Please wait - finding best movies...
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
| Subgenre: | survival horrorcorporate conspiracyzombie apocalypsepost apocalypticcyberpunkdystopiapost apocalypseconspiracymartial arts |
| Themes: | artificial intelligenceself sacrificepanichopesurveillanceillnessinsanityredemptionparanoiabrutalityangerdeceptionmonsterescapefear …betrayalkidnappingdeathrevengemurder (See All) |
| Mood: | gore |
| Locations: | cable carhumveesewertunnellaboratoryrooftopwheelchairmotorcycle |
| Characters: | engineerprofessorbiblesecurity guardhostagesoldierzombiefemale protagonistdoctorboyfriend girlfriend relationshipfather daughter relationship |
| Period: | seeing the futurezip line |
| Story: | siren the alarmfemale engineerfemale mechaniclaser cutterresistance fighteranti heroinerocket launchersecret laboratorynight vision binocularsaction heroinewinged creaturegiant creaturesurveillance footageone woman armymad scientist …final showdownfinal battlechild soldierfemale soldiergiant monsterhand to hand combatperson on fireknife throwingmad doctorthreatened with a knifeunderground complexcomputer controlraccoon cityreference to genesishivekilled by a propellerabandoned cityresident evilslow motion action scenehanged bodyhordeice pickcontact lenshockey stickbackflipcraterbusiness partnerreference to noah's arklast of seriesimplantsuper computerspikeflash drivecubestabbed in the footpandemicdeoxyribonucleic acidcorporate crimenail gunchild with a gunbarricadedetonatorlast standantidotefight the systemevil corporationmegacorporationlandmineanimal killingsevered footspray paintoutbreakfirecrackerhummerarmorychainscut into pieceswoman fights a mansole black character dies clichejumping into watercloningsixth partshot through the mouthsubterraneandistrustshot in the footopen endedcurecountdownwoman kills a manbitten in the neckgenetic engineeringfemale herosawed off shotgunhelicopter crashhanging upside downyoung version of characterstabbed in the armflareworld dominationcommanderinformantbunkermegalomaniacsuper strengtharmored carreturning character killed offfemale fighterburned to deathliving deadabandoned buildingbarbed wireenglishman abroaddesert eagletorso cut in halffast motion scenebullet timesatellitefight to the deathgatling gunrocketsevered legclonesirenstabbed in the eyeraised middle fingerbody landing on a cargasolineaerial shotairplane crashbooby traphologrampunched in the cheststabbed in the leginfectioncigarette lightershot in the facebroken glassbased on video gamestabbed in the throathit in the crotchpower outageevacuationdual wieldchaosmercilessnesshatredsevered fingerresistancestealing a carfemale warrioreaten alivesocial commentarymechanicmexican standoffcyborganimal attackend of the worldwhite housegun fustrong female leadtorchgenocidejumping from heightlasersevered handkicked in the stomachdesperationwristwatchwalkie talkiesecurity cameracrucifixvirusdiseaseelectronic music scorehypodermic needlesociopathmachetehead buttheroineburned alivestylized violencehand grenaderevelationdestructionfireplacesabotagetraitoruziropemissilewashington d.c.ak 47henchmanbattlefieldundeadobscene finger gestureshot in the armsevered armwaterfallmercenaryopening action sceneexploding bodyshot in the shoulderscarkicked in the facetough girlknocked outcharacter's point of view camera shottankevil manactor playing multiple rolescover uprace against timemissionbeaten to deathfired from the jobelectrocutionlocker roomstabbed in the backprologuedangerbinocularsone against manyshot in the foreheadshot in the legnecklacevoice overunderwater scenecreaturefictional wardouble crossdisarming someoneno opening creditssevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationambushflashlightgood versus evilsurvivalsubjective cameradecapitationshot in the backkung fuscientistcombatinterrogationcar crashrunningbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutvoice over narrationfirepistolsurprise endingchaseknifeexplosionfightdogflashbacksequelviolenceblood (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | self sacrificepanicsurveillanceredemptionparanoiabrutalityangerdeceptionescapefearbetrayaldeathmurder |
| Mood: | gore |
| Locations: | tunnellaboratorymotorcycle |
| Characters: | security guardhostagesoldierfemale protagonist |
| Story: | anti heroinesecret laboratoryaction heroinesurveillance footageone woman armyfinal showdownfinal battlefemale soldierhand to hand combatknife throwingthreatened with a knifeslow motion action scenehummerarmorywoman fights a man …distrustshot in the footopen endedwoman kills a manhanging upside downstabbed in the armsuper strengthreturning character killed offfemale fighterburned to deathdesert eagletorso cut in halfbullet timefight to the deathstabbed in the eyeaerial shothologrampunched in the cheststabbed in the legshot in the facestabbed in the throatdual wieldmercilessnessstealing a carfemale warriormexican standoffgun fustrong female leadjumping from heightkicked in the stomachsecurity camerahypodermic needleburned alivestylized violencerevelationtraitoruziak 47henchmanbattlefieldshot in the armsevered armopening action sceneshot in the shoulderkicked in the facetough girlknocked outevil manbeaten to deathstabbed in the backdangerone against manyshot in the foreheadshot in the legfictional wardouble crossdisarming someoneno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationambushflashlightsurvivaldecapitationshot in the backcombatinterrogationbombheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutvoice over narrationpistolsurprise endingchaseknifeexplosionbloodflashbacksequelviolencefight (See All) |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo …rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
| Subgenre: | survival horrorzombie apocalypsecyberpunkdystopiapost apocalypsemartial arts |
| Themes: | artificial intelligenceself sacrificesurveillancemonsterescapekidnappingdeathrevengemurder |
| Mood: | gore |
| Locations: | laboratoryrooftopmotorcycle |
| Characters: | hostagesoldierzombiefemale protagonist |
| Story: | laser cutterrocket launcheraction heroinegiant creatureone woman armyfemale soldiergiant monsterhand to hand combatthreatened with a knifecomputer controlraccoon cityresident evilsuper computerpandemiccorporate crime …megacorporationevil corporationwoman fights a mansubterraneanopen endedbitten in the neckgenetic engineeringfemale herohelicopter crashsuper strengtharmored carreturning character killed offfemale fighterdesert eaglebullet timecloneairplane crashhologrampunched in the chestinfectionshot in the facebased on video gamepower outagedual wieldresistancefemale warrioreaten alivemexican standoffend of the worldwhite housegun fulaserkicked in the stomachwristwatchsecurity cameravirusdiseasehypodermic needleheroinestylized violencehand grenadewashington d.c.battlefieldshot in the armmercenaryexploding bodyshot in the shoulderkicked in the facetough girlrace against timemissionone against manyshot in the foreheadshot in the legunderwater scenecreaturemixed martial artsimpalementarmystrangulationsurvivalshot in the backcombatinterrogationcar crashbombheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosionbloodviolencesequelfightflashback (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | artificial intelligenceself sacrificepanicsurveillanceinsanitybrutalitydeceptionescapebetrayalkidnappingmurderdeathrevenge |
| Mood: | gore |
| Locations: | laboratoryrooftopwheelchairmotorcycle |
| Characters: | security guardhostagesoldierdoctor |
| Story: | rocket launchersecret laboratorymad scientistfinal showdownfinal battlehand to hand combatperson on fireknife throwingkilled by a propellerimplantsuper computerdetonatorarmoryhummercut into pieces …cloningwoman kills a mansawed off shotgunstabbed in the armworld dominationmegalomaniacsuper strengtharmored carburned to deathabandoned buildingenglishman abroadbullet timefight to the deathgatling gunclonestabbed in the eyeraised middle fingerbody landing on a carpunched in the cheststabbed in the legcigarette lightershot in the facestabbed in the throatdual wieldchaosmercilessnessstealing a carcyborggun fujumping from heightlaserkicked in the stomachwalkie talkieelectronic music scoresociopathmachetehead buttburned alivestylized violencehand grenadedestructionuziak 47henchmanobscene finger gestureshot in the armsevered armmercenaryexploding bodyshot in the shoulderkicked in the faceknocked outcharacter's point of view camera shottankevil manbeaten to deathelectrocutionstabbed in the backdangerone against manyshot in the foreheadshot in the legunderwater scenedouble crossdisarming someonesevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationambushgood versus evilsubjective camerasurvivaldecapitationshot in the backscientistcombatinterrogationcar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosiondogflashbackbloodfightviolence (See All) |
It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter …mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)
| Subgenre: | martial arts |
| Themes: | self sacrificepanicsurveillanceinsanityredemptionbrutalitydeceptionmonsterescapefearbetrayalkidnappingmurderdeathrevenge |
| Locations: | sewerlaboratoryrooftopwheelchair |
| Characters: | security guardhostagesoldierboyfriend girlfriend relationshipfather daughter relationship |
| Story: | anti heroinerocket launcheraction heroinefinal showdownfinal battlegiant monsterhand to hand combatperson on fireabandoned cityimplantarmorysubterraneandistrusthelicopter crashhanging upside down …flaremegalomaniacsuper strengtharmored carburned to deathabandoned buildingtorso cut in halfsatellitegatling gunbody landing on a caraerial shotairplane crashbooby trappunched in the chestcigarette lighterpower outageevacuationdual wieldchaosfemale warriorend of the worldjumping from heightsevered handkicked in the stomachwalkie talkiesecurity camerahypodermic needlesociopathmachetehead buttburned alivestylized violencedestructionsabotageuzimissilewashington d.c.ak 47henchmanbattlefieldmercenaryexploding bodyscarkicked in the facetough girlknocked outcharacter's point of view camera shottankcover uprace against timemissionbeaten to deathelectrocutionstabbed in the backdangerone against manyshot in the foreheadnecklaceunderwater scenecreaturedouble crossfictional warno opening creditssevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationambushsurvivalsubjective cameradecapitationshot in the backscientistcombatinterrogationcar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionfightviolenceflashback (See All) |
In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead …that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)
| Subgenre: | survival horrorzombie apocalypsecyberpunkdystopiapost apocalypsemartial arts |
| Themes: | surveillancebrutalitydeceptionmonsterescapebetrayalkidnappingrevengedeathmurder |
| Mood: | gore |
| Locations: | sewertunnelrooftop |
| Characters: | hostagesoldierzombiefemale protagonist |
| Story: | anti heroinenight vision binocularsaction heroineone woman armyknife throwingkilled by a propellerresident evilbackflipmegacorporationarmoryhummershot through the mouthsubterraneanopen endedbitten in the neck …female herosawed off shotgunflaresuper strengthtorso cut in halfbullet timesatelliteclonesirenaerial shotholograminfectionshot in the facebased on video gamechaosmercilessnessfemale warrioreaten alivesocial commentaryanimal attackgun futorchjumping from heightkicked in the stomachsecurity cameravirussociopathrevelationuziropehenchmanundeadshot in the armmercenaryexploding bodyshot in the shoulderkicked in the facetough girltankevil manstabbed in the backbinocularsshot in the foreheadshot in the legunderwater scenecreaturefictional warsevered headstabbed in the chestimpalementarmymassacreflashlightgood versus evilsurvivaldecapitationshot in the backcombatbombsunglassesheld at gunpointfalling from heightbrawlswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splattershot to deathshootoutvoice over narrationpistolsurprise endingchaseknifeexplosionfightbloodsequeldogflashbackviolence (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
| Subgenre: | survival horrordystopiaconspiracymartial arts |
| Themes: | self sacrificepanichopesurveillanceinsanityparanoiabrutalitydeceptionescapefearbetrayalkidnappingmurderrevengedeath |
| Mood: | gore |
| Locations: | tunnelrooftop |
| Characters: | hostage |
| Story: | resistance fighterfinal showdownhand to hand combatperson on firethreatened with a knifeslow motion action scenehanged bodybarricadedetonatorfight the systemyoung version of characterstabbed in the armreturning character killed offburned to deathbullet time …gatling gunraised middle fingerbody landing on a caraerial shotbooby trappunched in the chestshot in the facestabbed in the throathit in the crotchdual wieldchaosmercilessnesshatredresistancesocial commentarymexican standoffwhite housegun fukicked in the stomachwristwatchwalkie talkiesecurity camerasociopathmacheteburned alivehand grenadewashington d.c.ak 47obscene finger gestureshot in the armmercenaryexploding bodyshot in the shoulderkicked in the faceknocked outevil manrace against timemissionelectrocutionstabbed in the backprologuedangerbinocularsshot in the foreheadshot in the legdisarming someoneno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsmassacreambushflashlightsurvivaldecapitationshot in the backcombatcar crashbombheld at gunpointshowdownbrawlgunfightswordwritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosionflashbackbloodviolencesequelfight (See All) |
The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi …nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | artificial intelligenceself sacrificepanichopesurveillanceinsanityredemptionparanoiabrutalityangerdeceptionmonsterescapefearbetrayal …kidnappingrevengedeathmurder (See All) |
| Locations: | laboratoryrooftopwheelchairmotorcycle |
| Characters: | engineerhostagesoldierboyfriend girlfriend relationship |
| Story: | rocket launcheraction heroinegiant creaturesurveillance footageone woman armymad scientistfinal showdownfinal battlegiant monsterhand to hand combatthreatened with a knifeslow motion action scenesuper computerflash drivedeoxyribonucleic acid …spray paintsubterraneanopen endedgenetic engineeringhelicopter crashhanging upside downyoung version of charactersuper strengtharmored carreturning character killed offburned to deathabandoned buildingsatellitefight to the deathgatling gunraised middle fingerbody landing on a caraerial shotairplane crashbooby trappunched in the chestshot in the facepower outageevacuationchaoshatredfemale warriorcyborgstrong female leadjumping from heightlaserkicked in the stomachsociopathhead buttburned alivestylized violencehand grenaderevelationdestructionfireplacemissileak 47washington d.c.henchmanbattlefieldsevered armmercenaryopening action sceneexploding bodyscarkicked in the facetough girlknocked outtankrace against timecover upbeaten to deathelectrocutionstabbed in the backprologuedangerone against manynecklaceunderwater scenecreaturefictional wardouble crossdisarming someoneexploding carstabbed in the cheststabbed to deathimpalementarmymassacrestrangulationambushgood versus evilscientistcombatcar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionbloodflashbacksequelviolencefight (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ …le'. (Read More)
| Subgenre: | martial arts |
| Themes: | self sacrificepanicsurveillanceparanoiabrutalitydeceptionescapefearbetrayalkidnappingmurderrevengedeath |
| Mood: | gore |
| Locations: | cable carsewerlaboratory |
| Characters: | security guardhostagesoldierboyfriend girlfriend relationshipfather daughter relationship |
| Story: | rocket launchersecret laboratorysurveillance footagefinal showdownfinal battlehand to hand combatthreatened with a knifeslow motion action scenecraterflash drivedetonatorantidotefight the systemlandmineanimal killing …armorycut into piecescureyoung version of characterworld dominationmegalomaniacarmored carreturning character killed offburned to deathenglishman abroaddesert eagletorso cut in halffight to the deathgatling gunraised middle fingerbody landing on a caraerial shothologrampunched in the chestinfectioncigarette lightershot in the facedual wieldmercilessnesssocial commentarywhite housegun fusevered handkicked in the stomachwristwatchwalkie talkiesecurity cameradiseasevirushypodermic needlesociopathhead buttstylized violencehand grenadedestructionfireplacesabotagetraitormissilewashington d.c.henchmanbattlefieldobscene finger gesturesevered armmercenaryopening action sceneexploding bodyshot in the shoulderscarkicked in the faceknocked outcharacter's point of view camera shotrace against timemissionbeaten to deathelectrocutiondangerone against manyshot in the foreheadunderwater scenedouble crossdisarming someoneno opening creditsexploding carmixed martial artsimpalementstrangulationambushgood versus evilsubjective camerashot in the backinterrogationcar crashbombsunglassesheld at gunpointshowdownbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathbeatingshootoutpistolsurprise endingchaseknifeexplosiondogsequelflashbackviolencebloodfight (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
| Subgenre: | cyberpunkdystopiaconspiracymartial arts |
| Themes: | surveillancemonsterescapekidnappingdeathrevengemurder |
| Mood: | gore |
| Locations: | sewerlaboratoryrooftop |
| Characters: | security guardhostagefemale protagonistdoctor |
| Story: | anti heroineaction heroineone woman armyhand to hand combatknife throwingantidotemegacorporationwoman fights a manopen endedcurebitten in the neckgenetic engineeringstabbed in the armsuper strengthdesert eagle …torso cut in halfstabbed in the eyebody landing on a carpunched in the cheststabbed in the legshot in the facestabbed in the throatstealing a carfemale warriorsocial commentaryanimal attackgun fujumping from heightkicked in the stomachsecurity camerahypodermic needlehand grenadehenchmanshot in the armsevered armmercenaryexploding bodyshot in the shoulderkicked in the facetough girlcharacter's point of view camera shotcover upbeaten to deathlocker roomstabbed in the backone against manyshot in the foreheadshot in the legunderwater scenecreaturefictional warno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationflashlightgood versus evilsurvivalsubjective cameradecapitationshot in the backkung fuscientistcombatcar crashbombheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the facerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionbloodsequelviolence (See All) |
Now that Dom and Letty are on their honeymoon and Brian and Mia have retired from the game-and the rest of the crew has been exonerated-the globetrotting team has found a semblance of a normal life. But when a mysterious woman seduces Dom into the world of crime he can't seem to escape and a betraya …l of those closest to him, they will face trials that will test them as never before. From the shores of Cuba and the streets of New York City to the icy plains off the arctic Barents Sea, the elite force will crisscross the globe to stop an anarchist from unleashing chaos on the world's stage... and to bring home the man who made them a family. (Read More)
| Subgenre: | martial arts |
| Themes: | panicsurveillanceredemptionbrutalityangerdeceptionescapefearbetrayalkidnappingmurderrevengedeath |
| Locations: | humveerooftopmotorcycle |
| Characters: | security guardhostagesoldierfather daughter relationship |
| Story: | anti heroinerocket launcheraction heroineone woman armyfinal showdownfinal battlehand to hand combatthreatened with a knifekilled by a propellersuper computerflash drivehummerarmorywoman fights a mancountdown …woman kills a manhelicopter crashflarearmored carreturning character killed offenglishman abroaddesert eaglesatellitefight to the deathgatling gunbody landing on a caraerial shotpunched in the chesthit in the crotchchaosmercilessnesshatredfemale warriormexican standoffjumping from heightkicked in the stomachwristwatchwalkie talkiesecurity camerasociopathhead butthand grenadedestructionsabotagemissileak 47henchmanbattlefieldmercenaryopening action scenescarkicked in the facetough girlknocked outcharacter's point of view camera shottankrace against timemissionbeaten to deathelectrocutionstabbed in the backdangerbinocularsone against manynecklaceunderwater scenedouble crossdisarming someoneexploding carstabbed in the chestmixed martial artsstrangulationambushsubjective camerashot in the backcar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionsequelfightflashbackviolenceblood (See All) |
Despite his tarnished reputation after the events of The Dark Knight, in which he took the rap for Dent's crimes, Batman feels compelled to intervene to assist the city and its police force which is struggling to cope with Bane's plans to destroy the city.
| Subgenre: | conspiracymartial arts |
| Themes: | self sacrificepanichopesurveillanceredemptionparanoiabrutalitydeceptionescapebetrayalkidnappingrevengedeathmurder |
| Locations: | sewertunnelrooftopmotorcycle |
| Characters: | engineersecurity guardhostagesoldierdoctor |
| Story: | anti heroineaction heroineone woman armyfinal showdownfinal battlehand to hand combatflash drivedetonatorfight the systemhummerarmorywoman fights a mansubterraneanfemale herosawed off shotgun …flaresuper strengtharmored carreturning character killed offsatellitefight to the deathgatling gunrocketgasolineaerial shotbooby trappunched in the chestpower outageevacuationchaosmercilessnessstealing a carfemale warriorsocial commentaryjumping from heightkicked in the stomachwalkie talkiesecurity cameraelectronic music scorehypodermic needlesociopathhead buttstylized violencehand grenaderevelationdestructionfireplacesabotageuziropemissileak 47henchmanbattlefieldwaterfallmercenaryopening action sceneexploding bodykicked in the facetough girlknocked outcharacter's point of view camera shottankevil manrace against timecover upmissionbeaten to deathstabbed in the backdangerone against manyshot in the legnecklacefictional wardouble crossdisarming someoneno opening creditsexploding carstabbed in the chestmixed martial artsimpalementarmymassacrestrangulationambushgood versus evilsubjective camerashot in the backscientistcombatinterrogationcar crashbombheld at gunpointshowdownfalling from heightbrawlgunfightbattlewritten by directorpunched in the facerescueshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionflashbackfightsequel (See All) |
| Subgenre: | martial arts |
| Themes: | self sacrificepanichoperedemptionparanoiabrutalityangerdeceptionmonsterescapefearbetrayalkidnappingrevengemurder …death (See All) |
| Locations: | sewer |
| Characters: | hostagesoldierfather daughter relationship |
| Story: | resistance fighterfinal showdownhand to hand combatknife throwingthreatened with a knifeslow motion action scenehanged bodyfight the systemanimal killingsubterraneanhanging upside downyoung version of charactercommandersuper strengthburned to death …fast motion scenebullet timeaerial shotpunched in the cheststabbed in the legshot in the facedual wieldchaosmercilessnesshatredresistanceeaten aliveanimal attacktorchjumping from heightkicked in the stomachhead buttburned alivestylized violencedestructionsabotagetraitorhenchmanbattlefieldshot in the armsevered armwaterfallopening action sceneexploding bodyshot in the shoulderscarknocked outcharacter's point of view camera shotevil manbeaten to deathstabbed in the backdangerone against manyshot in the legunderwater scenecreaturefictional wardisarming someonesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationambushgood versus evilsubjective cameradecapitationshot in the backcombatinterrogationshowdownfalling from heightbrawlswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingfiresurprise endingchaseknifeexplosionblooddogviolenceflashbackfight (See All) |
After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc …king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)
| Subgenre: | cyberpunkdystopiapost apocalypseconspiracymartial arts |
| Themes: | panichopesurveillanceparanoiadeceptionescapefearbetrayalkidnappingdeathrevengemurder |
| Locations: | tunnelrooftop |
| Characters: | security guardhostagesoldierfemale protagonistboyfriend girlfriend relationship |
| Story: | anti heroineaction heroineone woman armyfinal showdownfemale soldierhand to hand combatdeoxyribonucleic aciddetonatorfight the systemarmorysubterraneanopen endedwoman kills a manarmored carreturning character killed off …female fighterabandoned buildingaerial shothologrampunched in the cheststabbed in the throatchaosfemale warriorsocial commentarymexican standoffstrong female leadgenocidelaserkicked in the stomachsecurity cameraelectronic music scorehead buttrevelationsabotagetraitormissilehenchmanbattlefieldscarkicked in the facetough girlknocked outcharacter's point of view camera shotevil manrace against timecover upmissionbeaten to deathelectrocutiondangerone against manyshot in the foreheaddouble crossfictional wardisarming someoneno opening creditsexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmyambushgood versus evilsurvivalsubjective camerashot in the backscientistcombatbombheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosionbloodsequelviolencefight (See All) |
| Subgenre: | corporate conspiracyconspiracymartial arts |
| Themes: | artificial intelligencepanicsurveillanceparanoiabrutalityangerdeceptionescapefearbetrayalkidnappingmurderdeathrevenge |
| Locations: | laboratory |
| Characters: | hostagedoctorboyfriend girlfriend relationship |
| Story: | secret laboratorysurveillance footagefinal showdownhand to hand combatthreatened with a knifedeoxyribonucleic acidcloningdistrustwoman kills a mangenetic engineeringyoung version of characterstabbed in the armbunkersuper strengthfight to the death …clonestabbed in the eyeaerial shotpunched in the chestevacuationstealing a carkicked in the stomachsecurity cameraelectronic music scorehypodermic needlehead buttrevelationsabotageshot in the shoulderkicked in the faceknocked outcover upbeaten to deathstabbed in the backdangershot in the foreheaddouble crossdisarming someonestabbed in the cheststabbed to deathmixed martial artsimpalementstrangulationambushshot in the backkung fuscientistinterrogationheld at gunpointshowdownbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightcorpsebeatingpistolsurprise endingchaseknifeviolenceflashbackbloodfight (See All) |
The second chapter of the epic "Maze Runner" saga. Thomas (Dylan O'Brien) and his fellow Gladers face their greatest challenge yet: searching for clues about the mysterious and powerful organization known as WCKD. Their journey takes them to the Scorch, a desolate landscape filled with unimaginable …obstacles. Teaming up with resistance fighters, the Gladers take on WCKD's vastly superior forces and uncover its shocking plans for them all. (Read More)
| Subgenre: | cyberpunkdystopiapost apocalypse |
| Themes: | hopesurveillanceparanoiadeceptionescapefearbetrayalkidnappingmurderdeath |
| Locations: | tunnellaboratory |
| Characters: | hostagesoldierzombie |
| Period: | zip line |
| Story: | resistance fighterdetonatorfight the systemmegacorporationevil corporationdistrustopen endedcuresawed off shotgunhanging upside downyoung version of characterreturning character killed offabandoned buildinggatling gunraised middle finger …holograminfectionpower outageresistancesocial commentarywalkie talkievirusdiseasehypodermic needlemachetehead buttrevelationmissileak 47obscene finger gesturemercenaryexploding bodyshot in the shoulderscartough girlknocked outcharacter's point of view camera shotrace against timeelectrocutionshot in the foreheadcreaturedouble crossdisarming someoneno opening creditsmassacreambushflashlightgood versus evilsurvivalsubjective camerashot in the backscientistinterrogationrunningbombheld at gunpointfalling from heightbattlepunched in the faceslow motion scenerescueshot in the chestshot to deathcorpsebeatingshootoutfirepistolsurprise endingexplosionsequelbloodviolenceflashback (See All) |
In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra …nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)
| Subgenre: | corporate conspiracycyberpunkdystopiaconspiracymartial arts |
| Themes: | self sacrificepanichoperedemptionparanoiabrutalityangerdeceptionescapefearbetrayalkidnappingmurderrevengedeath |
| Mood: | gore |
| Locations: | laboratorywheelchairmotorcycle |
| Characters: | professorhostagesoldierdoctor |
| Story: | secret laboratorymad scientistfinal showdownchild soldierhand to hand combatthreatened with a knifestabbed in the footdeoxyribonucleic acidcorporate crimefight the systemevil corporationmegacorporationcloningshot in the footgenetic engineering …stabbed in the armsuper strengtharmored carreturning character killed offabandoned buildingbarbed wireenglishman abroadtorso cut in halffight to the deathgatling gunsevered legclonestabbed in the eyebody landing on a carpunched in the cheststabbed in the legshot in the facestabbed in the throathit in the crotchmercilessnesshatredstealing a carsocial commentarycyborgsevered handkicked in the stomachdesperationwalkie talkievirushypodermic needlesociopathstylized violencehand grenadehenchmanshot in the armsevered armmercenaryopening action sceneexploding bodyshot in the shoulderscarkicked in the faceknocked outcharacter's point of view camera shotevil mancover uprace against timemissionbeaten to deathelectrocutionstabbed in the backdangerbinocularsone against manyshot in the foreheadshot in the legdouble crossdisarming someonesevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationflashlightsubjective camerasurvivaldecapitationshot in the backscientistcombatinterrogationcar crashrunningsunglassesheld at gunpointshowdownbrawlswordwritten by directorpunched in the facerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosionfightbloodsequeldogviolence (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
| Subgenre: | martial arts |
| Themes: | self sacrificepanicsurveillanceredemptionparanoiaangerdeceptionmonsterescapefearbetrayalkidnappingrevengemurderdeath |
| Locations: | tunnellaboratoryrooftop |
| Characters: | professorsecurity guardhostagesoldierzombiedoctor |
| Story: | secret laboratorymad scientistfinal showdownhand to hand combatmad doctorthreatened with a knifewoman fights a mansubterraneanopen endedwoman kills a manbitten in the neckworld dominationmegalomaniacarmored carliving dead …fight to the deathaerial shotairplane crashpunched in the cheststabbed in the legpower outageevacuationmercilessnesstorchkicked in the stomachwalkie talkiesecurity camerahypodermic needlehand grenadedestructionmissileak 47battlefieldundeadmercenaryopening action scenescarknocked outcharacter's point of view camera shotcover uprace against timebeaten to deathelectrocutionprologuedangerbinocularsshot in the legunderwater scenedouble crossdisarming someoneno opening creditsstabbed in the cheststabbed to deathmixed martial artsthroat slittingarmymassacrestrangulationambushflashlightgood versus evilsubjective camerashot in the backscientistcombatcar crashsunglassesheld at gunpointshowdownbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosiondogfightviolenceflashbackblood (See All) |
When John Connor ('Jason Clarke (I)' (qv)), leader of the human resistance, sends Sgt. Kyle Reese ('Jai Courtney' (qv)) back to 1984 to protect Sarah Connor ('Emilia Clarke' (qv)) and safeguard the future, an unexpected turn of events creates a fractured time-line. Now, Sgt. Reese finds himself in a … new and unfamiliar version of the past, where he is faced with unlikely allies, including the Guardian ('Arnold Schwarzenegger' (qv)), dangerous new enemies, and an unexpected new mission: To reset the future... (Read More)
| Subgenre: | cyberpunkpost apocalypse |
| Themes: | artificial intelligenceself sacrificehopedeceptionbetrayaldeathmurder |
| Locations: | laboratorymotorcycle |
| Characters: | security guardsoldierdoctor |
| Story: | resistance fighterrocket launcheraction heroineone woman armyhand to hand combatperson on firesuper computerdetonatorfight the systemmegacorporationarmoryshot in the footsubterraneanhelicopter crashyoung version of character …bunkersuper strengthreturning character killed offabandoned buildingdesert eaglebody landing on a carbooby traphologrampunched in the chestshot in the facedual wieldresistancestealing a carfemale warriorsocial commentarycyborgend of the worldlaserkicked in the stomachsecurity cameraelectronic music scorehead buttrevelationbattlefieldshot in the armsevered armexploding bodyshot in the shouldertough girlcharacter's point of view camera shotrace against timemissionbeaten to deathelectrocutionstabbed in the backshot in the foreheadshot in the legfictional wardisarming someonesevered headexploding carstabbed in the cheststabbed to deathimpalementambushgood versus evilsurvivalsubjective cameradecapitationshot in the backscientistinterrogationcar crashbombheld at gunpointbrawlbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutvoice over narrationpistolsurprise endingknifeexplosionflashbacksequel (See All) |
After young Katniss Everdeen agrees to be the symbol of rebellion, the Mockingjay, she tries to return Peeta to his normal state, tries to get to the Capitol, and tries to deal with the battles coming her way...but all for her main goal: assassinating President Snow and returning peace to the Distri …cts of Panem. As her squad starts to get smaller and smaller, will she make it to the Capitol? Will she get revenge on Snow or will her target change? Will she be with her "Star-Crossed Lover," Peeta, or her long-time friend, Gale? Deaths, bombs, bow and arrows, a love triangle, hope... What will happen? (Read More)
| Subgenre: | cyberpunkdystopiapost apocalypse |
| Themes: | self sacrificepanichopesurveillanceparanoiabrutalitydeceptionescapefearbetrayalrevengedeathmurder |
| Locations: | sewertunnelwheelchair |
| Characters: | engineerhostagesoldierfemale protagonistdoctor |
| Story: | resistance fighteranti heroinerocket launcheraction heroinesurveillance footageone woman armyfemale soldierperson on fireabandoned citylast of seriesfight the systemanimal killingarmorysole black character dies clichedistrust …subterraneancommanderbunkerarmored carreturning character killed offfemale fighterabandoned buildingrocketaerial shotbooby traphologramevacuationchaosresistancefemale warriorsocial commentarymexican standoffanimal attackstrong female leadgenociderevelationdestructionbattlefieldshot in the armmercenaryexploding bodytough girlknocked outtankmissionstabbed in the backdangercreaturedouble crossfictional warno opening creditsexploding carstabbed in the cheststabbed to deathimpalementarmystrangulationambushflashlightgood versus evilsurvivalscientistcombatbombheld at gunpointshowdownfalling from heightbrawlgunfightbattleslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpseshootoutfirepistolchaseknifeexplosionfightsequelviolence (See All) |
Twenty three-year-old Mitch lost his parents to a tragic car accident at the age of fourteen, and his girlfriend to a terrorist attack just as they were engaged. Seeking revenge, he is enlisted by CIA Deputy Director Irene Kennedy as a black ops recruit. Kennedy then assigns Cold War veteran Stan Hu …rley to train Mitch. Together they will later on investigate a wave of apparently random attacks on military and civilian targets. The discovery of a pattern in the violence leads them to a joint mission with a lethal Turkish agent to stop a mysterious operative intent on starting a world war in the Middle East. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | panicsurveillanceredemptionbrutalityangerdeceptionescapebetrayalkidnappingrevengedeathmurder |
| Mood: | gore |
| Locations: | tunnellaboratoryrooftopmotorcycle |
| Characters: | engineerhostagesoldierdoctorboyfriend girlfriend relationship |
| Story: | anti heroinesecret laboratoryaction heroinesurveillance footageone woman armyfinal showdownfinal battlehand to hand combatknife throwingthreatened with a knifewoman fights a manshot in the footcountdownwoman kills a manstabbed in the arm …commanderarmored carfight to the deathbody landing on a cargasolineaerial shothologrampunched in the cheststabbed in the legshot in the facestabbed in the throatevacuationmercilessnesshatredstealing a carfemale warrioranimal attackkicked in the stomachwristwatchwalkie talkiesociopathtraitoruziak 47henchmanshot in the armmercenaryopening action sceneshot in the shoulderscartough girlknocked outcharacter's point of view camera shotrace against timemissionbeaten to deathelectrocutionstabbed in the backdangerone against manyshot in the foreheadshot in the legunderwater scenedouble crossdisarming someoneno opening creditsexploding carstabbed in the cheststabbed to deathmixed martial artsmassacrestrangulationambushflashlightsubjective camerashot in the backscientistinterrogationcar crashbombsunglassesheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosionbloodflashbackdogviolencefight (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
| Subgenre: | zombie apocalypsedystopiamartial arts |
| Themes: | hopeillnessredemptionparanoiabrutalitydeceptionescapefearbetrayalkidnappingdeathrevengemurder |
| Mood: | gore |
| Locations: | rooftop |
| Characters: | hostagesoldierzombiefemale protagonistfather daughter relationship |
| Story: | anti heroineaction heroinehand to hand combatknife throwingthreatened with a knifeslow motion action scenehordefight the systemoutbreakwoman fights a manopen endedwoman kills a manfemale fighteraerial shotpunched in the chest …infectionstabbed in the throathit in the crotchdual wieldmercilessnesshatredfemale warriorstrong female leadsevered handdiseaseburned alivestylized violencerevelationtraitorbattlefieldsevered armexploding bodyscartough girlknocked outcharacter's point of view camera shotrace against timestabbed in the backprologuedangerdouble crossfictional wardisarming someonesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacreambushgood versus evilsurvivalsubjective cameradecapitationkung fucombatheld at gunpointshowdownfalling from heightbrawlswordbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsebeatingvoice over narrationfirepistolsurprise endingchaseknifeexplosionviolenceflashbackfightdogblood (See All) |
Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle …dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)
| Subgenre: | cyberpunkconspiracymartial arts |
| Themes: | panicsurveillanceredemptionparanoiaangerdeceptionescapefearbetrayalkidnappingmurderrevengedeath |
| Locations: | laboratoryrooftop |
| Characters: | security guardhostagesoldierdoctorfather daughter relationship |
| Story: | action heroinehand to hand combatknife throwingthreatened with a knifedeoxyribonucleic acidfight the systemevil corporationmegacorporationarmorywoman fights a manwoman kills a manyoung version of characterstabbed in the armworld dominationfemale fighter …aerial shotpunched in the cheststabbed in the legbased on video gamestabbed in the throatfemale warriorsocial commentarytorchjumping from heightkicked in the stomachsecurity camerahypodermic needlestylized violencerevelationropehenchmanbattlefieldshot in the armmercenaryscarkicked in the facetough girlknocked outcharacter's point of view camera shotrace against timecover upmissionelectrocutionstabbed in the backprologuedangerone against manyshot in the legfictional wardouble crossno opening creditsstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymassacrestrangulationambushgood versus evilsubjective camerashot in the backscientistcombatbombbrawlswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsefiresurprise endingchaseknifeexplosionbloodflashbackfightviolence (See All) |
In the near future, Major Motoko Kusanagi (Scarlett Johansson) is the first of her kind: A human saved from a terrible terrorist attack, who is cyber-enhanced to be a perfect soldier devoted to stopping the world's most dangerous criminals. When terrorism reaches a new level that includes the abilit …y to hack into people's minds and control them, Major Kusanagi is uniquely qualified to stop it. As she prepares to face a new enemy, Major Kusanagi discovers that she has been lied to: her life was not saved, it was stolen. She will stop at nothing to recover her past, find out who did this to her and stop them before they do it to others. (Read More)
| Subgenre: | corporate conspiracycyberpunkdystopiaconspiracymartial arts |
| Themes: | artificial intelligencepanicredemptionparanoiadeceptionescapefearbetrayalkidnappingmurderdeathrevenge |
| Locations: | rooftopmotorcycle |
| Characters: | engineersecurity guardhostagesoldierfemale protagonist |
| Story: | anti heroinerocket launcheraction heroinefinal showdownhand to hand combatslow motion action sceneimplantcorporate crimefight the systemevil corporationmegacorporationwoman fights a manwoman kills a manhelicopter crashsuper strength …bullet timegatling gunraised middle fingeraerial shothologrampunched in the chestdual wieldfemale warriorsocial commentarycyborggun fustrong female leadjumping from heightlaserkicked in the stomachelectronic music scorehypodermic needlestylized violencehand grenadeuzimissilehenchmanobscene finger gesturesevered armopening action sceneexploding bodykicked in the facetough girlknocked outcharacter's point of view camera shotrace against timecover upbeaten to deathelectrocutionprologuedangerbinocularsone against manyshot in the foreheadshot in the legunderwater scenedisarming someonemixed martial artsmassacreambushflashlightsubjective camerascientistcombatinterrogationcar crashbombheld at gunpointshowdownbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosionflashbackfightviolencedog (See All) |
Since the dawn of civilization, he was worshiped as a god. Apocalypse, the first and most powerful mutant from Marvel's X-Men universe, amassed the powers of many other mutants, becoming immortal and invincible. Upon awakening after thousands of years, he is disillusioned with the world as he finds …it and recruits a team of powerful mutants, including a disheartened Magneto, to cleanse mankind and create a new world order, over which he will reign. As the fate of the Earth hangs in the balance, Raven with the help of Professor X must lead a team of young X-Men to stop their greatest nemesis and save mankind from complete destruction. (Read More)
| Subgenre: | martial arts |
| Themes: | self sacrificepanichopesurveillanceangerdeceptionescapefearbetrayalkidnappingdeathmurderrevenge |
| Locations: | laboratorywheelchairmotorcycle |
| Characters: | engineerprofessorhostagesoldierfather daughter relationship |
| Story: | anti heroinesecret laboratoryaction heroineone woman armyfinal showdownfinal battlehand to hand combatthreatened with a knifeslow motion action scenewoman fights a mansixth partsubterraneanwoman kills a manyoung version of characterworld domination …megalomaniacsuper strengthreturning character killed offburned to deathbullet timebody landing on a caraerial shotpunched in the cheststabbed in the throatpower outageevacuationdual wieldchaosmercilessnessstealing a carfemale warriorend of the worldstrong female leadtorchlaserkicked in the stomachhead buttburned alivestylized violencedestructionsabotagemissileak 47henchmanbattlefieldmercenaryopening action scenekicked in the facetough girlknocked outcharacter's point of view camera shotrace against timebeaten to deathelectrocutionprologuedangerone against manyunderwater scenedouble crossfictional wardisarming someoneno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushflashlightgood versus evilsubjective camerasurvivaldecapitationshot in the backscientistcombatsunglassesheld at gunpointshowdownfalling from heightbrawlswordbattlepunched in the faceslow motion scenerescuemachine gunblood splatterfistfightcorpsebeatingfirepistolsurprise endingchaseknifeexplosionbloodflashbacksequelviolencefightdog (See All) |
Four waves of increasingly deadly attacks have left most of Earth in ruin. Against a backdrop of fear and distrust, Cassie is on the run, desperately trying to save her younger brother. As she prepares for the inevitable and lethal fifth wave, Cassie teams up with a young man who may become her fina …l hope - if she can only trust him. (Read More)
| Subgenre: | dystopiapost apocalypse |
| Themes: | self sacrificehopesurveillanceparanoiabrutalitydeceptionescapefearbetrayalkidnappingmurderdeath |
| Characters: | hostagesoldierfather daughter relationship |
| Story: | anti heroineaction heroineone woman armychild soldierfemale soldierthreatened with a knifepandemicchild with a gundetonatorfight the systemoutbreakdistrustopen endedflareworld domination …bunkerarmored carfemale fighterabandoned buildingbody landing on a carairplane crashbooby trappunched in the chestpower outageevacuationchaosmercilessnessfemale warriorsocial commentarymexican standoffend of the worldcrucifixdiseasevirushypodermic needlerevelationdestructionsabotageak 47battlefieldtough girlknocked outcharacter's point of view camera shotrace against timemissionshot in the legnecklacefictional wardouble crossdisarming someoneno opening creditsexploding cararmymassacrestrangulationambushgood versus evilsurvivalsubjective camerashot in the backcombatcar crashbombheld at gunpointbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutvoice over narrationfirepistolsurprise endingchaseknifeexplosionbloodflashbackfightviolence (See All) |
With many people fearing the actions of super heroes, the government decides to push for the Hero Registration Act, a law that limits a hero's actions. This results in a division in The Avengers. Iron Man stands with this Act, claiming that their actions must be kept in check otherwise cities will c …ontinue to be destroyed, but Captain America feels that saving the world is daring enough and that they cannot rely on the government to protect the world. This escalates into an all-out war between Team Iron Man (Iron Man, Black Panther, Vision, Black Widow, War Machine, and Spider-Man) and Team Captain America (Captain America, Bucky Barnes, Falcon, Scarlet Witch, Hawkeye, and Ant Man) while a new villain emerges. (Read More)
| Subgenre: | martial arts |
| Themes: | artificial intelligencesurveillanceredemptionparanoiabrutalityangerdeceptionescapefearbetrayalkidnappingdeathmurderrevenge |
| Locations: | laboratoryrooftopmotorcycle |
| Characters: | engineersecurity guardhostagesoldier |
| Story: | rocket launchersecret laboratoryaction heroinesurveillance footagefinal showdownfinal battlehand to hand combatthreatened with a knifearmorywoman fights a mansubterraneanopen endedwoman kills a manhanging upside downsuper strength …armored carreturning character killed offfemale fighterabandoned buildingfight to the deathgatling gunrocketbody landing on a carbooby traphologrampunched in the chesthit in the crotchpower outageevacuationhatredstealing a carfemale warriorsocial commentarymexican standoffjumping from heightlaserkicked in the stomachwristwatchsecurity cameramachetehead buttstylized violencehand grenaderevelationsabotageuzimissileak 47henchmanbattlefieldsevered armwaterfallmercenaryopening action sceneexploding bodykicked in the facetough girlknocked outcharacter's point of view camera shottankrace against timemissionbeaten to deathelectrocutionprologuebinocularsshot in the foreheadunderwater scenedouble crossdisarming someoneno opening creditsexploding carstabbed in the chestmixed martial artsstrangulationambushflashlightsubjective camerascientistcombatinterrogationcar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionbloodsequelflashbackviolencefight (See All) |
An apocalyptic story set in the furthest reaches of our planet, in a stark desert landscape where humanity is broken, and almost everyone is crazed fighting for the necessities of life. Within this world exist two rebels on the run who just might be able to restore order. There's Max, a man of actio …n and a man of few words, who seeks peace of mind following the loss of his wife and child in the aftermath of the chaos. And Furiosa, a woman of action and a woman who believes her path to survival may be achieved if she can make it across the desert back to her childhood homeland. (Read More)
| Subgenre: | dystopiapost apocalypsemartial arts |
| Themes: | self sacrificehopeinsanityredemptionparanoiabrutalitydeceptionescapefearbetrayalkidnappingmurderdeathrevenge |
| Locations: | wheelchairmotorcycle |
| Characters: | hostagefemale protagonist |
| Story: | anti heroinerocket launcheraction heroineone woman armyfinal showdownfinal battlehand to hand combatthreatened with a knifelandminewoman kills a mansawed off shotgunhanging upside downflarearmored carfast motion scene …gatling gunstabbed in the eyegasolinebooby trapshot in the facestabbed in the throatdual wieldchaosfemale warriormechanicjumping from heightdesperationdiseasesociopathmachetehead buttrevelationdestructionuziak 47henchmanshot in the armopening action sceneexploding bodyscartough girltankevil manstabbed in the backbinocularsshot in the legdouble crossdisarming someoneno opening creditsexploding carstabbed in the chestimpalementambushgood versus evilsurvivalshot in the backcombatcar crashbombheld at gunpointfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightcorpseshootoutvoice over narrationfirepistolsurprise endingchaseknifeexplosionfightbloodsequelviolenceflashback (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
| Subgenre: | martial arts |
| Themes: | panicparanoiabrutalitydeceptionescapefearbetrayalkidnappingrevengemurderdeath |
| Mood: | gore |
| Locations: | tunnelrooftopmotorcycle |
| Characters: | hostagesoldierfemale protagonistfather daughter relationship |
| Story: | resistance fighteranti heroineaction heroineone woman armyfinal showdownhand to hand combatknife throwingthreatened with a knifeslow motion action scenewoman fights a manwoman kills a manstabbed in the armenglishman abroadfast motion scenefight to the death …body landing on a cargasolineaerial shotpunched in the cheststabbed in the legcigarette lightershot in the facestabbed in the throathit in the crotchevacuationmercilessnessresistancestealing a carfemale warriorstrong female leadjumping from heightkicked in the stomachwristwatchelectronic music scorehead buttstylized violencerevelationtraitorropehenchmanopening action scenescarkicked in the facetough girlknocked outcover uprace against timemissionbeaten to deathstabbed in the backprologuedangerbinocularsone against manyshot in the foreheadshot in the legunderwater scenedouble crossdisarming someoneexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushsurvivalshot in the backkung fuinterrogationcar crashsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutvoice over narrationfirepistolsurprise endingchaseknifeexplosionbloodfightviolenceflashback (See All) |
Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t …o end all wars, Diana will discover her full powers and her true destiny. (Read More)
| Subgenre: | martial arts |
| Themes: | self sacrificepanichopeinsanityparanoiabrutalityangerdeceptionescapefearbetrayalmurderdeathrevenge |
| Locations: | laboratorymotorcycle |
| Characters: | soldierfemale protagonist |
| Story: | action heroineone woman armymad scientistfinal showdownfinal battlefemale soldierhand to hand combatmad doctorthreatened with a knifebackflipwoman fights a mandistrustopen endedwoman kills a manfemale hero …young version of characterworld dominationmegalomaniacsuper strengthfemale fighterbullet timefight to the deathgatling gungasolineaerial shotpunched in the chestdual wieldchaosmercilessnesshatredfemale warriorstrong female leadjumping from heightkicked in the stomachdesperationwristwatchsociopathstylized violencehand grenaderevelationdestructionfireplacesabotageropebattlefieldshot in the armwaterfallexploding bodyscarkicked in the facetough girlknocked outtankevil manrace against timemissionbeaten to deathelectrocutiondangerbinocularsone against manyshot in the legunderwater scenedouble crossdisarming someoneno opening creditsstabbed in the cheststabbed to deathmixed martial artsarmymassacregood versus evilshot in the backscientistcombatinterrogationbombheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutvoice over narrationfirepistolsurprise endingchaseknifeexplosionsequelfightflashbackviolence (See All) |
The G.I. Joe team is framed for crimes against the country by Zartan, disguised as the President, and Cobra Commander has all the world leaders under his influence, with their advanced warheads headed towards innocent populaces around the world. Outnumbered and outgunned, the surviving team members …form a plan with their original leader, General Joseph Colton, to rescue the President and face off Cobra Commander, his accomplices and the world leaders. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | surveillanceredemptiondeceptionbetrayalkidnappingrevengedeathmurder |
| Locations: | humveemotorcycle |
| Characters: | security guardhostagesoldier |
| Period: | zip line |
| Story: | rocket launcheraction heroinefemale soldierhand to hand combatdeoxyribonucleic acidhummersubterraneanyoung version of characterworld dominationbunkermegalomaniacarmored carreturning character killed offsatellitegatling gun …punched in the chestpower outagedual wieldfemale warriormexican standoffwhite housegun fujumping from heightkicked in the stomachwalkie talkiesecurity cameraburned alivestylized violencehand grenadetraitoruzimissileak 47washington d.c.battlefieldobscene finger gestureshot in the armmercenaryopening action sceneexploding bodykicked in the facetough girlknocked outcharacter's point of view camera shottankrace against timecover upbinocularsunderwater scenedouble crossno opening creditsexploding carstabbed in the cheststabbed to deathmixed martial artsimpalementarmymassacreambushgood versus evilsurvivalshot in the backinterrogationbombheld at gunpointshowdownfalling from heightbrawlswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutvoice over narrationpistolsurprise endingchaseknifeexplosionflashbackfightviolencebloodsequel (See All) |
| Subgenre: | martial arts |
| Themes: | panichopeinsanityredemptionangerdeceptionmonsterescapefearbetrayalkidnappingmurderdeathrevenge |
| Characters: | hostagesoldier |
| Story: | anti heroineaction heroineone woman armyfinal showdownchild soldierfemale soldierhand to hand combatthreatened with a knifebackflipanimal killingchainswoman fights a manwoman kills a manyoung version of characterworld domination …megalomaniacburned to deathfight to the deathaerial shotbooby trappunched in the chestdual wieldmercilessnessfemale warrioranimal attacktorchjumping from heightkicked in the stomachburned alivehead buttstylized violencerevelationfireplacetraitorbattlefieldwaterfallkicked in the facetough girlmissionbeaten to deathstabbed in the backprologuedangerone against manynecklacecreaturedouble crossfictional wardisarming someoneno opening creditsstabbed in the chestmixed martial artsimpalementarmymassacreambushgood versus evilsubjective cameracombatshowdownbrawlswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestfistfightcorpsebeatingvoice over narrationsurprise endingchaseknifeexplosionbloodfightviolenceflashbacksequel (See All) |
Almost eleven years after the futile and disastrous expedition on the distant moon LV-223, the deep-space colonisation vessel Covenant equipped with more than 2,000 colonists in cryogenic hibernation, sets a course for the remote planet Origae-6 with the intention to build a new world. Instead, a ro …gue transmission will entice the crew to a nearby habitable small planet which resembles The Earth. The unsuspecting members of Covenant will have to cope with biological foes, beyond human comprehension. Ultimately, what was intended as a peaceful exploratory mission, will soon turn into a desperate rescue operation deep into the cold infinite space. (Read More)
| Subgenre: | survival horror |
| Themes: | artificial intelligencepanicsurveillanceinsanityparanoiabrutalityangerdeceptionmonsterescapefearbetrayaldeathmurder |
| Mood: | gore |
| Locations: | laboratory |
| Characters: | engineerhostagesoldierdoctor |
| Story: | female mechanicsecret laboratorymad scientistfinal showdownfemale soldierperson on firesuper computerarmorywoman fights a mandistrustsubterraneansuper strengtharmored carreturning character killed offburned to death …fight to the deathraised middle fingeraerial shothologrampunched in the chestinfectionevacuationmercilessnessfemale warrioreaten alivemechanicgenocidelasersevered handsecurity cameravirussociopathburned aliveobscene finger gesturewaterfallmercenaryexploding bodyscartough girlcharacter's point of view camera shotactor playing multiple rolesrace against timemissionbeaten to deathstabbed in the backprologuedangercreaturedouble crossdisarming someonesevered headstabbed in the chestimpalementmassacrestrangulationflashlightsurvivalsubjective cameradecapitationshot in the backscientistheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosionbloodviolencefightflashbacksequel (See All) |
After the British Prime Minister has passed away under mysterious circumstances, all leaders of the Western world must attend his funeral. But what starts out as the most protected event on earth, turns into a deadly plot to kill the world's most powerful leaders and unleash a terrifying vision of t …he future. The President of the United States, his formidable secret service head and a British MI-6 agent who trusts no one are the only people that have any hope of stopping it. (Read More)
| Subgenre: | conspiracy |
| Themes: | self sacrificepanichopesurveillancebrutalitydeceptionescapebetrayalkidnappingdeathmurderrevenge |
| Mood: | gore |
| Locations: | wheelchairmotorcycle |
| Characters: | hostagesoldier |
| Story: | rocket launchernight vision binocularsfinal showdownhand to hand combatthreatened with a knifeflash drivearmorysubterraneanhelicopter crashflarebunkerarmored carreturning character killed offburned to deathsatellite …gatling gunstabbed in the eyebody landing on a caraerial shotbooby trappunched in the cheststabbed in the legstabbed in the throatpower outagemercilessnesswhite housejumping from heightkicked in the stomachwalkie talkiesecurity camerasociopathmacheteburned alivehand grenaderevelationdestructionfireplacesabotagetraitormissileak 47washington d.c.henchmanshot in the armmercenaryexploding bodyshot in the shoulderknocked outcharacter's point of view camera shotrace against timebeaten to deathstabbed in the backprologueone against manyshot in the foreheadshot in the legdisarming someoneexploding carstabbed in the cheststabbed to deaththroat slittingimpalementmassacrestrangulationambushgood versus evilsubjective camerashot in the backcar crashbombheld at gunpointbrawlbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionsequelviolence (See All) |
HITMAN: AGENT 47 centers on an elite assassin who was genetically engineered from conception to be the perfect killing machine, and is known only by the last two digits on the barcode tattooed on the back of his neck. He is the culmination of decades of research and forty-six earlier Agent clones -- … endowing him with unprecedented strength, speed, stamina and intelligence. His latest target is a mega-corporation that plans to unlock the secret of Agent 47's past to create an army of killers whose powers surpass even his own. Teaming up with a young woman who may hold the secret to overcoming their powerful and clandestine enemies, 47 confronts stunning revelations about his own origins and squares off in an epic battle with his deadliest foe. (Read More)
| Subgenre: | conspiracy |
| Themes: | surveillancebrutalitydeceptionescapebetrayalkidnappingrevengemurderdeath |
| Mood: | gore |
| Locations: | laboratoryrooftopmotorcycle |
| Characters: | hostagedoctorfather daughter relationship |
| Period: | zip line |
| Story: | anti heroineaction heroineone woman armymad scientisthand to hand combatthreatened with a knifekilled by a propellerdeoxyribonucleic acidevil corporationmegacorporationarmorycut into pieceswoman kills a mangenetic engineeringhelicopter crash …young version of charactersuper strengthclonebody landing on a caraerial shotbooby trappunched in the chestshot in the facebased on video gamedual wieldstealing a carfemale warriorkicked in the stomachsecurity camerahypodermic needlehead buttstylized violenceuzishot in the armmercenaryopening action sceneexploding bodyshot in the shoulderkicked in the facetough girlknocked outrace against timemissionelectrocutionprologueone against manyshot in the foreheadshot in the legdisarming someoneexploding carstabbed in the cheststabbed to deathmixed martial artsimpalementarmystrangulationambushsurvivaldecapitationshot in the backinterrogationcar crashbombheld at gunpointshowdownfalling from heightbrawlbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutvoice over narrationpistolsurprise endingknifeexplosionviolenceflashback (See All) |
Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.
| Subgenre: | martial arts |
| Themes: | self sacrificepanicredemptionbrutalitydeceptionmonsterescapefearbetrayalkidnappingdeathrevengemurder |
| Characters: | hostagesoldierzombie |
| Story: | anti heroineaction heroinegiant creatureone woman armyfinal showdownfinal battlefemale soldiergiant monsterhand to hand combatthreatened with a knifeslow motion action scenefight the systemwoman fights a manopen endedhanging upside down …world dominationreturning character killed offfemale fighterfight to the deathgatling gunhologrampunched in the chestevacuationdual wieldchaosmercilessnessfemale warriorsocial commentaryjumping from heightlaserkicked in the stomachelectronic music scoresociopathhead buttstylized violencedestructionhenchmanbattlefieldundeadwaterfallmercenaryopening action sceneexploding bodykicked in the facetough girlrace against timecover upmissionbeaten to deathelectrocutiondangerone against manyunderwater scenecreaturefictional wardouble crossdisarming someonesevered headstabbed in the cheststabbed to deathmixed martial artsimpalementarmymassacreambushgood versus evilsurvivaldecapitationcombatheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the chestmachine gunfistfightshot to deathbeatingshootoutfiresurprise endingchaseknifeexplosionviolencesequelflashbackfight (See All) |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
| Subgenre: | survival horrormartial arts |
| Themes: | self sacrificepanicinsanityredemptionparanoiabrutalitydeceptionmonsterescapefearbetrayalkidnappingdeathmurderrevenge |
| Mood: | gore |
| Characters: | hostagesoldierdoctor |
| Story: | anti heroineaction heroineone woman armyfemale soldiermad doctorthreatened with a knifeopen endedhanging upside downflaretorso cut in halffight to the deathgatling gunsevered legbooby trapshot in the face …stabbed in the throatdual wieldmercilessnesssevered fingerfemale warrioranimal attacklasermachetehead butthand grenadeuziak 47battlefieldsevered armwaterfallmercenaryexploding bodyshot in the shoulderkicked in the facetough girlcharacter's point of view camera shotevil manelectrocutiondangercreaturedouble crossno opening creditssevered headstabbed to deathimpalementambushsubjective camerasurvivaldecapitationshot in the backcombatheld at gunpointfalling from heightgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestmachine gunblood splattershot to deathcorpseshootoutfirepistolsurprise endingchaseknifeexplosionviolencesequelblood (See All) |
Extreme athlete turned government operative Xander Cage (Vin Diesel) comes out of self-imposed exile, thought to be long dead, and is set on a collision course with deadly alpha warrior Xiang (Donnie Yen) and his team in a race to recover a sinister and seemingly unstoppable weapon known as Pandora' …s Box. Recruiting an all-new group of thrill-seeking cohorts, Xander finds himself enmeshed in a deadly conspiracy that points to collusion at the highest levels of world governments. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | surveillanceredemptionbrutalitydeceptionescapebetrayaldeathmurderrevenge |
| Locations: | rooftopmotorcycle |
| Characters: | security guardhostagesoldier |
| Story: | anti heroineaction heroinesurveillance footagefinal showdownhand to hand combatknife throwingthreatened with a knifebackflipfight the systemarmorywoman fights a manwoman kills a mansawed off shotgunarmored carabandoned building …englishman abroadbullet timesatelliteraised middle fingerbody landing on a caraerial shotpunched in the chestevacuationdual wieldmercilessnessstealing a carfemale warriormexican standoffgun fujumping from heightkicked in the stomachwristwatchwalkie talkiesecurity camerahead buttstylized violencehand grenaderevelationdestructionsabotageuziak 47henchmanobscene finger gestureshot in the armmercenaryopening action scenescarkicked in the facetough girlknocked outcover uprace against timemissionbeaten to deathelectrocutionprologueone against manyshot in the foreheadshot in the legunderwater scenedouble crossdisarming someoneexploding carstabbed in the chestmixed martial artsmassacreambushshot in the backkung fucar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunfistfightshot to deathbeatingshootoutpistolsurprise endingchaseknifeexplosionsequelfightviolence (See All) |
| Subgenre: | martial arts |
| Themes: | panicparanoiabrutalitydeceptionescapefearbetrayalrevengedeathmurder |
| Mood: | gore |
| Locations: | tunnelrooftopmotorcycle |
| Story: | rocket launcherfinal showdownhand to hand combatthreatened with a knifearmorywoman fights a manshot in the footopen endedstabbed in the armenglishman abroadfight to the deathraised middle fingerbody landing on a caraerial shotpunched in the chest …stabbed in the legshot in the facestabbed in the throatdual wieldmercilessnessstealing a carfemale warriorgun fukicked in the stomachstylized violencehenchmanobscene finger gestureshot in the armopening action sceneshot in the shoulderkicked in the facetough girlcover upstabbed in the backprologuedangerone against manyshot in the foreheadshot in the legdouble crossdisarming someoneno opening creditsstabbed in the cheststabbed to deathmixed martial artsthroat slittingmassacrestrangulationambushsurvivalshot in the backcar crashheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion sceneshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpseshootoutfirepistolsurprise endingchaseknifeexplosiondogsequelflashbackbloodfightviolence (See All) |
During an operation of a Mexican Cartel, Machete Cortez and Sartana Rivera intercept the criminals alone, but another group arrives and a masked man kills Sartana. Machete is arrested, accused of killing his beloved Sartana and Sheriff Doakes hangs Machete. But the President of the USA Rathcock pard …ons and recruits Machete to kill the revolutionary Marcos Mendez that has threatened the USA with a missile with a bomb. Machete goes to San Antonio to meet the Miss San Antonio Blanca Vasquez that will be the liaison between Machete and President Rathcock. Then Machete goes to the brothel of Madame Desdemona to seek out the prostitute Cereza that is Mendez's mistress. Machete meets Mendez and learns that his heart is connected to the missile and only the arm dealer Luther Voz is capable to disarm the bomb. Now Machete needs to bring Mendez to the USA in less than twenty-four hours and save his new country in a dangerous journey with betrayals. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | self sacrificesurveillanceinsanitydeceptionescapebetrayalkidnappingmurderdeathrevenge |
| Mood: | gore |
| Locations: | wheelchairmotorcycle |
| Characters: | hostagesoldierdoctor |
| Story: | hand to hand combatperson on fireknife throwingthreatened with a knifekilled by a propellercut into piecesopen endedcountdowngenetic engineeringsawed off shotgunworld dominationmegalomaniacsuper strengtharmored carreturning character killed off …female fightersatellitefight to the deathgatling gunrocketsevered legclonehologramstabbed in the throathit in the crotchdual wieldstealing a carmexican standoffwhite housejumping from heightsecurity cameramacheteburned alivehead buttstylized violenceuzimissileak 47washington d.c.henchmanbattlefieldobscene finger gestureshot in the armsevered armmercenaryexploding bodyshot in the shouldertough girlrace against timemissionelectrocutionstabbed in the backone against manyshot in the foreheadshot in the legdouble crosssevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacreambushdecapitationshot in the backscientistcar crashbombheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosionviolencebloodflashbackfightsequel (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d …ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
| Subgenre: | post apocalypticcyberpunkdystopiapost apocalypsemartial arts |
| Themes: | self sacrificeredemptiondeceptionmonsterbetrayalkidnappingrevengemurderdeath |
| Mood: | gore |
| Locations: | motorcycle |
| Characters: | biblehostageboyfriend girlfriend relationshipfather daughter relationship |
| Story: | anti heroineaction heroineone woman armyfemale soldierhand to hand combatperson on fireknife throwingthreatened with a knifehivefight the systemcut into piecessubterraneanbitten in the neckflareworld domination …megalomaniactorso cut in halfsevered legpunched in the cheststabbed in the legfemale warrioreaten alivesocial commentaryanimal attackjumping from heightkicked in the stomachcrucifixmachetehead buttstylized violencerevelationsevered armmercenaryexploding bodyscarkicked in the facetough girlrace against timemissionbeaten to deathelectrocutionstabbed in the backprologueone against manycreaturefictional warno opening creditssevered headstabbed in the cheststabbed to deaththroat slittingimpalementmassacreambushflashlightgood versus evilsurvivaldecapitationkung fucombatinterrogationheld at gunpointshowdownfalling from heightbrawlbattlepunched in the facerescueshot in the chestmachine gunblood splatterfistfightcorpsebeatingshootoutvoice over narrationfiresurprise endingchaseknifeexplosionbloodflashbackfightviolence (See All) |
Bound by a shared destiny, a bright, optimistic teen bursting with scientific curiosity and a former boy-genius inventor jaded by disillusionment embark on a danger-filled mission to unearth the secrets of an enigmatic place somewhere in time and space that exists in their collective memory as "Tomo …rrowland." (Read More)
| Subgenre: | dystopiamartial arts |
| Themes: | artificial intelligenceself sacrificehopesurveillanceredemptiondeceptionescapefearbetrayaldeathmurder |
| Locations: | laboratorymotorcycle |
| Characters: | engineersecurity guarddoctorfather daughter relationship |
| Period: | seeing the future |
| Story: | laser cuttermad scientisthand to hand combatperson on fireabandoned citycut into piecessubterraneansuper strengthbarbed wiretorso cut in halfrocketbody landing on a caraerial shotbooby traphologram …punched in the chestpower outagestealing a carfemale warriorsocial commentarycyborgend of the worldstrong female leadjumping from heightlasersevered handkicked in the stomachwristwatchwalkie talkiesecurity cameraheroinestylized violencesabotagesevered armmercenaryexploding bodykicked in the faceknocked outcharacter's point of view camera shotrace against timemissionbeaten to deathelectrocutiondangerdouble crossno opening creditssevered headmixed martial artsambushflashlightsubjective camerasurvivaldecapitationkung fuscientistinterrogationcar crashbombsunglassesshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the chestcar accidentfistfightcorpsebeatingshootoutfiresurprise endingchaseexplosiondogfightviolenceflashback (See All) |
MI6's top assassin (Mark Strong) has a brother. Unfortunately for him, he's a football hooligan (Sacha Baron Cohen) from the town of Grimsby. Nobby has everything a man from the poor English fishing town of Grimsby could want - 9 children and the most attractive girlfriend in northern England (Rebel … Wilson). There's only one thing missing in his life: his little brother, Sebastian. After they were adopted by different families as children, Nobby spent 28 years searching for him. Upon hearing of his location, Nobby sets off to reunite with his brother, unaware that not only is his brother an MI6 agent, but he's just uncovered a plot that puts the world in danger. On the run and wrongfully accused, Sebastian realizes that if he is going to save the world, he will need the help of its biggest idiot. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | panicsurveillanceredemptionbrutalitydeceptionescapebetrayalkidnappingdeathmurderrevenge |
| Mood: | gore |
| Locations: | wheelchairmotorcycle |
| Characters: | security guardhostageboyfriend girlfriend relationshipfather daughter relationship |
| Period: | zip line |
| Story: | rocket launcherfinal showdownhand to hand combatperson on firecontact lensantidotefirecrackeryoung version of characterflarecommanderbunkermegalomaniacarmored carburned to deathabandoned building …englishman abroaddesert eaglefast motion scenebullet timesatelliterocketraised middle fingerbody landing on a caraerial shotpunched in the chestinfectionevacuationchaosstealing a carsocial commentarymexican standoffjumping from heightkicked in the stomachwalkie talkievirushypodermic needlehead buttburned alivestylized violencerevelationmissileak 47henchmanmercenaryopening action sceneexploding bodyshot in the shoulderkicked in the faceknocked outcharacter's point of view camera shotrace against timecover upmissionbeaten to deathdangerbinocularsone against manyshot in the foreheadshot in the legunderwater scenedouble crossdisarming someonesevered headexploding carstabbed in the chestmixed martial artsimpalementstrangulationambushsubjective cameradecapitationshot in the backscientistinterrogationcar crashsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosionviolenceflashbackbloodfightdog (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
| Subgenre: | survival horrordystopiapost apocalypsemartial arts |
| Themes: | self sacrificepanicsurveillancebrutalitydeceptionescapefearbetrayalmurderdeath |
| Mood: | gore |
| Locations: | tunnel |
| Characters: | engineersecurity guardhostagezombieboyfriend girlfriend relationship |
| Story: | final showdownhand to hand combatthreatened with a knifeabandoned citysole black character dies clicheflarefemale fighterfight to the deathstabbed in the legcigarette lighterinfectionstabbed in the throatpower outagemercilessnessfemale warrior …eaten alivekicked in the stomachsecurity cameradiseasevirusmachetehead buttexploding bodyshot in the shouldertough girlrace against timemissionbeaten to deathstabbed in the backdangershot in the foreheadshot in the legcreaturedisarming someonesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementambushflashlightgood versus evilsurvivaldecapitationshot in the backcombatheld at gunpointshowdownfalling from heightbrawlgunfightbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingshootoutvoice over narrationfirepistolsurprise endingchaseknifeexplosionbloodflashbackviolencefight (See All) |
Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and … the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)
| Subgenre: | dystopiapost apocalypse |
| Themes: | self sacrificepanichoperedemptionparanoiabrutalityangerdeceptionescapefearbetrayalkidnappingmurderrevengedeath |
| Locations: | tunnel |
| Characters: | hostagesoldier |
| Story: | rocket launcherfinal showdownfinal battlefemale soldierbarricadeanimal killinghelicopter crasharmored carreturning character killed offabandoned buildinggatling gunaerial shotinfectionmercilessnesshatred …social commentaryanimal attacktorchlaserdesperationwalkie talkiecrucifixvirusmachetehand grenadedestructionsabotagetraitorropemissileak 47battlefieldwaterfallopening action sceneexploding bodyknocked outcharacter's point of view camera shottankrace against timemissionbeaten to deathdangerbinocularsdouble crossfictional warno opening creditsimpalementarmymassacrestrangulationambushflashlightsurvivalsubjective camerashot in the backcombatinterrogationsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightbattleslow motion scenerescueshot in the headshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionviolencesequelfightflashbackblood (See All) |
Civil Unrest in the European country of Moldova has US forces engaging the insurgents however there is a new threat who has decided both are their enemy. This new threat resides in an alternative spectrum that makes them invisible to the naked eye and instant death to anyone confronting them. Locals … believe they are Spirits of War but others believe they are superior arms technology fabricated by the Moldova government.. (Read More)
| Subgenre: | survival horror |
| Themes: | self sacrificepanicparanoiaescapefearmurderdeath |
| Locations: | laboratoryrooftop |
| Characters: | engineersoldierdoctor |
| Story: | rocket launchersecret laboratorynight vision binocularsfinal showdownfinal battleabandoned cityslow motion action scenebarricadelast standlandminehanging upside downbunkersuper strengtharmored carabandoned building …bullet timegatling gunbody landing on a caraerial shotairplane crashpower outageevacuationdual wieldfemale warriorsocial commentarymexican standofflaserwalkie talkiehand grenadedestructionak 47battlefieldmercenaryexploding bodytough girlcharacter's point of view camera shottankrace against timemissionprologuedangerbinocularsfictional warimpalementmassacreambushflashlightgood versus evilsurvivalsubjective camerascientistcombatbombheld at gunpointshowdownfalling from heightbattleslow motion scenerescuecar accidentmachine gunblood splattercorpsepistolsurprise endingchaseexplosionviolenceblood (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | martial arts |
| Themes: | self sacrificehoperedemptionbrutalitydeceptionmonsterescapefearbetrayalkidnappingrevengedeathmurder |
| Characters: | hostagesoldierboyfriend girlfriend relationship |
| Story: | giant creaturefinal showdownfinal battlegiant monsterhand to hand combatthreatened with a knifeslow motion action sceneanimal killingsole black character dies clicheworld dominationmegalomaniacsuper strengthburned to deathtorso cut in halfsevered leg …aerial shotbooby trappunched in the cheststabbed in the legstabbed in the throatchaosmercilessnessanimal attackend of the worldtorchkicked in the stomachburned alivestylized violencedestructionsabotagehenchmanbattlefieldsevered armwaterfallopening action sceneevil manrace against timemissionstabbed in the backprologuedangerone against manynecklaceunderwater scenecreaturedouble crossfictional warno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsimpalementarmymassacreambushgood versus evilsurvivaldecapitationcombatshowdownfalling from heightbrawlswordbattlepunched in the faceslow motion scenerescueshot in the chestfistfightcorpsebeatingvoice over narrationfiresurprise endingchaseknifeexplosionbloodfightviolenceflashback (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
| Subgenre: | martial arts |
| Themes: | artificial intelligenceself sacrificeparanoiabrutalitymonsterescapefeardeathmurder |
| Mood: | gore |
| Locations: | laboratory |
| Characters: | engineerprofessorsoldierdoctorboyfriend girlfriend relationship |
| Story: | female soldierhand to hand combatknife throwingthreatened with a knifebackflipdeoxyribonucleic acidarmorywoman fights a manfemale fightertorso cut in halfgatling gunsevered leghologramdual wieldcyborg …kicked in the stomachelectronic music scorehypodermic needlemachetesabotageundeadsevered armmercenaryexploding bodykicked in the facetough girlevil manrace against timebeaten to deathelectrocutionstabbed in the backprologuedangershot in the legunderwater scenecreaturedisarming someonesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushflashlightsurvivaldecapitationshot in the backkung fuscientistheld at gunpointshowdownfalling from heightpunched in the facerescueshot in the headshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosionflashbacksequelbloodfightviolence (See All) |
30 years after the defeat of Darth Vader and the Empire, Rey, a scavenger from the planet Jakku, finds a BB-8 droid that knows the whereabouts of the long lost Luke Skywalker. Rey, as well as a rogue stormtrooper and two smugglers, are thrown into the middle of a battle between the Resistance and th …e daunting legions of the First Order. (Read More)
| Subgenre: | martial arts |
| Themes: | hoperedemptionbrutalityangerdeceptionmonsterescapefearbetrayalkidnappingmurderdeathrevenge |
| Characters: | hostagesoldierfemale protagonist |
| Story: | resistance fighteranti heroineaction heroineone woman armyfemale soldierhand to hand combatdetonatorwoman fights a mancloningopen endedwoman kills a mangenetic engineeringfemale heroworld dominationcommander …megalomaniacreturning character killed offfemale fighteraerial shothologrampower outagechaosmercilessnesshatredresistancefemale warrioreaten alivestrong female leadlaserwalkie talkiestylized violencedestructionsabotagehenchmanbattlefieldshot in the armopening action sceneshot in the shouldertough girlknocked outrace against timemissionelectrocutiondangerbinocularsone against manycreaturefictional wardouble crossno opening creditsstabbed in the chestmixed martial artsarmymassacrestrangulationambushgood versus evilsurvivalshot in the backcombatinterrogationheld at gunpointshowdownfalling from heightbrawlgunfightbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestfistfightshot to deathshootoutfiresurprise endingchaseexplosionbloodsequelfightviolence (See All) |
For Steve Rogers, awakening after decades of suspended animation involves more than catching up on pop culture; it also means that this old school idealist must face a world of subtler threats and difficult moral complexities. That becomes clear when Director Nick Fury is killed by the mysterious as …sassin, the Winter Soldier, but not before warning Rogers that SHIELD has been subverted by its enemies. When Rogers acts on Fury's warning to trust no one there, he is branded as a traitor by the organization. Now a fugitive, Captain America must get to the bottom of this deadly mystery with the help of the Black Widow and his new friend, The Falcon. However, the battle will be costly for the Sentinel of Liberty, with Rogers finding enemies where he least expects them while learning that the Winter Soldier looks disturbingly familiar. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | artificial intelligencehopesurveillanceparanoiadeceptionbetrayalkidnappingmurderdeath |
| Locations: | motorcycle |
| Characters: | security guardhostagesoldier |
| Story: | anti heroinerocket launcheraction heroineone woman armyhand to hand combatsuper computerflash drivewoman fights a mandistrustopen endedwoman kills a mangenetic engineeringstabbed in the armworld dominationmegalomaniac …super strengtharmored carreturning character killed offsatellitegatling gunbody landing on a cargasolinehologrampunched in the chestcigarette lighterdual wieldfemale warriorcyborgmexican standoffwhite housegun fujumping from heightkicked in the stomachsecurity camerahead buttburned alivestylized violencehand grenaderevelationtraitoruzimissilewashington d.c.shot in the armmercenaryshot in the shoulderkicked in the facetough girlknocked outcover uprace against timemissionbeaten to deathelectrocutionone against manyunderwater sceneno opening creditsexploding carstabbed in the chestmixed martial artsflashlightgood versus evilshot in the backcombatcar crashheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathbeatingshootoutfirepistolsurprise endingchaseknifeexplosionsequelviolenceflashbackfightblood (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com