed that all Josey's problems are of her own doing, ever since she, unmarried, had Sammy while she was still in high school. Josey has always stated that she does not know who Sammy's biological father is, which fosters Hank's attitude about her. Among Josey's coworkers is Bobby Sharp, who many believe is Sammy's biological father. Josey's evangelical mother, Alice Aimes, stands by her husband in their general belief of traditional roles of men and women. Josey and her fellow female mine workers are continually harassed, emotionally, physically and sexually by their male counterparts. Every seeming step forward in the issue Josey finds is only a measure to lull the women into a false sense of security, or to make the fall even harder. Una… (Read More)

Themes:
lovefriendshiprapechristmasmoneypregnancydrinkingdrunkennessdivorceillnessdying
Mood:
high school
Locations:
hospitalrestauranttrainchurchsnowsmall townrural settingcourtroommotelgas stationcatholic church
Characters:
employer employee relationshipfamily relationshipsfather daughter relationshiphusband wife relationshiphomosexualpolicemother son relationshipmother daughter relationshipfrienddoctorteenage girlprostituteteenage boyfemale protagonistnurse β€¦dancerbabypriestlawyersingle motherteacher student relationshipcatholicolder man younger woman relationshipgrandfather grandson relationshipgrandmother grandson relationshipgrandmother granddaughter relationshipgrandfather granddaughter relationshiptruck driverself respect (See All)
Period:
1980s1990s1970s
Story:
trampolinedancingf ratedbloodflashbackkissfightcigarette smokingexplosionbased on true story β€¦cryingtitle directed by femaleunderwearfoodurinationwatching tvdrinksecretvomitingliebeertearscafemenage a troisbandtoiletflash forwardmicrophonelocker roomliarcowboychristmas treecourtwitnessbank robberyhateterminal illnesspickup truckmachismocoacheyeglassesapplausedresslawwalkie talkieworking classamerican footballwristwatchgossippoolflatulencerape victimrapistinnocencesexismkaraokesexual harassmentbutterflyice hockeyblack eyeraised middle fingerminemisogynyminingalarmhangoverlawsuitflaskfemale lawyerteasingarenaunionauto mechanicminercrotch grabfilling stationlabor unionbeauty salontoxic wastemagnifying glasssewingabusive boyfriendminnesotafinancial problemmolestationspray paintice rinkwelfarewater hoseostracismwife beaterhard hatpool cueteen drinkingdining hallfootball stadiumunwed motherdartsfootball fieldwalkerbeauticianhockey sticksteelworking momwinklearning to drivelunchboxdead deermale chauvinismspouse abusefirst communionworking womanalimonyice skatesrape of a minorpolkabutt grabarthritisdart boardchilicovered in fecesice hockey playerlou gehrigs diseaselunch breakportable toiletcoffee breakearth moverpet cemeterychalk drawingice hockey teamstrip miningunion leaderclass action lawsuitlosing one's voiceschool detentionone testicleunion meetinglabor union meeting (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Imagine That?
<< FIND THEM HERE! >>