Please wait - finding best movies...
The second chapter of the epic "Maze Runner" saga. Thomas (Dylan O'Brien) and his fellow Gladers face their greatest challenge yet: searching for clues about the mysterious and powerful organization known as WCKD. Their journey takes them to the Scorch, a desolate landscape filled with unimaginable …obstacles. Teaming up with resistance fighters, the Gladers take on WCKD's vastly superior forces and uncover its shocking plans for them all. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypsesuspense |
Themes: | near death experiencehopeunrequited lovesurveillanceparanoiamemorydeceptionescapetorturefearbetrayalkidnappingsuicidedeathfriendship …murder (See All) |
Locations: | airshiptunnellaboratorydeserthelicopter |
Characters: | sniper rifleevil doctorsnipertough guyhostagesoldierzombieteenage boyprostituteteenager |
Period: | zip line |
Story: | commando raidresistance fighterrunning for your lifebolt action rifletelescopic rifleassault riflesawed off shotgunuh 1 huey helicopterfalling down an elevator shafteye swollen shutsleeping in the opendestroyed bridgecrawling through an air shaftelectric generatorcamp site …lightning stormhit with a metal pipeall terrain vehiclebuilding demolitionsuspension bridgeimmunityair ventbased on young adult novelcity in ruinscollapsing buildingdark futurestruck by lightningsand duneabandoned carsandstormstun gundetonatorevil corporationmegacorporationteenage herovinylhuman experimentdistrustopen endedfight the systemcurereluctant heroravehanging upside downwhistlingyoung version of charactersmugglerflaskreturning character killed offepidemiccafeteriaabandoned buildingpickpocketdrugged drinkmale in showerblood on shirtmoral dilemmagatling guncrowlasersightraised middle fingerfalling to deathjumping through a windowcapturehologramcommandoinfectionthunderstormshopping mallpower outageresistancesocial commentarywalkie talkiehidingvirusdiseasehypodermic needlemachetehead buttrevelationsyringemissileeavesdroppingak 47obscene finger gesturemercenaryexploding bodyratshot in the shoulderinjectionscartough girlknocked outcharacter's point of view camera shotrace against timetentfugitiveelectrocutionshot in the foreheadon the runcreaturedouble crossdisarming someonedream sequenceno opening creditstied to a chairdeath of friendmassacremountainambushflashlightfoot chasegood versus evilsubjective camerasurvivalshot in the backscientistrevolverhallucinationinterrogationrunningsecond partbombheld at gunpointriflefalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingpartyexplosionbare chested malebased on novelviolenceflashbacksequelblood (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypse |
Themes: | hopesurveillanceparanoiadeceptionescapefearbetrayalkidnappingmurderdeath |
Locations: | tunnellaboratory |
Characters: | hostagesoldierzombie |
Period: | zip line |
Story: | resistance fightersawed off shotgundetonatorevil corporationmegacorporationdistrustopen endedfight the systemcurehanging upside downyoung version of characterreturning character killed offabandoned buildinggatling gunraised middle finger …holograminfectionpower outageresistancesocial commentarywalkie talkiediseasevirushypodermic needlemachetehead buttrevelationmissileak 47obscene finger gesturemercenaryexploding bodyshot in the shoulderscartough girlknocked outcharacter's point of view camera shotrace against timeelectrocutionshot in the foreheadcreaturedouble crossdisarming someoneno opening creditsmassacreambushflashlightgood versus evilsurvivalsubjective camerashot in the backscientistinterrogationrunningbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionsequelbloodviolenceflashback (See All) |
After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc …king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypsesuspense |
Themes: | near death experiencehopesurveillanceparanoiamemorydeceptionescapefearbetrayalkidnappingdeathmurder |
Locations: | airshiptunneldesert |
Characters: | tough guyhostagesoldierteenager |
Story: | commando raidassault riflebased on young adult noveldetonatorteenage heroopen endedfight the systemreturning character killed offcafeteriaabandoned buildingmoral dilemmalasersighthologramcommandosocial commentary …head buttrevelationmissileeavesdroppinginjectionscartough girlknocked outcharacter's point of view camera shotrace against timetentfugitiveelectrocutionshot in the foreheadon the rundouble crossdisarming someoneno opening creditsambushfoot chasegood versus evilsubjective camerasurvivalshot in the backscientistrevolverhallucinationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingexplosionbare chested malebased on novelsequelviolenceblood (See All) |
One choice can transform you-or it can destroy you. But every choice has consequences, and as unrest surges in the factions all around her, Tris Prior must continue trying to save those she loves--and herself--while grappling with haunting questions of grief and forgiveness, identity and loyalty, po …litics and love. Tris's initiation day should have been marked by celebration and victory with her chosen faction; instead, the day ended with unspeakable horrors. War now looms as conflict between the factions and their ideologies grows. And in times of war, sides must be chosen, secrets will emerge, and choices will become even more irrevocable--and even more powerful. Transformed by her own decisions but also by haunting grief and guilt, radical new discoveries, and shifting relationships. Tris must fully embrace her Divergence, even if she does not know what she may lose by doing so. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypsesuspense |
Themes: | near death experiencehopesurveillancedeceptionescapetorturefearbetrayalkidnappingsuicidemurderfriendshipdeath |
Locations: | laboratory |
Characters: | tough guyhostagesoldierteenager |
Period: | zip line |
Story: | resistance fighterassault riflebased on young adult novelcity in ruinscollapsing buildingteenage herohuman experimentfight the systemreluctant heroreturning character killed offmoral dilemmafalling to deathjumping through a windowcapturehologram …resistancesocial commentaryhypodermic needlehead buttrevelationsyringeinjectiontough girlknocked outrace against timefugitiveon the rundouble crossdisarming someoneno opening creditsmassacreambushfoot chasegood versus evilsurvivalshot in the backscientistrevolverhallucinationinterrogationrunningsecond partheld at gunpointfalling from heightpunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested malebased on novelsequelflashbackbloodviolence (See All) |
Four waves of increasingly deadly attacks have left most of Earth in ruin. Against a backdrop of fear and distrust, Cassie is on the run, desperately trying to save her younger brother. As she prepares for the inevitable and lethal fifth wave, Cassie teams up with a young man who may become her fina …l hope - if she can only trust him. (Read More)
Subgenre: | dystopiapost apocalypsesuspense |
Themes: | hopeunrequited lovesurveillanceparanoiadeceptionescapefearbetrayalkidnappingmurderdeathfriendship |
Locations: | helicopter |
Characters: | sniper riflesnipertough guyhostagesoldierteenage boyteenager |
Story: | assault riflebased on young adult novelabandoned cardetonatordistrustopen endedfight the systemreluctant heroabandoned buildingmoral dilemmapower outagesocial commentarydiseasevirushypodermic needle …revelationeavesdroppingak 47injectiontough girlknocked outcharacter's point of view camera shotrace against timetentdouble crossdisarming someoneno opening creditsmassacreambushgood versus evilsurvivalsubjective camerashot in the backrevolverbombheld at gunpointriflebattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingpartyexplosionbare chested malebased on novelviolenceflashbackblood (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | dystopiasuspense |
Themes: | near death experiencehopesurveillanceparanoiadeceptionescapefearbetrayalkidnappingdeathmurderfriendship |
Locations: | tunnelhelicopter |
Characters: | sniper riflesnipertough guyhostage |
Story: | commando raidresistance fighterassault rifledetonatorfight the systemwhistlingyoung version of characterreturning character killed offblood on shirtmoral dilemmagatling gunraised middle fingercommandoresistancesocial commentary …walkie talkiemacheteak 47obscene finger gesturemercenaryexploding bodyshot in the shoulderknocked outrace against timefugitiveelectrocutionshot in the foreheadon the rundisarming someoneno opening creditstied to a chairdeath of friendmassacreambushflashlightsurvivalshot in the backrevolverbombheld at gunpointriflepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolexplosionbare chested malebloodflashbacksequelviolence (See All) |
Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and … the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)
Subgenre: | dystopiapost apocalypsesuspense |
Themes: | near death experiencehopeparanoiadeceptionescapetorturefearbetrayalkidnappingsuicidedeathmurderfriendship |
Locations: | tunneldeserthelicopter |
Characters: | sniper riflesniperhostagesoldier |
Story: | commando raidassault riflereturning character killed offabandoned buildingmoral dilemmagatling gunlasersightcapturecommandoinfectionsocial commentarywalkie talkievirusmachetemissile …ak 47exploding bodyknocked outcharacter's point of view camera shotrace against timedouble crossno opening creditsdeath of friendmountainmassacreambushflashlightsurvivalsubjective camerashot in the backhallucinationinterrogationheld at gunpointriflefalling from heightbattleslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested malebloodsequelflashbackviolence (See All) |
After young Katniss Everdeen agrees to be the symbol of rebellion, the Mockingjay, she tries to return Peeta to his normal state, tries to get to the Capitol, and tries to deal with the battles coming her way...but all for her main goal: assassinating President Snow and returning peace to the Distri …cts of Panem. As her squad starts to get smaller and smaller, will she make it to the Capitol? Will she get revenge on Snow or will her target change? Will she be with her "Star-Crossed Lover," Peeta, or her long-time friend, Gale? Deaths, bombs, bow and arrows, a love triangle, hope... What will happen? (Read More)
Subgenre: | cyberpunkdystopiapost apocalypsesuspense |
Themes: | near death experiencehopesurveillanceparanoiadeceptionescapefearbetrayaldeathmurder |
Locations: | tunnel |
Characters: | tough guyhostagesoldierteenager |
Story: | resistance fighterassault riflebased on young adult novelcollapsing buildingdark futuredistrustfight the systemreluctant heroreturning character killed offabandoned buildingdrugged drinkmoral dilemmacapturehologramcommando …resistancesocial commentaryrevelationmercenaryexploding bodytough girlknocked outfugitiveon the runcreaturedouble crossno opening creditsmountainambushflashlightfoot chasegood versus evilsurvivalscientistbombheld at gunpointriflefalling from heightbattleslow motion scenerescueshot in the chestshot to deathcorpseshootoutfirepistolexplosionbased on novelviolencesequel (See All) |
The G.I. Joe team is framed for crimes against the country by Zartan, disguised as the President, and Cobra Commander has all the world leaders under his influence, with their advanced warheads headed towards innocent populaces around the world. Outnumbered and outgunned, the surviving team members …form a plan with their original leader, General Joseph Colton, to rescue the President and face off Cobra Commander, his accomplices and the world leaders. (Read More)
Themes: | surveillancedeceptiontorturebetrayalkidnappingfriendshipdeathmurder |
Locations: | deserthelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Period: | zip line |
Story: | commando raidassault rifleyoung version of characterreturning character killed offgatling gunfalling to deathcommandopower outagewalkie talkiemissileak 47obscene finger gesturemercenaryexploding bodyinjection …tough girlknocked outcharacter's point of view camera shotrace against timeon the rundouble crossno opening creditstied to a chairdeath of friendmassacremountainambushfoot chasegood versus evilsurvivalshot in the backinterrogationsecond partbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingpartyexplosionbare chested malebloodflashbacksequelviolence (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
Subgenre: | dystopiapost apocalypsesuspense |
Themes: | near death experiencesurveillancedeceptionescapefearbetrayalsuicidemurderdeath |
Locations: | tunnelhelicopter |
Characters: | tough guyhostagezombieteenage boy |
Story: | destroyed bridgehit with a metal pipeair ventcollapsing buildingdark futureepidemicmoral dilemmainfectionpower outagediseasevirusmachetehead buttexploding bodyshot in the shoulder …tough girlrace against timeshot in the foreheadcreaturedisarming someonedream sequenceambushflashlightfoot chasegood versus evilsurvivalshot in the backrevolverheld at gunpointriflefalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbloodflashbackviolence (See All) |
When John Connor ('Jason Clarke (I)' (qv)), leader of the human resistance, sends Sgt. Kyle Reese ('Jai Courtney' (qv)) back to 1984 to protect Sarah Connor ('Emilia Clarke' (qv)) and safeguard the future, an unexpected turn of events creates a fractured time-line. Now, Sgt. Reese finds himself in a … new and unfamiliar version of the past, where he is faced with unlikely allies, including the Guardian ('Arnold Schwarzenegger' (qv)), dangerous new enemies, and an unexpected new mission: To reset the future... (Read More)
Subgenre: | cyberpunkpost apocalypse |
Themes: | hopememorydeceptionbetrayaldeathmurder |
Locations: | laboratory |
Characters: | sniper rifletough guysoldier |
Story: | resistance fighterdark futuredetonatormegacorporationfight the systemyoung version of characterreturning character killed offabandoned buildingjumping through a windowhologramresistancesocial commentaryhead buttrevelationexploding body …shot in the shouldertough girlcharacter's point of view camera shotrace against timefugitiveelectrocutionshot in the foreheadon the rundisarming someoneambushfoot chasegood versus evilsubjective camerasurvivalshot in the backscientistrevolverinterrogationbombheld at gunpointbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingexplosionbare chested maleflashbacksequel (See All) |
In the near future, Major Motoko Kusanagi (Scarlett Johansson) is the first of her kind: A human saved from a terrible terrorist attack, who is cyber-enhanced to be a perfect soldier devoted to stopping the world's most dangerous criminals. When terrorism reaches a new level that includes the abilit …y to hack into people's minds and control them, Major Kusanagi is uniquely qualified to stop it. As she prepares to face a new enemy, Major Kusanagi discovers that she has been lied to: her life was not saved, it was stolen. She will stop at nothing to recover her past, find out who did this to her and stop them before they do it to others. (Read More)
Subgenre: | cyberpunkdystopiasuspense |
Themes: | paranoiamemorydeceptionescapefearbetrayalkidnappingsuicidedeathmurder |
Locations: | helicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | assault rifleevil corporationmegacorporationfight the systemgatling gunlasersightraised middle fingerjumping through a windowhologramsocial commentaryhypodermic needlemissileeavesdroppingobscene finger gestureexploding body …injectiontough girlknocked outcharacter's point of view camera shotrace against timefugitiveelectrocutionshot in the foreheadon the rundisarming someonetied to a chairmassacreambushflashlightfoot chasesubjective camerascientistrevolverhallucinationinterrogationbombheld at gunpointpunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolexplosionbare chested maleflashbackviolence (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ …le'. (Read More)
Themes: | near death experiencesurveillanceparanoiadeceptionescapetorturefearbetrayalkidnappingdeathmurderfriendship |
Locations: | laboratoryhelicopter |
Characters: | tough guyhostagesoldier |
Story: | assault rifledetonatorfight the systemcureyoung version of characterreturning character killed offmoral dilemmagatling gunraised middle fingerholograminfectionsocial commentarywalkie talkiediseasevirus …hypodermic needlehead buttmissileeavesdroppingobscene finger gesturemercenaryexploding bodyshot in the shoulderinjectionscarknocked outcharacter's point of view camera shotrace against timetentelectrocutionshot in the foreheaddouble crossdisarming someoneno opening creditstied to a chairdeath of friendmountainambushgood versus evilsubjective camerashot in the backrevolverhallucinationinterrogationsecond partbombheld at gunpointriflebattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathbeatingshootoutpistolsurprise endingexplosionbare chested malesequelbloodflashbackviolence (See All) |
For a factory worker named Douglas Quaid, even though he's got a beautiful wife who he loves, the mind-trip sounds like the perfect vacation from his frustrating life - real memories of life as a super-spy might be just what he needs. But when the procedure goes horribly wrong, Quaid becomes a hunte …d man as he finds himself on the run from the police. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypse |
Themes: | surveillancedeceptionescapetorturebetrayaldeathmurder |
Locations: | helicopter |
Characters: | tough guyprostitute |
Story: | resistance fighterstun gunmegacorporationfight the systemreluctant heroabandoned buildinggatling gunlasersightjumping through a windowhologramresistanceexploding bodyshot in the shoulderinjectionscar …tough girlfugitiveshot in the foreheadon the rundouble crossdream sequenceno opening creditstied to a chairfoot chaseshot in the backinterrogationbombheld at gunpointfalling from heightpunched in the faceslow motion sceneshot in the chestshot to deathshootoutpistolsurprise endingexplosionbare chested maleflashbackviolence (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
Themes: | near death experienceunrequited lovesurveillanceparanoiadeceptionescapetorturefearbetrayalmurderdeath |
Locations: | tunnellaboratory |
Characters: | snipertough guyhostagesoldier |
Story: | assault rifledistrustopen endedreluctant herohanging upside downreturning character killed offjumping through a windowhologramhypodermic needlerevelationak 47shot in the shoulderinjectiontough girlknocked out …fugitiveshot in the foreheadon the rundouble crossdisarming someoneno opening creditsmassacremountainambushflashlightsurvivalshot in the backinterrogationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingpartyexplosionbare chested malebloodviolenceflashbacksequel (See All) |
Ray Breslin is the world's foremost authority on structural security. After analyzing every high security prison and learning a vast array of survival skills so he can design escape-proof prisons, his skills are put to the test. He's framed and incarcerated in a master prison he designed himself. He … needs to escape and find the person who put him behind bars. (Read More)
Themes: | surveillancedeceptionescapetorturebetrayalkidnappingfriendshipmurderdeath |
Locations: | helicopter |
Characters: | sniper riflesnipertough guy |
Story: | assault rifleuh 1 huey helicoptercafeterialasersightraised middle fingerfalling to deathpower outagewalkie talkiehypodermic needlehead buttmercenaryshot in the shoulderinjectioncharacter's point of view camera shotelectrocution …shot in the foreheaddouble crossno opening creditstied to a chairflashlightfoot chasesurvivalsubjective camerashot in the backinterrogationheld at gunpointpunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested maleflashbackbloodviolence (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
Themes: | near death experiencesurveillanceparanoiadeceptionescapefearbetrayalkidnappingfriendshipmurderdeath |
Locations: | tunnellaboratorydeserthelicopter |
Characters: | tough guyhostagesoldierzombie |
Story: | collapsing buildingsandstormopen endedmoral dilemmacrowcapturepower outagewalkie talkiehypodermic needlemissileak 47mercenaryratinjectionscar …knocked outcharacter's point of view camera shotrace against timeelectrocutiondouble crossdisarming someoneno opening creditsdeath of friendmassacreambushflashlightfoot chasegood versus evilsubjective camerashot in the backscientisthallucinationheld at gunpointbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested maleviolencebloodflashback (See All) |
HITMAN: AGENT 47 centers on an elite assassin who was genetically engineered from conception to be the perfect killing machine, and is known only by the last two digits on the barcode tattooed on the back of his neck. He is the culmination of decades of research and forty-six earlier Agent clones -- … endowing him with unprecedented strength, speed, stamina and intelligence. His latest target is a mega-corporation that plans to unlock the secret of Agent 47's past to create an army of killers whose powers surpass even his own. Teaming up with a young woman who may hold the secret to overcoming their powerful and clandestine enemies, 47 confronts stunning revelations about his own origins and squares off in an epic battle with his deadliest foe. (Read More)
Themes: | near death experiencesurveillancememorydeceptionescapetorturebetrayalkidnappingsuicidedeathmurder |
Locations: | laboratoryhelicopter |
Characters: | sniper riflesnipertough guyhostage |
Period: | zip line |
Story: | assault rifleevil corporationmegacorporationhuman experimentyoung version of characterpickpocketlasersightjumping through a windowcommandohypodermic needlehead buttmercenaryexploding bodyshot in the shoulderinjection …tough girlknocked outrace against timefugitiveelectrocutionshot in the foreheadon the rundisarming someonetied to a chairambushfoot chasesurvivalshot in the backinterrogationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingexplosionviolenceflashback (See All) |
The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi …nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)
Subgenre: | suspense |
Themes: | near death experiencehopesurveillanceparanoiadeceptionescapetorturefearbetrayalkidnappingmurderdeath |
Locations: | laboratorydeserthelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | assault riflecollapsing buildingopen endedhanging upside downyoung version of charactersmugglerreturning character killed offabandoned buildingmoral dilemmagatling gunraised middle fingerjumping through a windowcommandopower outagehead butt …revelationmissileeavesdroppingak 47mercenaryexploding bodyscartough girlknocked outrace against timeelectrocutioncreaturedouble crossdisarming someonedream sequencetied to a chairdeath of friendmountainmassacreambushgood versus evilscientisthallucinationsecond partbombheld at gunpointriflefalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingpartyexplosionbare chested malebloodflashbackviolencesequel (See All) |
Life for former United Nations investigator Gerry Lane and his family seems content. Suddenly, the world is plagued by a mysterious infection turning whole human populations into rampaging mindless zombies. After barely escaping the chaos, Lane is persuaded to go on a mission to investigate this dis …ease. What follows is a perilous trek around the world where Lane must brave horrific dangers and long odds to find answers before human civilization falls. (Read More)
Themes: | surveillanceescapesuicidemurderdeath |
Locations: | laboratorydeserthelicopter |
Characters: | sniper riflesnipersoldierzombie |
Story: | assault rifleimmunityopen endedcurereluctant heroepidemiccafeteriagatling gunfalling to deathcommandoinfectionpower outagediseasevirusmachete …missileak 47mercenaryexploding bodyinjectionshot in the foreheadcreaturetied to a chairdeath of friendfoot chasesurvivalshot in the backscientistrevolverinterrogationbombriflefalling from heightbattlerescueshotgunshot in the chestshot to deathcorpseshootoutpistolsurprise endingexplosionbare chested malebased on novelbloodviolenceflashback (See All) |
With the Games destroyed, Katniss Everdeen, along with Gale, Finnick and Beetee, end up in the so thought "destroyed" District 13. Under the leadership of President Coin and the advice of her friends, Katniss becomes the "Mockingjay", the symbol of rebellion for the districts of Panem.
Subgenre: | cyberpunkdystopiapost apocalypsesuspense |
Themes: | hopedeceptiontorturefearmurderfriendshipdeath |
Locations: | airshiplaboratory |
Characters: | soldierteenager |
Story: | commando raidresistance fighterbased on young adult novelteenage heroopen endedfight the systemwhistlinghologrampower outageresistancesocial commentaryhypodermic needlemissilemercenaryexploding body …tough girlknocked outrace against timeno opening creditsambushflashlightgood versus evilscientistbombriflerescueshot in the chestshot to deathcorpsefirepistolsurprise endingexplosionbased on novelsequelviolence (See All) |
An apocalyptic story set in the furthest reaches of our planet, in a stark desert landscape where humanity is broken, and almost everyone is crazed fighting for the necessities of life. Within this world exist two rebels on the run who just might be able to restore order. There's Max, a man of actio …n and a man of few words, who seeks peace of mind following the loss of his wife and child in the aftermath of the chaos. And Furiosa, a woman of action and a woman who believes her path to survival may be achieved if she can make it across the desert back to her childhood homeland. (Read More)
Subgenre: | dystopiapost apocalypse |
Themes: | near death experiencehopeparanoiadeceptionescapefearbetrayalkidnappingdeathmurder |
Locations: | desert |
Characters: | sniper rifletough guyhostage |
Story: | sawed off shotgundark futuresandstormreluctant herohanging upside downgatling guncrowdiseasemachetehead buttrevelationak 47exploding bodyscartough girl …fugitiveon the rundouble crossdisarming someoneno opening creditsambushfoot chasegood versus evilsurvivalshot in the backrevolverhallucinationbombheld at gunpointriflefalling from heightpunched in the faceslow motion scenerescueshotgunshot in the chestcorpseshootoutfirepistolsurprise endingexplosionbare chested maleviolenceflashbackbloodsequel (See All) |
Bill Pope (Ryan Reynolds) is a CIA agent on a mission in London tracking down a shadowy hacker nicknamed "The Dutchman." When he gets mysteriously ambushed and killed, an experimental procedure is used to transfer his memories into dangerous convict Jericho Stewart (Kevin Costner). When he wakes up …with the CIA agent's memories, his mission is to find The Dutchman and make the deal with him before the hacker launches ICBM's and starts World War III. But complications soon arise and the mission turns personal. (Read More)
Subgenre: | suspense |
Themes: | surveillanceparanoiamemorydeceptionescapetorturefearbetrayalkidnappingdeathmurder |
Locations: | laboratoryhelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | commando raidassault rifleuh 1 huey helicopterpickpocketmoral dilemmaraised middle fingercommandowalkie talkiehypodermic needleeavesdroppingmissileobscene finger gesturemercenaryratshot in the shoulder …injectionscarknocked outcharacter's point of view camera shotrace against timefugitiveelectrocutionshot in the foreheadon the rundouble crossdisarming someoneno opening creditstied to a chairfoot chasesubjective camerashot in the backinterrogationheld at gunpointpunched in the facerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested malebloodflashbackviolence (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to … survive the night in Los Angeles. (Read More)
Subgenre: | dystopiasuspense |
Themes: | near death experiencesurveillancedeceptionkidnappingdeathmurder |
Characters: | sniper riflesnipertough guyhostage |
Story: | resistance fighterassault riflegatling gunresistancemacheteak 47mercenaryshot in the shouldercharacter's point of view camera shotrace against timeshot in the foreheadon the runno opening creditstied to a chairambush …foot chasesurvivalshot in the backrevolversecond partheld at gunpointslow motion scenerescueshotgunshot in the chestshot to deathcorpseshootoutfirepistolsurprise endingexplosionbare chested malesequelviolenceblood (See All) |
It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter …mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)
Themes: | near death experiencesurveillancedeceptionescapetorturefearbetrayalkidnappingsuicidedeathmurder |
Locations: | laboratoryhelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | assault rifledistrusthanging upside downabandoned buildinggatling gunlasersightjumping through a windowcommandopower outagewalkie talkiehypodermic needlemachetehead buttmissileak 47 …mercenaryexploding bodyinjectionscartough girlknocked outcharacter's point of view camera shotrace against timeelectrocutionshot in the foreheadcreaturedouble crossno opening creditstied to a chairmassacreambushsubjective camerasurvivalshot in the backscientistrevolverhallucinationinterrogationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested maleflashbackviolence (See All) |
Awakening in an elevator, remembering nothing of his past, Thomas emerges into a world of about thirty teenage boys, all without past memories, who have learned to survive under their own set of rules in a completely enclosed environment, subsisting on their own agriculture and supplies. With a new …boy arriving every thirty days, the group has been in "The Glade" for three years, trying to find a way to escape through the Maze that surrounds their living space (patrolled by cyborg monsters named 'Grievers'). They have begun to give up hope when a comatose girl arrives with a strange note, and their world begins to change with the boys dividing into two factions: those willing to risk their lives to escape and those wanting to hang onto what they've got and survive. (Read More)
Subgenre: | dystopiapost apocalypsesuspense |
Themes: | near death experiencehopeescapefearsuicidemurderdeathfriendship |
Locations: | tunnellaboratorydeserthelicopter |
Characters: | teenage boyteenager |
Story: | uh 1 huey helicopterbased on young adult novelhuman experimentopen endedfalling to deathinfectionvirusdiseasemacheterevelationsyringeinjectioncharacter's point of view camera shotcreaturedream sequence …no opening creditsdeath of friendfoot chasesubjective camerasurvivalscientistrunningheld at gunpointbattlepunched in the faceslow motion sceneshot in the chestshot to deathcorpsepistolsurprise endingbare chested malebased on novelflashbackviolenceblood (See All) |
CIA chief Hunley (Baldwin) convinces a Senate committee to disband the IMF (Impossible Mission Force), of which Ethan Hunt (Cruise) is a key member. Hunley argues that the IMF is too reckless. Now on his own, Hunt goes after a shadowy and deadly rogue organization called the Syndicate.
Subgenre: | suspense |
Themes: | near death experiencesurveillancedeceptionescapetorturebetrayalkidnappingmurderdeath |
Locations: | helicopter |
Characters: | sniper riflesnipertough guyhostage |
Story: | commando raidassault riflevinylmoral dilemmalasersightfalling to deathjumping through a windowcapturerevelationak 47tough girlknocked outcharacter's point of view camera shotrace against timefugitive …electrocutionon the rundouble crossambushfoot chasesubjective camerashot in the backinterrogationbombheld at gunpointfalling from heightpunched in the faceslow motion scenerescueshot in the chestshot to deathbeatingshootoutpistolsurprise endingbare chested maleflashbackviolencesequel (See All) |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
Subgenre: | suspense |
Themes: | paranoiadeceptionescapefearbetrayalkidnappingsuicidemurderdeath |
Characters: | sniper rifleevil doctorsnipertough guyhostagesoldier |
Story: | open endedhanging upside downmoral dilemmagatling gunlasersightfalling to deathmachetehead buttak 47mercenaryexploding bodyshot in the shouldertough girlcharacter's point of view camera shotelectrocution …creaturedouble crossno opening creditsambushfoot chasesubjective camerasurvivalshot in the backheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpseshootoutfirepistolsurprise endingexplosionbare chested malesequelbloodviolence (See All) |
Despite his tarnished reputation after the events of The Dark Knight, in which he took the rap for Dent's crimes, Batman feels compelled to intervene to assist the city and its police force which is struggling to cope with Bane's plans to destroy the city.
Subgenre: | suspense |
Themes: | hopesurveillanceparanoiadeceptionescapetorturebetrayalkidnappingsuicidemurderdeath |
Locations: | tunneldeserthelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | sawed off shotgundetonatorfight the systemreluctant heroreturning character killed offpickpocketgatling gunjumping through a windowcommandopower outagesocial commentarywalkie talkiehypodermic needlehead buttrevelation …missileak 47mercenaryexploding bodyinjectiontough girlknocked outcharacter's point of view camera shotrace against timefugitiveon the rundouble crossdisarming someoneno opening creditsmassacreambushfoot chasegood versus evilsubjective camerashot in the backscientisthallucinationinterrogationbombheld at gunpointriflefalling from heightbattlepunched in the facerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingpartyexplosionbare chested malesequelflashback (See All) |
When drug violence worsens on the USA Mexico border, the FBI sends an idealistic agent, Kate Macer (Emily Blunt) on a mission to eradicate a drug cartel responsible for a bomb that had killed members of her team.
Subgenre: | suspense |
Themes: | near death experiencesurveillanceparanoiadeceptionescapetorturebetrayalkidnappingdeathmurderfriendship |
Locations: | tunneldeserthelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | commando raidassault rifledistrustmoral dilemmacommandoak 47mercenaryshot in the shouldertough girlcharacter's point of view camera shotshot in the foreheaddouble crossdisarming someoneno opening creditstied to a chair …ambushsubjective camerashot in the backinterrogationbombheld at gunpointpunched in the facerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingexplosionbare chested maleviolence (See All) |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo …rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypse |
Themes: | surveillanceescapetorturekidnappingdeathmurder |
Locations: | airshiplaboratoryhelicopter |
Characters: | tough guyhostagesoldierzombie |
Story: | running for your lifemegacorporationevil corporationopen endedreturning character killed offhologramcommandoinfectionpower outageresistancevirusdiseasehypodermic needlesyringemercenary …exploding bodyshot in the shoulderinjectiontough girlrace against timeshot in the foreheadcreaturefoot chasesurvivalshot in the backinterrogationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathshootoutpistolsurprise endingexplosionsequelflashbackbloodviolence (See All) |
With many people fearing the actions of super heroes, the government decides to push for the Hero Registration Act, a law that limits a hero's actions. This results in a division in The Avengers. Iron Man stands with this Act, claiming that their actions must be kept in check otherwise cities will c …ontinue to be destroyed, but Captain America feels that saving the world is daring enough and that they cannot rely on the government to protect the world. This escalates into an all-out war between Team Iron Man (Iron Man, Black Panther, Vision, Black Widow, War Machine, and Spider-Man) and Team Captain America (Captain America, Bucky Barnes, Falcon, Scarlet Witch, Hawkeye, and Ant Man) while a new villain emerges. (Read More)
Subgenre: | suspense |
Themes: | near death experiencesurveillanceparanoiadeceptionescapetorturefearbetrayalkidnappingsuicidedeathfriendshipmurder |
Locations: | laboratoryhelicopter |
Characters: | tough guyhostagesoldierteenage boyteenager |
Story: | commando raidteenage heroopen endedhanging upside downreturning character killed offabandoned buildingmoral dilemmagatling gunlasersightjumping through a windowhologrampower outagesocial commentarymachetehead butt …revelationmissileak 47mercenaryexploding bodytough girlknocked outcharacter's point of view camera shotrace against timefugitiveelectrocutionshot in the foreheadon the rundouble crossdisarming someoneno opening creditsmountainambushflashlightfoot chasesubjective camerascientistinterrogationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested malebloodsequelviolenceflashback (See All) |
The city of Spokane, Washington is awakened by a North Korean paratrooper invasion. Marine Corps veteran Jed Eckert and his civilian brother, Matt, escape with a group of friends to an isolated cabin in the woods, where they witness the execution of their father at the hands of the ruthless Captain …Cho. The brothers unite with their friends to form a guerrilla resistance group--the Wolverines--to drive the invaders from their home. (Read More)
Themes: | hopesurveillanceparanoiadeceptionescapefearbetrayalkidnappingdeathfriendshipmurder |
Locations: | helicopter |
Characters: | sniper riflesnipertough guyhostagesoldierteenage boyteenager |
Story: | resistance fightertelescopic rifleassault rifleteenage heroopen endedgatling gunraised middle fingerjumping through a windowcommandopower outageresistanceak 47mercenaryexploding bodytough girl …knocked outrace against timedouble crossdisarming someonedeath of friendambushsurvivalshot in the backrevolverbombheld at gunpointriflebattlerescueshotgunshot in the chestshot to deathshootoutpistolsurprise endingexplosionviolence (See All) |
Civil Unrest in the European country of Moldova has US forces engaging the insurgents however there is a new threat who has decided both are their enemy. This new threat resides in an alternative spectrum that makes them invisible to the naked eye and instant death to anyone confronting them. Locals … believe they are Spirits of War but others believe they are superior arms technology fabricated by the Moldova government.. (Read More)
Subgenre: | suspense |
Themes: | near death experienceparanoiaescapefearmurderdeath |
Locations: | laboratoryhelicopter |
Characters: | sniper riflesnipertough guysoldier |
Story: | commando raidassault riflehuman experimenthanging upside downabandoned buildinggatling gunlasersightcommandopower outagesocial commentarywalkie talkieak 47mercenaryexploding bodytough girl …character's point of view camera shotrace against timemassacreambushflashlightgood versus evilsurvivalsubjective camerascientistbombheld at gunpointfalling from heightbattleslow motion scenerescueshotguncorpsepistolsurprise endingexplosionbloodviolence (See All) |
Subgenre: | suspense |
Themes: | surveillanceparanoiadeceptionescapefearbetrayalkidnappingdeathmurderfriendship |
Locations: | desert |
Characters: | snipertough guyhostageteenager |
Story: | assault riflesawed off shotgunreluctant heromoral dilemmahead buttak 47exploding bodyshot in the shoulderscarknocked outcharacter's point of view camera shotrace against timefugitiveshot in the foreheadon the run …double crossdisarming someoneno opening creditsdeath of friendambushsurvivalsubjective camerashot in the backrevolverheld at gunpointriflepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathbeatingshootoutpistolsurprise endingpartyexplosionbare chested malebased on novelbloodviolence (See All) |
Almost eleven years after the futile and disastrous expedition on the distant moon LV-223, the deep-space colonisation vessel Covenant equipped with more than 2,000 colonists in cryogenic hibernation, sets a course for the remote planet Origae-6 with the intention to build a new world. Instead, a ro …gue transmission will entice the crew to a nearby habitable small planet which resembles The Earth. The unsuspecting members of Covenant will have to cope with biological foes, beyond human comprehension. Ultimately, what was intended as a peaceful exploratory mission, will soon turn into a desperate rescue operation deep into the cold infinite space. (Read More)
Subgenre: | suspense |
Themes: | near death experiencesurveillanceparanoiadeceptionescapefearbetrayalmurderdeath |
Locations: | laboratory |
Characters: | sniper riflesniperhostagesoldier |
Story: | assault rifledistrustreluctant heroreturning character killed offmoral dilemmalasersightraised middle fingerholograminfectionvirusobscene finger gesturemercenaryexploding bodyscartough girl …character's point of view camera shotrace against timecreaturedouble crossdisarming someonedeath of friendmountainmassacreflashlightsurvivalsubjective camerashot in the backscientistsecond partheld at gunpointfalling from heightpunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingfirepistolsurprise endingexplosionbare chested malesequelviolenceflashbackblood (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
Subgenre: | suspense |
Themes: | near death experiencesurveillancememorydeceptionescapetorturebetrayalkidnappingdeathmurder |
Locations: | airshiplaboratoryhelicopter |
Characters: | sniper riflesnipertough guyhostagesoldierprostitute |
Story: | sawed off shotgundetonatorabandoned buildinggatling gunraised middle fingerjumping through a windowcommandowalkie talkiemachetehead buttak 47obscene finger gesturemercenaryexploding bodyshot in the shoulder …knocked outcharacter's point of view camera shotfugitiveelectrocutionshot in the foreheadon the rundouble crossdisarming someonetied to a chairmassacreambushfoot chasegood versus evilsurvivalsubjective camerashot in the backscientistrevolverinterrogationbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionbare chested malebloodflashbackviolence (See All) |
All looks lost for the Rebellion against the Empire as they learn of the existence of a new super weapon, the Death Star. Once a possible weakness in its construction is uncovered, the Rebel Alliance must set out on a desperate mission to steal the plans for the Death Star. The future of the entire …galaxy now rests upon its success. (Read More)
Subgenre: | suspense |
Themes: | hopeparanoiadeceptionescapetorturefearbetrayalkidnappingfriendshipmurderdeath |
Locations: | desert |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | resistance fighterassault riflecollapsing buildingdistrustopen endedfight the systemyoung version of characterreturning character killed offmoral dilemmafalling to deathcapturehologrampower outageresistancesocial commentary …mercenaryexploding bodyshot in the shouldertough girlknocked outcharacter's point of view camera shotrace against timeelectrocutionon the runcreaturedouble crossno opening creditstied to a chairdeath of friendmassacreambushgood versus evilsubjective camerasurvivalshot in the backscientistinterrogationbombheld at gunpointfalling from heightbattlerescueshot in the chestshot to deathcorpseshootoutfirepistolexplosionviolenceflashback (See All) |
After the British Prime Minister has passed away under mysterious circumstances, all leaders of the Western world must attend his funeral. But what starts out as the most protected event on earth, turns into a deadly plot to kill the world's most powerful leaders and unleash a terrifying vision of t …he future. The President of the United States, his formidable secret service head and a British MI-6 agent who trusts no one are the only people that have any hope of stopping it. (Read More)
Themes: | hopesurveillancedeceptionescapetorturebetrayalkidnappingsuicidemurderfriendshipdeath |
Locations: | deserthelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | commando raidassault rifleuh 1 huey helicopterfalling down an elevator shaftreturning character killed offgatling guncommandopower outagewalkie talkiemacheterevelationmissileak 47mercenaryexploding body …shot in the shoulderknocked outcharacter's point of view camera shotrace against timeshot in the foreheaddisarming someonetied to a chairmassacreambushgood versus evilsubjective camerashot in the backsecond partbombheld at gunpointbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionsequelviolence (See All) |
In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead …that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)
Subgenre: | cyberpunkdystopiapost apocalypse |
Themes: | surveillancedeceptionescapebetrayalkidnappingmurderdeath |
Locations: | tunnelhelicopter |
Characters: | sniper riflesniperhostagesoldierzombie |
Story: | sawed off shotgunmegacorporationopen endedcrowholograminfectionsocial commentaryvirusrevelationmercenaryexploding bodyshot in the shoulderinjectiontough girlshot in the forehead …creaturedeath of friendmassacremountainflashlightgood versus evilsurvivalshot in the backrevolverbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathshootoutpistolsurprise endingexplosionviolenceflashbackbloodsequel (See All) |
A race of non-corporeal, parasitic aliens who go from planet to planet looking for hosts have come to Earth and basically taken over the human race. It's believed that, once inside a body, all memories of the host human are gone. Some few free humans remain hidden from them, forming a resistance gro …up. When an alien Seeker captures a girl named Melanie and puts a Wanderer in her body, she hopes to find out where the remaining humans are gathered, but Melanie, a strong fighter able to converse with the alien in her commandeered body, convinces the Wanderer to say nothing. Disappointed by the lack of progress (though suspecting an empathy for the human), the Seeker informs the Wanderer that she'll be removed and placed in a new host while she herself will enter Melanie. With human lives at risk, Melanie convinces Wanderer to run away and hide out with the humans, but finding them doesn't mean they'll allow an alien presence among them. Jared (Melanie's boyfriend) wants her dead, but Jeb (Melanie's uncle) wants to wait, and Ian, tasked with guarding her, finds himself siding with Jeb. As Ian begins to fall for Melanie, a strange love triangle develops, with Ian wanting Wanderer (inhabiting Melanie's body), Jared wanting Melanie (imprisoned inside her own body), and no one knowing any way to separate the two without killing both. (Read More)
Subgenre: | dystopiapost apocalypse |
Themes: | near death experiencehopeunrequited loveparanoiamemorydeceptionescapefearbetrayalkidnappingsuicidemurderdeath |
Locations: | tunneldeserthelicopter |
Characters: | hostageteenager |
Story: | resistance fighterbased on young adult noveldistrustopen endedmoral dilemmacaptureinfectionresistancesocial commentaryhypodermic needlemachetehead buttrevelationak 47shot in the shoulder …injectiontough girlknocked outrace against timefugitiveon the rundouble crossno opening creditsmountainflashlightfoot chasesurvivalscientistrevolverheld at gunpointriflefalling from heightpunched in the facerescueshotguncorpsebeatingpistolsurprise endingbare chested malebased on novelflashback (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | dystopia |
Themes: | near death experiencehopeunrequited loveparanoiadeceptionescapefearbetrayalkidnappingmurderfriendshipdeath |
Characters: | tough guyhostagesoldierzombie |
Story: | open endedfight the systemepidemicmoral dilemmainfectiondiseaserevelationeavesdroppingexploding bodyscartough girlknocked outcharacter's point of view camera shotrace against timetent …double crossdisarming someonemassacreambushgood versus evilsurvivalsubjective camerahallucinationheld at gunpointriflefalling from heightbattlepunched in the faceslow motion scenerescuecorpsebeatingfirepistolsurprise endingpartyexplosionbased on novelbloodflashbackviolence (See All) |
In a dystopian near future, humanity has been ravaged by a mysterious fungal disease. The afflicted are robbed of all free will and turned into flesh-eating 'hungries'. Humankind's only hope is a small group of hybrid children who crave human flesh but retain the ability to think and feel. The child …ren go to school at an army base in rural Britain, where they're subjected to cruel experiments by Dr. Caroline Caldwell (Glenn Close). School teacher Helen Justineau (Gemma Arterton) grows particularly close to an exceptional girl named Melanie (Sennia Nanua), thus forming a special bond. But when the base is invaded, the trio escape with the assistance of Sgt. Eddie Parks (Paddy Considine) and embark on a perilous journey of survival, during which Melanie must come to terms with who she is. (Read More)
Subgenre: | dystopiapost apocalypsesuspense |
Themes: | near death experiencehopeparanoiadeceptionescapefearkidnappingmurderdeath |
Locations: | laboratory |
Characters: | hostagesoldierzombie |
Story: | assault rifledistrustcureblood on shirtmoral dilemmainfectionsocial commentarywalkie talkiediseasevirushypodermic needleratinjectionknocked outrace against time …shot in the foreheadcreaturedisarming someoneno opening creditstied to a chairmassacreambushflashlightsurvivalshot in the backscientistheld at gunpointbattleslow motion scenerescueshot in the chestshot to deathcorpsebeatingfirepistolsurprise endingbased on novelbloodviolence (See All) |
Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing, …to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)
Themes: | near death experiencesurveillancedeceptionescapebetrayalkidnappingdeathfriendshipmurder |
Locations: | helicopter |
Characters: | sniper riflesnipertough guyhostageteenage boyteenager |
Story: | assault riflereluctant herohanging upside downpickpocketlasersightjumping through a windowshopping mallwalkie talkiehead buttrevelationak 47shot in the shoulderscarknocked outcharacter's point of view camera shot …race against timeshot in the foreheaddouble crossdisarming someonedeath of friendmassacreambushflashlightfoot chasegood versus evilsubjective camerashot in the backrevolverinterrogationbombheld at gunpointfalling from heightpunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingpartyexplosionbare chested malesequelviolencebloodflashback (See All) |
For Steve Rogers, awakening after decades of suspended animation involves more than catching up on pop culture; it also means that this old school idealist must face a world of subtler threats and difficult moral complexities. That becomes clear when Director Nick Fury is killed by the mysterious as …sassin, the Winter Soldier, but not before warning Rogers that SHIELD has been subverted by its enemies. When Rogers acts on Fury's warning to trust no one there, he is branded as a traitor by the organization. Now a fugitive, Captain America must get to the bottom of this deadly mystery with the help of the Black Widow and his new friend, The Falcon. However, the battle will be costly for the Sentinel of Liberty, with Rogers finding enemies where he least expects them while learning that the Winter Soldier looks disturbingly familiar. (Read More)
Subgenre: | suspense |
Themes: | hopesurveillanceparanoiadeceptiontorturebetrayalkidnappingfriendshipmurderdeath |
Locations: | helicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | commando raiddistrustopen endedreturning character killed offblood on shirtgatling gunlasersightjumping through a windowhologramcommandoshopping mallhead buttrevelationeavesdroppingmissile …mercenaryshot in the shouldertough girlknocked outrace against timefugitiveelectrocutionon the runno opening creditsflashlightfoot chasegood versus evilshot in the backsecond partheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathbeatingshootoutfirepistolsurprise endingexplosionbare chested maleflashbackbloodsequelviolence (See All) |
Twenty three-year-old Mitch lost his parents to a tragic car accident at the age of fourteen, and his girlfriend to a terrorist attack just as they were engaged. Seeking revenge, he is enlisted by CIA Deputy Director Irene Kennedy as a black ops recruit. Kennedy then assigns Cold War veteran Stan Hu …rley to train Mitch. Together they will later on investigate a wave of apparently random attacks on military and civilian targets. The discovery of a pattern in the violence leads them to a joint mission with a lethal Turkish agent to stop a mysterious operative intent on starting a world war in the Middle East. (Read More)
Subgenre: | suspense |
Themes: | near death experiencesurveillancedeceptionescapetorturebetrayalkidnappingsuicidedeathmurder |
Locations: | tunnellaboratoryhelicopter |
Characters: | sniper riflesnipertough guyhostagesoldier |
Story: | commando raidassault riflepickpocketjumping through a windowhologramcommandowalkie talkieeavesdroppingak 47mercenaryshot in the shoulderscartough girlknocked outcharacter's point of view camera shot …race against timeelectrocutionshot in the foreheaddouble crossdisarming someoneno opening creditstied to a chairmassacreambushflashlightfoot chasesubjective camerashot in the backscientisthallucinationinterrogationbombheld at gunpointpunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingexplosionbare chested malebased on novelviolencebloodflashback (See All) |
Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle …dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)
Subgenre: | cyberpunksuspense |
Themes: | surveillanceparanoiamemorydeceptionescapefearbetrayalkidnappingdeathmurder |
Locations: | laboratorydeserthelicopter |
Characters: | tough guyhostagesoldier |
Story: | evil corporationmegacorporationfight the systemyoung version of charactersocial commentaryhypodermic needlerevelationeavesdroppingmercenaryinjectionscartough girlknocked outcharacter's point of view camera shotrace against time …electrocutiondouble crossno opening creditsmassacreambushfoot chasegood versus evilsubjective camerashot in the backscientisthallucinationbombbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsefiresurprise endingexplosionbare chested maleflashbackbloodviolence (See All) |
In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra …nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)
Subgenre: | cyberpunkdystopiasuspense |
Themes: | hopeparanoiadeceptionescapetorturefearbetrayalkidnappingdeathmurder |
Locations: | laboratorydeserthelicopter |
Characters: | tough guyhostagesoldier |
Story: | commando raidassault rifledark futuremegacorporationevil corporationfight the systemreluctant heroreturning character killed offabandoned buildingblood on shirtmoral dilemmagatling guncommandosocial commentarywalkie talkie …virushypodermic needlemercenaryexploding bodyshot in the shoulderinjectionscarknocked outcharacter's point of view camera shotrace against timefugitiveelectrocutionshot in the foreheadon the rundouble crossdisarming someonemassacreflashlightfoot chasesurvivalsubjective camerashot in the backscientistrevolverinterrogationrunningheld at gunpointpunched in the facerescueshotgunshot in the chestshot to deathcorpsebeatingfirepistolsurprise endingexplosionbare chested malebloodviolencesequel (See All) |
During an operation of a Mexican Cartel, Machete Cortez and Sartana Rivera intercept the criminals alone, but another group arrives and a masked man kills Sartana. Machete is arrested, accused of killing his beloved Sartana and Sheriff Doakes hangs Machete. But the President of the USA Rathcock pard …ons and recruits Machete to kill the revolutionary Marcos Mendez that has threatened the USA with a missile with a bomb. Machete goes to San Antonio to meet the Miss San Antonio Blanca Vasquez that will be the liaison between Machete and President Rathcock. Then Machete goes to the brothel of Madame Desdemona to seek out the prostitute Cereza that is Mendez's mistress. Machete meets Mendez and learns that his heart is connected to the missile and only the arm dealer Luther Voz is capable to disarm the bomb. Now Machete needs to bring Mendez to the USA in less than twenty-four hours and save his new country in a dangerous journey with betrayals. (Read More)
Themes: | surveillancedeceptionescapetorturebetrayalkidnappingdeathmurder |
Locations: | deserthelicopter |
Characters: | tough guyhostagesoldierprostitute |
Story: | assault riflesawed off shotgunopen endedreluctant heroreturning character killed offgatling gunjumping through a windowhologrammachetehead buttmissileak 47obscene finger gesturemercenaryexploding body …shot in the shouldertough girlrace against timeelectrocutionshot in the foreheadon the rundouble crosstied to a chairmassacreambushfoot chaseshot in the backscientistrevolversecond partbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestshot to deathshootoutpistolsurprise endingexplosionbare chested malesequelflashbackviolenceblood (See All) |
Two petty if violent criminals kidnap a girl being paid $1m to be a surrogate mother. As the baby is for a gangster the pair's demand for money sees several henchmen and assorted other ruthless characters head after them to Mexico. Bullets rather than talking are always going to settle this one.
Subgenre: | suspense |
Themes: | paranoiadeceptionescapetorturebetrayalkidnappingsuicidedeathmurderfriendship |
Locations: | desert |
Characters: | sniper riflesnipertough guyhostageprostitute |
Story: | telescopic rifleblood on shirtwalkie talkiehypodermic needlehead buttrevelationeavesdroppingak 47shot in the shoulderinjectionscarfugitiveon the rundouble crossdisarming someone …massacreambushshot in the backrevolverinterrogationheld at gunpointriflepunched in the facerescueshotgunshot in the chestshot to deathcorpsebeatingshootoutpistolsurprise endingbare chested malebloodviolence (See All) |