Please wait - finding best movies...
This is the story of a young boy named Richard Tyler, who spouts statistics about the possibility of accidents. So much so, he is scared to do anything that might endanger him, like riding his bike, or climbing into his treehouse. While riding his bike home, Richard finds shelter from a storm inside … a nearby library. Richard slips and is knocked unconscious while exploring a rotunda in the library. Upon awakening, he is led on a journey through conflicts and events that resemble fictional stories, keeping him from finding the exit from the library. (Read More)
| Subgenre: | fantasy reality crossovercoming of agecult film |
| Themes: | courageescapeghostsurrealism |
| Mood: | affection |
| Story: | reference to jack and the beanstalkfire breathing dragonlibrary cardreal person becomes animateddr jekyll and mr hydeparents son relationshipcrumbling to dustslipping on a wet floortreasure islandreference to quasimodobicycle jumphitting one's headlong john silvermagical carpetmoby dick …beanstalkgiant squidtree houseminiature personacrophobiafairy godmotherunconsciouslifting male in airmagic wandyoung boymuralpart live actiontreehousecowardtelephone boothlibrarianwhalehappy endingcrowthunderstormchild protagonistwizardshieldpresumed deadeaten alivemad scientistlifting someone into the airhelmetpirateskeletondragonlibraryjourneymansionbookswordtitle spoken by character (See All) |
When a green ogre named Shrek discovers his swamp has been 'swamped' with all sorts of fairytale creatures by the scheming Lord Farquaad, Shrek sets out with a very loud donkey by his side to 'persuade' Farquaad to give Shrek his swamp back. Instead, a deal is made. Farquaad, who wants to become the … King, sends Shrek to rescue Princess Fiona, who is awaiting her true love in a tower guarded by a fire-breathing dragon. But once they head back with Fiona, it starts to become apparent that not only does Shrek, an ugly ogre, begin to fall in love with the lovely princess, but Fiona is also hiding a huge secret. (Read More)
| Subgenre: | cult filmfairy talesword and sorceryepiccomputer animationcgi animationgross out comedyfairy tale parody |
| Themes: | couragedeathfriendshiptortureweddingheromagiccorruptionwrestlingredemptioncannibalismvengeanceunlikely hero |
| Mood: | satire |
| Locations: | forestcastle |
| Characters: | friendsoldierwarrior |
| Story: | fire breathing dragonshieldeaten alivelifting someone into the airskeletondragonswordtitle spoken by charactercharacter name in titlemale nuditykisschasesurprise endingfirebased on book …title directed by femalefistfightmirrorrescuebattlebrawlbeercombatsubjective cameraanti herocoffinprincesstransformationduelcursebeaten to deathisolationpigfirst partbeardismembermentdestinywolfloyaltyspearslow motiontalking animalquestmutilationmousehunterblockbustergiantflatulenceknighthonoranimal attackdwarfcrossbowfight to the deathfairyhit in the crotchswamparmordisfigurementkingdomsevered legalienationcrude humordaggerchallengesurprise after end creditsblindbullet timespellsidekickdonkeysunsettoweraccordionshot with an arrowreluctant herocartoon violencesunrisebishopaltered version of studio logowindmillpitchforkanachronismbased on children's booklifting female in airarm ripped offleadershiplordogregnomestained glass windowinterrupted weddingouthousecgi filmrope bridgejudgmentbelchmagical mirroronionethnic cleansinggingerbread mandark agesactor voicing multiple charactersawkward silencecandlestickinterspecies romanceflying dragonshreksword throwingbluebirdwinged dragondrawing in sandhybrid animaltrampled to deathexploding animalstorybook in opening shotrotisseriesarcasm taken literallydecree (See All) |
Arthur (aka Wart) is a young boy who aspires to be a knight's squire. On a hunting trip he falls in on Merlin, a powerful but amnesiac wizard who has plans for Wart beyond mere squiredom. He starts by trying to give Wart an education (whatever that is), believing that once one has an education, one …can go anywhere. Needless to say, it doesn't quite work out that way. (Read More)
| Subgenre: | sword and sorcery2d animationdisney |
| Themes: | surrealismmonstermagic |
| Locations: | forestsnowlondon englandwoodsenglandcastle |
| Characters: | boywitchmerlin |
| Story: | fire breathing dragonmagic wandyoung boywizarddragonswordtitle spoken by characterbased on noveldoghorsecatorphansnakefishbird …ritualunderwater scenetransformationfive word titledueltreerabbitchickenwolfbow and arrowtalking animalelephantmouseblockbusterfrogknighttournamentgoatdivingprophecymedieval timesfalldeerturtlekingdomowlcrocodilecrownsquirrelblackboardfriends who live togethercrabrattlesnakecoldhawkthronetitle appears in songminiaturizationhuman becoming an animalrhinoceroswashing dishesdisobeying ordersking arthuranvilplatewalrustalking birdexcaliburarthurian legenddisobediencethermometertalking fishround tablesquirestorybook in opening shot6th centurychicken poxgiantesssword in stonecharacter turns greenanimal licking someonewizards' dueldirty dishesrefusing to believe (See All) |
A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village … council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)
| Subgenre: | cult filmmartial artsfairy talesword and sorcerydark fantasysword and fantasychrist allegory |
| Themes: | courageescapesurrealismfriendshiprevengekidnappingbetrayaladulterymonsterheromagicredemptionsadismforgivenessbook of magic |
| Mood: | rainpoetic justice |
| Locations: | forestsnowboatvillagefarmlakecastlecampfireroad movie |
| Characters: | family relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendlittle girllittle boyvillainwitch …self discoverycrying babybaby girl (See All) |
| Story: | fire breathing dragonmagic wandcrowwizardshieldlifting someone into the airskeletondragonjourneybookswordtitle spoken by charactercharacter name in titlebloodone word title …dogkissfightdancingknifechasecryinghorsepunched in the facecatbattlefalling from heightmaskshowdownhand to hand combatislandrivercombatsubjective cameragood versus evilsword fightmountaindisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualold womanprincesstransformationcursemissiontentkicked in the facelightningfarmerbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightloss of friendhidingvillainessanimal attackgoatapplefemale warrioradventurerdwarffairyprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamsmokedaggerhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powersnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All) |
Bilbo Baggins is swept into a quest to reclaim the lost Dwarf Kingdom of Erebor from the fearsome dragon Smaug. Approached out of the blue by the wizard Gandalf the Grey, Bilbo finds himself joining a company of thirteen dwarves led by the legendary warrior, Thorin Oakenshield. Their journey will ta …ke them into the Wild; through treacherous lands swarming with Goblins and Orcs, deadly Wargs and Giant Spiders, Shapeshifters and Sorcerers. Although their goal lies to the East and the wastelands of the Lonely Mountain first they must escape the goblin tunnels, where Bilbo meets the creature that will change his life forever ... Gollum. Here, alone with Gollum, on the shores of an underground lake, the unassuming Bilbo Baggins not only discovers depths of guile and courage that surprise even him, he also gains possession of Gollum's "precious" ring that holds unexpected and useful qualities ... A simple, gold ring that is tied to the fate of all Middle-earth in ways Bilbo cannot begin to know. (Read More)
| Subgenre: | sword and sorcery |
| Themes: | courageescapemonstercooking over a campfire |
| Locations: | forestcastlecavetunnel |
| Characters: | warrioryounger version of character |
| Story: | fire breathing dragonwizarddragonjourneyswordbased on novelflashbackfightexplosionchasesurprise endingfirevoice over narrationrescuefalling from height …hand to hand combatgood versus evilsword fightaxemountainstabbingbridgecolon in titlestabbed in the chestmapsevered headdisarming someonekingfive word titlekeyringfirst partwaterfallsevered armgoldwolfbow and arrowhead buttquesttreasureexploding buildingwitchcraftgiantsevered handanimal attackcrushed to deathdwarf3 dimensionalbutterflyaerial shotwilhelm screamprequelelfcontractnarrated by characterinvisibilityeyecomic reliefshot with an arrowamputeesunrisetrolleaglefriends who live togethergoblinslingshotclimbing a treepart computer animationprehistoric timesopen endedwriting a letterblacksmitharm cut offriddleclose up of eyemale male hugred wineleaving homegold coinponyogrerunning for your lifehedgehogmale singerprehistorywalking stickemaciationlooking in a windowmothturned to stonecaught in the rainancientbridge collapseburied treasureuninvited guestballadeerfootbridgeorclighting a candlemagical ringinvented languagehobbitmiddle earthbeheadedunderground citydiversiongiant birdnecromancerrunesinger offscreenlive action remakescenic beautysmoke ringactor reprises previous rolefictional languagesmoking a piperockslidecrescent moonelongated cry of nofissurequill penrotisserieunexpected visitorbuglerhanging from a ledgewriting memoirsstolen treasurefalling down a holefish dinnerpile of goldrunning on a bridgeunexpected gueststhrushunderground lake (See All) |
Bastian is a young boy who lives a dreary life being tormented by school bullies. On one such occasion he escapes into a book shop where the old proprieter reveals an ancient story-book to him, which he is warned can be dangerous. Shortly after, he "borrows" the book and begins to read it in the sch …ool attic where he is drawn into the mythical land of Fantasia, which desperately needs a hero to save it from destruction. (Read More)
| Subgenre: | cult filmtragedyfairy talesword and sorcerystop motion animationhigh fantasy |
| Themes: | monsterheromagicangerillnesshopemythology |
| Mood: | darknessbreaking the fourth wall |
| Locations: | schoolkitchencity |
| Characters: | father son relationshipboygirlwarriorbullysingle fatherself confidence |
| Period: | 1980s |
| Story: | miniature personyoung boyhappy endingchild protagonistdragonjourneybooktitle spoken by characterbased on novelfightexplosionchasethree word titlehorserescue …battlescientistgood versus evilforeign language adaptationcreaturedangerkeymissionreadinglightningsadnessfirst partloss of motherwerewolfwolfdestructionflyingtalking animalquestdiseaseloss of friendhidinggiantdesperationvisitbreakfastrealityanthropomorphismimaginationwindthundersandbackpackdespairswampfrustrationbookstoredaydreamatticturtleopening a doorwishlightweathershamemudbathorseback ridingconfusionalleysandwichgatetowerpictureadviceelementary schoolbeastfantasy worldmale protagonistwarningfriends who live togetherluckfamous scoremeteortitle same as bookalter egofather son estrangementcureallergyhiding placedumpsterlunchrescue from drowningdeath by drowningsnailwish fulfillmentgnomeempowermentmysticfantasy becomes realitychild herowhite horsedeath of petexhaustionbased on young adult noveloraclefamous songsneezeempresssphinxpleadingechotravellingpostmodernismloss of petvoidbook sellermagic booklaser visionstory within the storyencouragementlatenessbook storesurvivor guiltmagical bookpretty girlvibrationlate for schoolboy horse relationshipdeath rayunderaged protagonistfissuregiant batself beliefyellnamingtalking rockdark versus lightskipping classwindstorm (See All) |
The myth of King Arthur brought once again to the screen. Uthur Pendragon is given the mystical sword Excalibur by the wizard Merlin. At his death Uthur buries the sword into a stone, and the next man that can pull it out will be King of England. Years later Arthur, Uthur's bastard son draws Excalib …ur and becomes king. Guided by Merlin, Arthur marries Guenivere and gathers the Knights of the Round Table. Arthur's evil half-sister Morgana sires a son with him, who may prove his downfall. (Read More)
| Subgenre: | sword and sorcery |
| Themes: | escapesurrealismdeathfriendshipmarriageinfidelityadulteryfeardeceptionmagicincestangerbrutalitysupernatural powerdying …falling in love (See All) |
| Mood: | affection |
| Locations: | forestwaterwoodslakecastlecave |
| Characters: | husband wife relationshipfriendlustwitchevil witchself injury |
| Story: | crowwizardhelmetdragonswordtitle spoken by characterfemale nuditynuditybloodmale nudityviolenceone word titlefemale frontal nuditymale rear nuditysex scene …kissfemale rear nudityfightfirebased on bookbeatingcorpsehorseblondebattlebrawlhand to hand combatmale pubic haircombatsword fightold manaxemassacredisguisestabbingimpalementstabbed to deathstabbed in the chestsnakebrunettefictional warkingtransformationpublic nuditytreelegendmissionpassionrabbithangingtragic eventdeath of husbandhorse ridingqueenspearquestmagiciancovered in bloodknightforbidden lovemedieval timesfogdead maneye gougingarmorsiegeattractionowlspellhistorical fictionassumed identitydying manpatricidebleedinghanged manflamebloodshedmatricidemiddle agesbritish renaissancewhite dressrise and fallhalf brotherdying wordsweepinghalf sistermagical swordevil powerking arthurholy graildeath by impalementdeath of main characterkilled with a swordsword and shieldcamelotexcaliburarthurian legendattempted escapebloodstainmace the weaponround tablefighting with selfjoustknights of the round tablerape by deception6th centurysword in stone5th century (See All) |
Once again we're plunged into the world of sword fights and "savvy" pirates. Captain Jack Sparrow is reminded he owes a debt to Davy Jones, who captains the flying Dutchman, a ghostly ship, with a crew from hell. Facing the "locker" Jack must find the heart of Davy Jones but to save himself he must …get the help of quick-witted Will Turner and Elizabeth Swan. If that's not complicated enough, Will and Elizabeth are sentenced to hang, unless will can get Lord Cutler Beckett Jack's compass, Will is forced to join another crazy adventure with Jack. (Read More)
| Subgenre: | cult filmsteampunkdark fantasyswashbuckler |
| Themes: | escapemurderbetrayaljealousydrunkennessmonstertheftgamblingcannibalismself sacrifice |
| Locations: | beachcemeterycaribbeansea monsterghost ship |
| Characters: | father son relationshipfather daughter relationshiplove triangle |
| Period: | 1700s |
| Story: | giant squidcrowpresumed deadeaten alivelifting someone into the airpirateskeletonswordsequeldogexplosionchasesurprise endingfireface slap …rescuearrestfalling from heightvomitingsecond partapostrophe in titlejailislandsword fightaxewomancolon in titlesnakesevered headno opening creditsanti herocoffindouble crosscursekeyunderwaterwhippingundeadmonkeydressslow motioncagehatslaverytreasureblockbusterpart of trilogycgicannontelescopeseven word titlerowboatscene after end creditssuperstitionheartrainstormvoodoowilhelm screamsurprise after end creditsbathistorical fictionruinsgiant monstergovernorold flamehanging upside downtentaclewagerchandeliermacguffinaltered version of studio logocrabopen endedmusic boxdeath sentencefather son reunionwoman slaps a mandiceorganbonedreadlockslifting person in aircompassjamaicaslimecanceled weddingsailing shippirate shipcult figurependanttreasure chestchestsquidgunpowderbritish empirenaval officercliffhangercastawayrumglass eyerope bridgesea captainjarseashellbell towernative tribeship sinkingblowgunbird attackdice gamechasmflaming swordbridal gownfliesflailpeg legkrakenwater wheelmacawpigstybased on theme park attractionmale dragcapuchin monkeyeyes pecked outeast indian companysignet (See All) |
The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E …ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)
| Subgenre: | cult filmmartial artssword and sorceryepicswashbucklersword and fantasy |
| Themes: | couragemonsterheromagicmythology |
| Locations: | castle |
| Characters: | soldiertough guywarrior |
| Story: | fire breathing dragonwizarddragonjourneyswordcharacter name in titlebased on novelone word titlefightbased on bookhorsebattlesecrethand to hand combatdemon …fightingcombatsubjective cameragood versus evilambushdeath of friendmixed martial artsdisarming someonefictional warkingduelbattlefieldbow and arrowspearegghunterknightdwarfsiegekingdomsword dueltragic herodaggerstick fightelfheroismadventure herofantasy worldsword fightingsword and sandalopen endedchosen onestaffteenage heroshot with a bow and arrowfictional countrybattle axeteenager fighting adultswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All) |
Long ago up North on the Island of Berk, the young Viking, Hiccup, wants to join his town's fight against the dragons that continually raid their town. However, his macho father and village leader, Stoik the Vast, will not allow his small, clumsy, but inventive son to do so. Regardless, Hiccup ventu …res out into battle and downs a mysterious Night Fury dragon with his invention, but can't bring himself to kill it. Instead, Hiccup and the dragon, whom he dubs Toothless, begin a friendship that would open up both their worlds as the observant boy learns that his people have misjudged the species. But even as the two each take flight in their own way, they find that they must fight the destructive ignorance plaguing their world. (Read More)
| Subgenre: | coming of agecult filmcomputer animationcgi animation |
| Themes: | escapefriendshipjealousyabuseexecution |
| Mood: | night |
| Locations: | schoolforestboatvillagelakeshipcastlecave |
| Characters: | father son relationshipteenagerteenage girlteenage boytough guywarrioraction herobest friendbullyteacher student relationshipgirlfriendsingle fatherengineerhuman animal relationshipboy hero |
| Story: | shieldlifting someone into the airhelmetdragonswordbased on novelkissexplosionsurprise endingfirevoice over narrationrescuebattlebrawlfalling from height …showdownislandcompetitioncombataxemontagefishno opening creditsanimalfictional warunderwater scenefive word titletrainingattackreadingtough girllightningexploding bodyfirst partwaterfalltwintrustmoonsingle parentflyingheavy raincagefaintinghammerexploding buildingblockbustersheepfemale warriorbraverycrossbowinventor3 dimensional3dmedieval timesvolcanorainstormpublic humiliationflightclose up of eyesfireballvikingamputeewellno title at beginningcottagetavernacceptancearenacreativityscandinaviaskyhandexploding houseexploding shipparentingblacksmithrescue from drowninghit with a hammerignoranceteenage heroscottish accentstrong manbattle axefire breathingstudio logo segues into filmnestchange of heartgiant creaturecatapultchorescouncilreptileshoreaurora borealisnorthern lightswarrior womanartificial leginstinctdisabilitiesmisadventureflying dragonpeg legarmadanorseimax versionhook for a handdragon featurehuman versus dragonbelief in godsmisunderstooddisownmenthuman dragon relationship (See All) |
| Subgenre: | coming of agemartial artsabsurdismslapstick comedyfish out of watersteampunkswashbucklersword and fantasychrist allegory |
| Themes: | courageescapesurrealismmurderdeathfriendshiprevengekidnappingbetrayalfearherodeceptionmagicfaithhope …near death experience (See All) |
| Locations: | forestboatlondon englandwoodsshipouter spacecavecampfirecable car |
| Characters: | mother son relationshipchildrenboybabyhostagewarriornative americanamerican abroadmermaidship captaincrying boyboy crying |
| Period: | world war two1940s1930s |
| Story: | child protagonisteaten alivepirateskeletonjourneyswordtitle spoken by charactercharacter name in titlebased on novelviolenceone word titlegunfightexplosionknife …chasesurprise endingpistolfirevoice over narrationfistfightface slaprescueslow motion scenepunched in the facebattlebrawlfalling from heightlettershowdownheld at gunpointhand to hand combatbombrivercombatsubjective cameragood versus evilorphanflashlightsword fightambushaxemountainmixed martial artsmapnunno opening creditschild in perilfictional warunderwater scenecreaturesearchprincesson the runtrainingflash forwardattempted murdertreecharacter repeating someone else's dialogueprologuekeyattackfugitivecharacter's point of view camera shotstatueevil manknocked outkicked in the facetough girlmartial artistexploding bodytied upthreatened with a knifebattlefieldstylized violencehenchmanflirtingropedestinycaptainflyingspearslaverycowboy hatjail cellkicked in the stomacheccentricgiantjumping from heightirishorphanagetorchaction heroineanimal attacksocial commentarybald manslavecannonfemale warriorguardvisionexplosivechild's point of viewbraveryfairydual wieldanimated sequence3 dimensionalfalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestbooby trapmusical numbertribeminekingdomsword duelcellarflamethrowerprequelclose up of eyesheroismflagminingfemale fightershipwreckcrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfantasy worldfighter pilotreluctant heroilliteracyaltered version of studio logohumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanegiant animalpirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laboralternate worldblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcewarrior racereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying fishflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All) |
The teenager Sarah is forced by her father and her stepmother to babysit her baby brother Toby while they are outside home. Toby does not stop crying and Sarah wishes that her brother be taken by the Goblin King. Out of the blue, Toby stops crying and when Sarah looks for him in the cradle, she lear …ns that he wish was granted and the Goblin King Jarethhas taken him to his castle in the Goblin City in the middle of a labyrinth. Sarah repents an asks Jareth to give Toby back; but the Goblin King tells that she has to rescue her brother before midnight, otherwise Toby will be turned into a goblin. Soon Sarah teams up with the coward goblin Hoggle, the beast Ludo and the knight Didymus and his dog Ambrosius in her journey. Will they rescue Toby in time? (Read More)
| Subgenre: | coming of agecult filmsword and sorcerysteampunk |
| Themes: | surrealismfriendshipkidnappingbetrayalfearmonstermagicangerforgivenessmythology |
| Mood: | rain |
| Locations: | forestwoodscastlecavecampfirestorm |
| Characters: | father daughter relationshipfriendteenage girlgirlbabycrying baby |
| Period: | 1980s |
| Story: | cowardlifting someone into the airhelmetjourneybookswordtitle spoken by characterone word titledogdancingphotographsingingfirecryingsong …dreammirrorurinationrescueslow motion scenecatbattlemasktearsrunningriversubjective cameragood versus evilcandlesnakechild abusechildkingcreaturesearchtransformationlegendcostumepuppetrace against timetentlightningbraceletringactor shares first name with charactertrapbrothertied upgardenchickensisterrockropeundergroundelectronic music scorequestbabysittercaptivetoygiantladderknighttorchclockcannoncelebrationfull moonguardwindthunderbraveryfairypet dogstairslaughterlionlipstickarmorgrowing upwishfortune tellerowlweathermemory lossspelljewelrystrugglegatejunkyardmazeselfishnesswallstepmotherbeast16 year oldsorcererbellfantasy worldwormmetamorphosisfemale heromissingeyeballtrollgoblinsiblingriddletrapdoorcockney accentthe muppetsalice in wonderlandpitsnoringlabyrinthsittingcrotch shotbattle axecrystal ballwish fulfillmentmasqueradeperilmorphingbad smellclock towervirtual setlancelifting a male into the airpeachfantasy lifesentrymasked ballactor voicing multiple charactersgownmasquerade partycitadelbogtrumpeterdoor knockerfoot bridgebulgerevulsionescher stairwayactress voicing multiple charactersoubliettebaby cribpea shootertalking worm (See All) |
Harry, Ron, and Hermione continue their quest of finding and destroying the Dark Lord's three remaining Horcruxes, the magical items responsible for his immortality. But as the mystical Deathly Hallows are uncovered, and Voldemort finds out about their mission, the biggest battle begins and life as …they know it will never be the same again. (Read More)
| Subgenre: | coming of agecult filmdark fantasy |
| Themes: | ghostdeathfriendshipbetrayalfeartortureherodeceptionmagicmemorycorruptionterrorismredemptionself sacrificeunlikely hero |
| Locations: | trainforestcastleschool of magic |
| Characters: | teenagerteacherteacher student relationshipwitchchildhood friend |
| Period: | 1990s2010s20th centurynear future21st centuryyear 1997year 1998 |
| Story: | fire breathing dragonmagic wandwizardpresumed deaddragonswordcharacter name in titlebased on novelnumber in titlebloodviolencesequelflashbackkissexplosion …firerescuebattlefalling from heightshowdowndead bodycombatgood versus evilspyambushterroristdisguisedeath of friendsnakefictional wardouble crossduellegendcurseattackrace against timetough girlbankscarthreatwaterfallarsonbattlefieldpowerstrong female characterwerewolfdisasterdestinyloyaltydestructionrevelationloss of friendroman numeral in titleexploding buildingspidergiantfrograilway stationstrong female leadback from the deadbraveryimpostorresurrectionimmortalitydark pastdead woman with eyes openblack magicteleportationelfheroismfinal showdownreturning character killed offdark secretassumed identityyoung version of characterboy with glassessorcererartifactfemale heroepiloguefinal battlevaultinfiltrationsnake bitechosen oneforce fielddouble agentteenage herodying wordsdead woman on floorbroomgiant spidercupbank vaultcult figurepretending to be deadeighth partlast of seriesmass destructionbased on young adult novellimboenglish subtitles in originalgiant snakepythonevil sorcereryear 2017wet jeansdeath by fireevil wizardwandaftermathexploding bridgehereditary gift of witchcraftthroat slashedkilling a snakebitten by a snakesoaked clothesmagical broomstickmain characters killed offdeath of relativeanimate statuebildungsromaneighth in serieshobgoblininspirational speechmoving statuelife and death battleduel to the death (See All) |
The passage from this world to the fantasy kingdom of Stormhold is through a breach in a wall beside an English village. In the 1800s, a boy becomes a man when he ventures through the breach in pursuit of a fallen star, to prove his love for the village beauty. The star is no lump of rock, it's a ma …iden, Yvaine. Tristan, the youth, is not the only one looking for her: three witches, led by Lamia, want her heart to make them young; and, the sons of the dead king of Stormhold want her because she holds a ruby that will give one of them title to the throne. Assisting Tristan are his mother, the victim of a spell, and a cross-dressing pirate of the skies. Will Tristan win his true love? (Read More)
| Subgenre: | coming of agecult filmepicswashbucklersword and fantasy |
| Themes: | courageescapeghostsurrealismmurderdeathlovekidnappingbetrayalmagicunrequited lovehopedying |
| Locations: | beachforestsnowbathtubvillagestorm |
| Characters: | friendteenage boybabywitchyounger version of characterevil witch |
| Period: | 1870s1850s |
| Story: | happy endingpirateswordtitle spoken by characterf ratedbased on novelviolenceone word titleflashbackkissdancingexplosionchasefirevoice over narration …foodhorsemirrorblonderescuefalling from heightletterrunningbirthdayscientistgood versus evilcandlesword fightdeath of friendeatingno opening creditsbirdcoffinbathunderwater scenekingprincesstransformationconfessionattempted murderargumentprologuerace against timelightningdeath of brotherdeath of sontied upflowersleepingcross dressingqueenmoonprinceballoongothiccageelephantmousewitchcrafthonorslavetelescopethundermisunderstandingensemble castinsultlightstick fightmannequininvisibilitydead animaltowerblonde womancrownbroken mirrorfencingmeat cleavercheeseimplied sexlong brown hairstaffcupwaltzstickcrossroadsliverblue blooddeath of kingtied togetherpushed off a cliffintestinemusic score features choirevil princesilver dress (See All) |
In this charming film based on the popular L. Frank Baum stories, Dorothy and her dog Toto are caught in a tornado's path and somehow end up in the land of Oz. Here she meets some memorable friends and foes in her journey to meet the Wizard of Oz who everyone says can help her return home and possib …ly grant her new friends their goals of a brain, heart and courage. (Read More)
| Subgenre: | allegory |
| Themes: | courageescapefriendshipdancemagicdysfunctional familyguiltabduction |
| Locations: | forestsnowbicyclevillagefarmroad tripcastlewalled city |
| Characters: | husband wife relationshipsingerhostagewitchuncle niece relationshipaunt niece relationshipcoronerevil witchgirl and her dog |
| Story: | crowwizardlifting someone into the airjourneytitle spoken by characterdogsingingfirecryingsongdreamhorserescuecatsecret …falling from heightgood versus evilaxedisguisechild in periltreeperson on firethreatflowermonkeyrunawaytalking animalquestfaintingwitchcraftvillainesshomecompassionanimal attackcrushed to deathclockguarddwarfinnocenceimpostorpet dogawardlionjumping through a windowheartdeath of sisterdungeonsnowingsecret identityfortune tellerbrainadolescentauntlevitationgatefireballfarmhousetween girlmedalhot dogtornadoshoecornfieldunconsciousnessfantasy worldchandelierscarecrowhot air balloonbeauty salonbechdel test passedreference to abraham lincolnkansaspigtailsrecluselocked in a roomintellectualdoormanvoyagemagic spellcurtainbroomcowardicebubblecrystal ballfalling asleepniecehomesicknesshourglassbasketrich snobalternate universetalking to a dogdeus ex machinait was all a dreampleadingwizard of ozcrossroadslittle personpet owner relationshipcharlatandrawbridgereference to julius caesarfarm handapple treegreen skinreference to cleopatracycloneanimate treedeath certificatediplomaowner dog relationshipwavinghaunted forestreference to isistin mansmall dogtalking treefacadeslipperwoodsmanreference to the egyptian god osirisaccidental herobroomstickomaha nebraskahome sweet homepigstybucket of waterflying monkeyimaginary landmagical shoegood witchskywritingfloating headloyal doganthropomorphic treemelting womanoil canpoppy fieldflying witchhonorary degreeruby slippers (See All) |
In the sixth year at Hogwarts School of Witchcraft, and in both wizard and muggle worlds Lord Voldemort and his henchmen are increasingly active. With vacancies to fill at Hogwarts, Professor Dumbledore persuades Horace Slughorn, back from retirement to become the potions teacher, while Professor Sn …ape receives long awaited news. Harry Potter, together with Dumbledore, must face treacherous tasks to defeat his evil nemesis. (Read More)
| Subgenre: | cult filmteen romancedark fantasy |
| Themes: | murderdeathlovefriendshiprevengechristmasbetrayaljealousydrunkennessdeceptionmagicmemoryguilt |
| Mood: | rain |
| Locations: | snowlondon englandvillagecaveoceanschool of magic |
| Characters: | husband wife relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshiplove triangleteacher student relationshipprofessoryounger version of characterboy hero |
| Period: | 1990schristmas partyyear 1997year 1996 |
| Story: | magic wandwizardlifting someone into the airdragonlibrarybookcharacter name in titlebased on novelbloodflashbackkissphotographsurprise endingfirecorpse …slow motion scenefalling from heightgood versus evilfoot chasenewspaperdeath of friendno opening creditsunderwater scenenecklacecursepoisonkicked in the facetough girlringdiarymanipulationscardisappearancetragic eventpubstrong female characterwerewolfeavesdroppingfireplaceteen angstburned alivekilling an animalrevelationlooking at oneself in a mirrorstrong female leadorphanageappleinterracial romancebroken glassprophecyhealingteleportationdrugged drinkspellinvisibilitylevitationreturning character killed offdinner partysports teamsubway stationremorseboy with glassestwin brotherinterracial kisschandelierdripping bloodpotionseizureluckbroken noseopen endedorchestral music scoresixth partdead birdheadmastercut handhouse on firelocketevil childgiant spidercult figurehourglassmagical potionlifting a female into the airbased on young adult novelsteam traincliffhangerinfirmaryfalse memoryvowbreaking up with girlfriendcabinetfoaming at the mouthwet jeanslove potionclosing credits sequenceevil wizarddrugged foodclosing eyes of dead personring of firebox of chocolateshereditary gift of witchcraftbad guys winfavoritismfictitious sportburnt down housebildungsromanblack male white female relationshipdestroyed bridgeevil markmagic shopwalking up a wall (See All) |
After a beautiful princess, Aurora, is born in to royalty everyone gathers to exchange gifts. Everything is perfectly fine until an unwanted guest appears, Maleficent. Magnificent casts a spell on the young princess and announces that she will die by pricking her finger on the spindle of a spinning …wheel on the evening of her 16th birthday. Fortunately, one of the good fairies, Merryweather, changes the spell so Aurora will fall asleep, and that the only way to wake her up were the tears from her true love. Finally the day comes. Will she be left to sleep forever? (Read More)
| Subgenre: | fairy talesword and sorcery2d animationdisneysword and fantasybased on fairy talehand drawn animationtraditional animation |
| Themes: | surrealismfriendshipprisondrunkennessdanceheromagicevil |
| Locations: | forestfrancecastle |
| Characters: | father son relationshipteenage girlfemale protagonistwitchbaby girlevil witch |
| Story: | fire breathing dragonmagic wandhappy endingshieldlifting someone into the airdragonswordbloodkisssingingfirevoice over narrationcryinghorsebattle …birthdaydemoncombatgood versus evilbound and gaggedwinesword fightmountainfishbirthday partyforeign language adaptationkingfemme fataleprincesscursemistaken identityrabbitgifthorse ridingtrapflowerqueenprincespeardresseggcakewitchcraftvillainessblockbusterknightcelebrationguardstupiditydamsel in distressfairylove at first sightprophecyhypnosisoildungeonkingdomarrowlightowlspellfinal showdownstonetrue lovecrownsquirrelsleepcottageyoung womanfriends who live togetherfinal battlerainbowravencleaningyoung manhappy birthday to yousurprise partybroomlifting female in airbirdsbuckethuman becoming an animalbubblecoatfireworkfalling asleepawakeningturned to stonechimneytalking to an animalmockerycastle thundersuper villainesssurprise birthday partyplatefalling off horsemop14th centurydrawbridgeacornbootsleeping beautycradlepet bird16th birthdayspinning wheeldisney princesslutebluebirdhelpingstorybook in opening shotbetrothalthornbaking a caketransmutationpricked finger (See All) |
After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h …is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)
| Subgenre: | coming of agemartial artssword and sorcerydark fantasysword and fantasy |
| Themes: | escapemurderdeathrevengedrunkennessmonsterdeceptionmagicredemptionunrequited lovehome invasiongreed |
| Mood: | rainnightmare |
| Locations: | forestsnowsmall townboatvillagewoodscastlecave |
| Characters: | father son relationshipfather daughter relationshipbrother sister relationshipsoldierhostagethieftough guylove trianglewarrioraction heromayorsingle father |
| Story: | fire breathing dragonwizardshieldskeletondragonjourneyswordtitle spoken by charactercharacter name in titlebased on novelbloodviolencesequelflashbackfight …photographexplosionpartyknifechasefiredreamshot to deathblood splatterfistfightshot in the chestshot in the headrescuewritten by directorbattlearrestbrawlfalling from heighthand to hand combatsecond parthallucinationrivercombatshot in the backsubjective cameradecapitationgood versus evilfoot chaseassassinsword fightambushstrangulationaxemountainthroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestmapfishsevered headno opening creditschild in perilfictional warunderwater scenekingcreatureshot in the legtransformationshot in the foreheadcharacter repeating someone else's dialoguestabbed in the backkeyperson on firefantasy sequencepoisoncharacter's point of view camera shotrace against timeknocked outtough girlringshot in the shoulderscarneck breakingtrapwaterfallshot in the armpubsubtitled scenestylized violencesingle parenticegoldfalling down stairsbow and arrowkilling an animalspearassassination attemptquestbarnjail celltreasureblockbustergiantskullaction heroineanimal attackgoatfemale warriorguarddwarfburglarflooddual wieldstabbed in the throat3 dimensionalstabbed in the neckshot in the faceprophecystabbed in the headstabbed in the legfogcapturedisfigurementknife throwingstabbed in the eyeeye patchlens flarekingdomprequelteleportationpipe smokingtorso cut in halfelftombfemale soldierinvisibilitydirector cameoshot in the neckfemale fightergiant monsterbeeshot with an arrowamputeestabbed in the armwellshot in the eyecrystaldammushroomfriends who live togetherstabbed in the shoulderclimbing a treeshot in the throatdisfigured faceopen endedcorrupt officialshapeshiftingsubterraneanjewelfreedom fighterbarrelclose up of eyeanimal killingforce fieldarmoryleg woundburning buildinghumangiant spiderchopping woodstabbed in the mouthgold coinwheelbarrowhidden doorwine cellargiant creaturelost in the woodsorbdog sledcliffhangerspider webhealing powerballadeerstaringcocoonsignalhobbitmoonlightprequel and sequelnecromancersinger offscreenflying dragonminstrellive action remaketapestryflatterywinged dragonwhite mouseapprehensiongold ringstone bridgetalking dragongold statuepoisoned arrowsilver coinbare foot manpile of goldsleepyglowing crystalthrush (See All) |
An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.
| Subgenre: | coming of age2d animationdisneyswashbuckler |
| Themes: | surrealismfriendshipkidnappingjealousyheromagicangerchildhoodmythology |
| Locations: | boatlondon englandseaenglandcavejunglecity of children |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother brother relationshipboybrother sister relationshipgirllittle girlnative americanlittle boymermaid |
| Period: | 1900s |
| Story: | child protagonistlifting someone into the airpiratejourneyswordtitle spoken by charactercharacter name in titlebased on noveldogfightbased on playdreamrescuebedisland …good versus evilorphansword fightmapcigar smokingprincessduelattempted murderumbrellarabbitfirst partwaterfallbearmonkeycaptainflyingwoundblockbusterimpersonationteddy bearclockexplosivefairyshadowpipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassesseagullcloudfantasy worldfriends who live togetheraltered version of studio logoskyoutlaw gangracial stereotyperaccoonhookpirate shiprhinocerosbig ben londonskunkhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandseashell bikinimagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All) |
When Scrat accidentally provokes a continental cataclysm with a storm, Manny is separated from Ellie and Peaches on an iceberg with Diego, Sid and Granny but he promises that he will find a way to return home. While crossing the ocean, they are captured by the cruel pirate Captain Gutt and his crew. … However they escape and Manny plots a plan to steal Captain Gutt's ship and return to his homeland in a dangerous voyage through the sea. But the cruel pirates seek revenge against Manny and his family and friends. (Read More)
| Subgenre: | computer animationcgi animationswashbucklerrevisionist history |
| Themes: | escapefalling in love |
| Locations: | oceanstorm at sea |
| Characters: | father daughter relationshipbest friendgrandmother grandson relationship |
| Story: | whalepirateskeletonswordsequelrescuebattlesword fightmapno opening creditsbirdanimalunderwater scenerabbitgrandmother …icetalking animalfourth partblockbustersharkdinosaurmigrationsquirrelfall from heightnatural disastercrabprehistoric timesrainbowapeavalanchekangarooanimal that acts humangiraffepirate shipseal the animalatlantisicebergoverprotective fatherbeaverice agebadgerhot springherdmammothslothacorngiant wavesiren the creaturenorth americawoolly mammothgiant apepangeasabertooth tigernarwhalelephant sealmelting icesliding on icecontinental driftsabre toothed catland bridgemarmotsperm whale (See All) |
Pete, a boy is found in a forest. Apparently he's been living there for six years after an accident took his parents. A ranger named Grace decides to take him in and when she asks him how he survived all by himself, he says he had a friend, Elliot, with him. He draws a picture of Elliot and it's a p …icture of a dragon. Grace takes the picture to her father who claims that years ago, he encountered a dragon in the forest. Grace takes Pete back to the forest and he shows them where he lives and Elliot. A man saw Elliot and when he tells about his experience and is not believed, he sets out to prove it by capturing the dragon. (Read More)
| Themes: | escapeboy girl friendship |
| Mood: | night |
| Locations: | hospitalforestcampfireschool bus |
| Characters: | childrenboygirl |
| Story: | fire breathing dragondragonbookcharacter name in titlesingingfiresongcar accidentremakeapostrophe in titlecar crashriverorphanbridgelegend …rabbitbearcowwolfballoonbarefootbutterflyinvisibilityclimbing a treedeforestationcompassboy girl relationshipkeysculture shockfalling from a treefamily lifechildren's bookfalling treesocial servicesferal childsawmillwoodworkingexcavatorwild childtree climbingblue collar workerliving in foresthuman dragon relationshipbarefoot boyfailed brakes (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir …ing genuine courage. (Read More)
| Subgenre: | cult filmblack comedysupernaturalfairy taleslapstick comedydark fantasy |
| Themes: | courageescapeghostsurrealismmurderdeathrevengekidnappingmoneybetrayalprisondrinkingfeartorturedrunkenness …monsterdeceptionmagicmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All) |
| Mood: | rainnightmare |
| Locations: | churchforestsnowcemeterysmall townvillagewoodscastlecavegermany |
| Characters: | mother son relationshipfather daughter relationshipfriendbrother brother relationshipboyprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove trianglewarrior …witchmayorfrench soldier (See All) |
| Period: | 19th century1810s |
| Story: | reference to jack and the beanstalkcrowlifting someone into the airbookswordtitle spoken by charactercharacter name in titlebloodviolenceflashbackdoggunkissfightdancing …explosionknifethree word titlepistolfirecorpseunderwearfoodhorsemirrorshot in the chestshot in the headrescuecatdrinkbattlearrestfalling from heightriflerunningbedinterrogationhallucinationshot in the backdecapitationbound and gaggedwinecandleold manaxestabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsnakesevered headman with glassestrialanti heroanimaldrawingchild in perildouble crossritualkingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralfireworksqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundgothiccagehatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfemale warriorfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacehorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationbody torn in halfhanging from heightreference to rapunzel (See All) |
The LEGO Movie is a 3D animated film which follows lead character, Emmet a completely ordinary LEGO mini-figure who is identified as the most "extraordinary person" and the key to saving the Lego universe. Emmet and his friends go on an epic journey to stop the evil tyrant, Lord Business.
| Subgenre: | superherocomputer animationcgi animationaustralian fantasy |
| Themes: | ghostunlikely hero |
| Locations: | motorcycle |
| Characters: | father son relationshippoliceaction heropolice shootoutmermaid |
| Story: | part live actionwizardpiratedragonjourneychasethree word titleshootoutcatbattlegunfightrobotdecapitationno opening creditsfictional war …spaceshipunderwater scenecoffeecowboytough girlopening action scenepigaction heroinecyborganthropomorphismcouch3 dimensionalprophecyastronautblind mandc comicsbased on toyconstruction workertwist endingno title at beginningsaloonmovie in titlealtered version of studio logolegounicornpirate shipconformityhobbycgi filmglueoffice buildingteenage mutant ninja turtlesevil businessmanparallel worldsdual personalitygood cop bad copmentoringwarner brosanimate toyevil overlordbrick movielego bricklive action sequence (See All) |
This retelling of the old Chinese folktale is about the story of a young Chinese maiden who learns that her weakened and lame father is to be called up into the army in order to fight the invading Huns. Knowing that he would never survive the rigours of war in his state, she decides to disguise hers …elf and join in his place. Unknown to her, her ancestors are aware of this and to prevent it, they order a tiny disgraced dragon, Mushu to join her in order to force her to abandon her plan. He agrees, but when he meets Mulan, he learns that she cannot be dissuaded and so decides to help her in the perilous times ahead. (Read More)
| Subgenre: | coming of agemartial arts2d animationdisneybased on fairy tale |
| Themes: | friendshipredemption |
| Locations: | chinacampfire |
| Characters: | father daughter relationshipfriendfemale protagonistvillain |
| Story: | fire breathing dragonlifting someone into the airdragonswordtitle spoken by characterf ratedcharacter name in titleviolenceone word titledogbare chested malepartyknifebased on true storyfire …horserescuelettershowdownhand to hand combatcombatkung fumountainfishno opening creditsdisarming someoneritualprincesstraininglegendtough girlopening action sceneloss of fatherfirst partfireworkscross dressingbow and arrowheroineblockbusterimpersonationfalse identityfemale warriorexplosivesexismbathingfamily dinnerpublic humiliationfemale soldierfolklorefemale fighterwar herowar violencearcheryemperorfemale herocartoon violencepunluckforgerywoman fights a manavalanchebo staffoff screen murdergender disguisebased on poemcricketboot camppandaflaming arrowmatchmakerarmy lifewuxia fictionancient chinagreat wall of chinawar woundadvisorgirl disguised as boywoman dressed as a manbeacondisney princessnose picking6th centuryimpersonating a soldiertalking dragon5th centuryasian dragon (See All) |
Mikey Walsh and Brandon Walsh are brothers whose family is preparing to move because developers want to build a golf course in the place of their neighborhood -- unless enough money is raised to stop the construction of the golf course, and that's quite doubtful. But when Mikey stumbles upon a treas …ure map of the famed "One-Eyed" Willy's hidden fortune, Mikey, Brandon, and their friends Lawrence "Chunk" Cohen, Clark "Mouth" Devereaux, Andrea "Andy" Carmichael, Stefanie "Stef" Steinbrenner, and Richard "Data" Wang, calling themselves The Goonies, set out on a quest to find the treasure in hopes of saving their neighborhood. The treasure is in a cavern, but the entrance to the cavern is under the restaurant of evil thief Mama Fratelli and her sons Jake Fratelli, Francis Fratelli, and the severely disfigured Lotney "Sloth" Fratelli. Sloth befriends the Goonies and decides to help them. (Read More)
| Subgenre: | cult filmslapstick comedyteen movieteen comedyswashbuckler |
| Themes: | murderdeathfriendship |
| Mood: | car chaseone night |
| Locations: | beachsmall townbicyclecavetunnel |
| Characters: | family relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother brother relationshipteenage girlteenage boypolice officerjewishpolice chase |
| Period: | 1980s |
| Story: | happy endingthunderstormlifting someone into the airpirateskeletonjourneyswordtitle spoken by characterviolencetwo word titlekissexplosionchasesurprise endingpistol …shootoutcorpseurinationblonderescuewatching tvarrestgunfightvomitingshowdowndead bodyrevolvercriminalswimmingfoot chasenewspapertoiletmapchild abusechildchild in perilsearchconfessionsuburbfugitivemistaken identitystatueopening action sceneconvertiblecheerleadertrapunderwaterclass differencesquestgroup of friendstreasureblockbustervisitgirl with glassesadventurerswitchbladechild's point of viewinventorhit in the crotchfirst kissdynamiteoutlawbooby trapdungeonatticyoung loveopening a doorwishgadgetcellarcoinhuman monsterrestroomreal estateasthmalanguage barriertreasure huntunsubtitled foreign languageoctopussubterraneanrescue from drowningdeformityorgantelevision reportercavernberetteenage heropirate shipfedorasittingshower roomtreasure mapdental bracesforeclosurejail breakdevelopmentfreezerhome alonechild heropacific northwestteenager fighting adulttoupeereference to george washingtonbad motherhawaiian shirtcountry clubcounterfeithousingfamous songfake suicidehidden treasurehiddenbullet holewater slidehare krishnatravellingwet jeansblenderlifting a male into the airchained to a wallagainst the oddslost treasurereference to liberaceoverweight childexercise machinecutlassrube goldberg machinecovegroup of childrentrufflewalking the planksoaked clothesrunning gunfightscally capfrozen corpsewishing welljail escapemichelangelo's davidpirate hatgroup vomitintentional mistranslationschwinn bicyclebaby ruthstepping on a rake (See All) |
A futuristic twist on Robert Louis Stevenson's Treasure Island, Treasure Planet follows restless teen Jim Hawkins on a fantastic journey across the universe as cabin boy aboard a majestic space galleon. Befriended by the ship's charismatic cyborg cook, John Silver, Jim blossoms under his guidance an …d shows the makings of a fine shipmate as he and the alien crew battle a supernova, a black hole, and a ferocious space storm. But even greater dangers lie ahead when Jim discovers that his trusted friend Silver is actually a scheming pirate with mutiny on his mind. (Read More)
| Subgenre: | disneysteampunk |
| Themes: | escapesurrealismmurderdeathgreed |
| Locations: | outer space |
| Characters: | family relationshipsmother son relationshipaliensingle mother |
| Period: | future |
| Story: | pirateskeletonjourneyswordtitle spoken by characterbased on novelflashbackchasefirerescuearrestrobotdeath of friendno opening creditsanti hero …sadnesstrapeavesdroppingloss of friendtreasurespacecraftplanetflatulencecyborganthropomorphismscissorsfather figurebooby traphologramjuvenile delinquentportalhugtaverntreasure hunteyeballpart computer animationshapeshiftingteenage herovillain turns goodgiant spiderloss of memorytreasure mapmutinyblack holefamily abandonmentprosthetic limbdistant futureoutrunning explosionshape shifting aliensea adventuresupernovahoverboardastrophysicistmale with earringimax versionfemale captainholographic map (See All) |
Furious that her late father only willed her his gloomy-looking mansion rather than his millions, Carrigan Crittenden is ready to burn the place to the ground when she discovers a map to a treasure hidden in the house. But when she enters the rickety mansion to seek her claim, she is frightened away … by a wicked wave of ghosts. Determined to get her hands on this hidden fortune, she hires afterlife therapist Dr. James Harvey to exorcise the ghosts from the mansion. Harvey and his daughter Kat move in, and soon Kat meets Casper, the ghost of a young boy who's "the friendliest ghost you know." But not so friendly are Casper's uncles--Stretch, Fatso and Stinkie--who are determined to drive all "fleshies" away. Ultimately, it is up to Harvey and Kat to help the ghosts cross over to the other side. (Read More)
| Subgenre: | supernaturalabsurdismslapstick comedy |
| Themes: | ghostsurrealismfriendshipdrunkennesssupernatural powergriefinheritance |
| Locations: | bardesertlaboratory |
| Characters: | father daughter relationshipteenagerpriestlawyerself referential |
| Period: | 1990s |
| Story: | young boymad scientistmansionswordtitle spoken by charactercharacter name in titleone word titlepartychaseshotgunfalling from heightbased on comichalloweenbased on comic bookno opening credits …news reportbased on tv seriesdangerwidowerangellightninghauntinghaunted housenewspaper headlinefalling down stairsspiritfireplaceheavy rainfaintingblockbusterback from the deadcameochild's point of viewresurrectiondemonic possessionnewspaper clippinghalloween partylighthouseforename as titlecartoon on tvold dark housespiral staircaselast will and testamenttween girlbased on cartoonteasingheiressfriends who live togetherheirpart computer animationmainesecret passagemiddle schoolsledsecret doorstudio logo segues into filmghost costumesecret passagewaybaseball glovesecret tunneltoy trainghostbustertalking to a ghostsecret labbreakfast machinefriendly ghostmeowingcasperghost of wife (See All) |
James' happy life at the English seaside is rudely ended when his parents are killed by a rhinoceros and he goes to live with his two horrid aunts. Daringly saving the life of a spider he comes into possession of magic boiled crocodile tongues, after which an enormous peach starts to grow in the gar …den. Venturing inside he meets not only the spider but a number of new friends including a ladybug and a centipede who help him with his plan to try and get to New York. (Read More)
| Subgenre: | cult film |
| Themes: | surrealismmagictravelrivalryblindness |
| Mood: | nightmare |
| Locations: | new york cityseaengland |
| Characters: | family relationshipsfriendlittle boy |
| Story: | lifting male in airpart live actionlifting someone into the airskeletonswordcharacter name in titlebased on novelbased on bookdreammirrordrinkfalling from heightbirthdaymanhattan new york cityorphan …child abusetransformationtreegiftloss of fatherloss of motherrunawayropewhat happened to epiloguespidersharkpart animationviolinchild's point of viewanthropomorphic animalhungerscene after end creditssurprise after end creditsauntcar troublehot dogseagullcheesefriends who live togetherbagcalendarmysterious strangergiant spiderfruit in titlerhinocerosgiant insectempire state building manhattan new york citypart animatedneglected childvagabondpeachcentipedegrasshopperearthwormgiant wormchicken as foodanthropomorphic insectpart stop motion animationroald dahlshark fin above water (See All) |
Exploring the further adventures of Carmen and Juni Cortez, who have now joined the family spy business as Level 2 OSS agents. Their new mission is to save the world from a mad scientist living on a volcanic island populated by an imaginative menagerie of creatures. On this bizarre island, none of t …he Cortez's gadgets work and they must rely on their wits--and each other--to survive and save the day. (Read More)
| Subgenre: | martial artsspy spoof |
| Themes: | monsterhero |
| Mood: | spoofparodyjames bond spoof |
| Locations: | helicopterwheelchairsubmarinesea monster |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother sister relationshipvillain |
| Period: | 2000s |
| Story: | mad scientistlifting someone into the airhelmetskeletonswordviolencesequelfistfightrescuebrawlfalling from heightshowdownhand to hand combatrobotisland …scientistspysword fightu.s. presidentballetsecret agenttraitorrock concertamusement parkspyinghologramtelepathytracking devicebloopers during creditssecret servicegenetic engineeringfemale herodirector also cinematographerspy herobanquetvillain turns goodsteel helmetmagnetchild heromusic score composed by directormild violencechild fighting adultspy missionchild spydrugged foodtooth extractionmanuredaughter of the presidentformal dancegirl spyboy spy (See All) |
This is the tale of Harry Potter, an ordinary 11-year-old boy serving as a sort of slave for his aunt and uncle who learns that he is actually a wizard and has been invited to attend the Hogwarts School for Witchcraft and Wizardry. Harry is snatched away from his mundane existence by Hagrid, the gro …unds keeper for Hogwarts, and quickly thrown into a world completely foreign to both him and the viewer. Famous for an incident that happened at his birth, Harry makes friends easily at his new school. He soon finds, however, that the wizarding world is far more dangerous for him than he would have imagined, and he quickly learns that not all wizards are ones to be trusted. (Read More)
| Subgenre: | cult filmfairy taleepicdark fantasy |
| Themes: | ghostfriendshipchristmasmoneymonsterheromagicsupernatural powerdysfunctional familycelebrity |
| Mood: | night |
| Locations: | trainforesttrain stationschool of magic |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendgirlbest friendlittle girlbullyteacher student relationshipprofessorwitchuncle nephew relationshipaunt nephew relationship |
| Period: | 1990syear 1991year 1992 |
| Story: | magic wandwizardlifting someone into the airdragonswordtitle spoken by charactercharacter name in titlebased on noveldogsurprise endingmirrorrescueslow motion sceneletterbirthday …good versus evilhalloweenorphansnakechild abuseno opening creditschild in perilcreaturetransformationkeyuniformfirst of seriesmissiontough girlbankscarschoolgirlratfirst partpowerstrong female characterchesseyeglassesoccultdestinygametalking animalhatwitchcraftblockbusterfrogstrong female leadbreakfastdwarfreverse footagebraverycrossbowzooimmortalityboarding schoolstadiumfamily secretowlelfspellinvisibilitylevitationparalysissorcererfantasy worldpotiontrollidentical twinsorchestral music scoresorcerystutteringtrapdoorschool lifeunicornbroomhuman becoming an animalcult figurewoman in uniformmysticchild herofemale ghostgiant creaturegrandfather clockbased on young adult novelinfirmarycloaknew homelifting a male into the airmagical mirrorcentaursteam locomotivemirror does not reflect realityevil wizardflying broombrick wallelitismhereditary gift of witchcraftpoetry recitationinvisibility cloakmagical bookattempted child strangulationforced perspectivebad parentsmagical broomstickfictitious sportbad parentingbildungsromanescher stairwayhobgoblinpet as giftquidditchportrait comes to lifetrain platformmagical cloak11th birthdayfaerie talehuman chessboardsnowy owltripping while fleeing (See All) |
Marvel's "Doctor Strange" follows the story of the talented neurosurgeon Doctor Stephen Strange who, after a tragic car accident, must put ego aside and learn the secrets of a hidden world of mysticism and alternate dimensions. Based in New York City's Greenwich Village, Doctor Strange must act as a …n intermediary between the real world and what lies beyond, utilising a vast array of metaphysical abilities and artifacts to protect the Marvel Cinematic Universe. (Read More)
| Subgenre: | martial artssuperheroparanormal phenomena |
| Themes: | courageescapeghostsurrealismmurderdeathbetrayaldeceptionmagicsupernatural powerapocalypsephilosophyself sacrificenear death experiencespace travel …book of magic (See All) |
| Mood: | raindarkness |
| Locations: | hospitalnew york citychurchhelicoptersnowbusdesertlondon englandapartmentpolice carouter spacefire truck |
| Characters: | doctornursetough guywarrioraction heroteacher student relationship |
| Period: | 2010s |
| Story: | librarianwizardshieldlibrarymansionswordtitle spoken by charactercharacter name in titleviolenceflashbackbare chested malefightexplosionknifechase …surprise endingfirecell phonebeatingcorpsefistfightcar accidentmirrorrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heighthand to hand combatcar crashdemonfightingcombatdecapitationgood versus evilfoot chasebased on comic bookambushambulancebasketballdeath of friendmontageimpalementmixed martial artsstabbed in the chestsevered headno opening creditsanti heroone man armyritualtransformationlatex glovestrainingone against manyspiritualityelectrocutionattackproduct placementrace against timeevil mankicked in the facetough girllightningopening action scenescene during end creditsexploding bodylaptoplove interestbattlefieldpowerstylized violencestrong female characterhenchmansurgerytraitorfalling down stairsdestructionbulletrevelationhead buttheavy rainhong kongmagiciantemplebeardexploding buildingkicked in the stomachblockbustereccentricwristwatchtimeend of the worldaction heroineinterracial friendshipback from the deadfemale warriorcameobraveryfight to the deathdual wieldresurrectionimmortalitymentorscene after end creditsmarvel comicspunched in the chestbutterflyblack eyewisecrack humore mailtitle at the endhealingfemale doctorlaughingsurgeonblack magicreckless drivingteleportationarrogancesurprise after end creditsspellenergylevitationalleyfinal showdownmysticismfemale fighterabuse of powerportaltwo man armyworld dominationbrooklyn bridgemegalomaniacskyscraperold flameno title at beginningsorcererartifactbullet woundguardianoperationamuletimmortalgodvending machinebo staffbaldalternate dimensionnew agetime looprelicattempted robberyx rayed skeletonearth viewed from spacementor protege relationshipnepalparallel worldsurprise during end creditssecret organizationorigin of herobrain surgerybritish actor playing american characterbroken handcollapsing buildingmysticbrass knucklesipodsequel mentioned during end creditsdisobeying ordersdefibrillationdefibrillatoranti villaincosmoshenchwomanmarvel entertainmenthand woundsupervillainout of body experiencealternate worldcloakmarvel cinematic universeevil sorcerermount everestevil godalley fightfighting in the airdying repeatedlyman wearing a tuxedomagical ringmaster apprentice relationshipoccupation in titleastral projectionzealotmagical objectlovecraftianmultiverseneurosurgeonupside downreference to beyoncereference to emineminanimate object comes to lifetime reversalparallel dimensionmentoringremoving a bulletarrogant manreference to bonoprayer wheelpsychedelic imagedimensional portalkathmandu nepalstan lee cameonew york cityscapethrown outcar falling off cliffsevered spinesuperhero origindisembodimentnerve damageenergy beamexperimental surgerysuturing a wounddisintegrating bodydoctor strangemiracle cure (See All) |
Abandoned after an accident, baby Mowgli is taken and raised by a family of wolves. As the boy grows older, the wise panther Bagheera realizes he must be returned to his own kind in the nearby man-village. Baloo the bear however thinks differently taking the young Mowgli under his wing and teaching …that living in the jungle is the best life there is. Bagheera realizes that Mowgli is in danger, particularly from Shere Khan the tiger who hates all people. When Baloo finally comes around, Mowgli runs off into the jungle where he survives a second encounter with Kaa the snake and finally, with Shere Khan. It's the sight of a pretty girl however that gets Mowgli to go the nearby man-village. (Read More)
| Subgenre: | 2d animationdisneybuddy comedyhand drawn animationtraditional animation |
| Themes: | surrealismfriendshipkidnappingabductionadoption |
| Mood: | rainnight |
| Locations: | villagejungleindiajungle book |
| Characters: | friendsingerboygirlhuman animal relationshipbaby boy |
| Period: | 19th century1890s |
| Story: | young boyhappy endingthunderstormchild protagonistlifting someone into the airbooktitle spoken by characterbased on noveldogfightdancingsingingthree word titlefirevoice over narration …rescueriverorphanstrangulationdisguisesnakeanimalnarrationkingtreeactor playing multiple rolesfirst partwildlifebearcross dressingmonkeywolftalking animalelephantblockbusterfaked deathcolonelanthropomorphismbarefootticklinganthropomorphic animalhypnosisblack eyebananamusical numberdeertigerrunning awayjazz musicfruitbare chested boyanthypnotismmale protagonistcactusfriends who live togetherfamous scoretitle same as book10 year oldanimal that acts humanvultureabandoned babysong and danceorangutanpantherwild animalcastle thundersurrogate familyorphan boycartoon bearwolf packtalking birdferal childlead singerblack pantherwild childcroonersinging animalancient ruinshuman animal friendshipbackup singerstorybook in opening shotcartoon wolfinterspecies friendshiptalking bearroaringcartoon elephanthappy go luckywolf cubanimal licking someonecartoon monkeyspiraling eyescartoon tiger10 year old boyhuman bear relationshiptalking snaketalking wolf (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
| Themes: | courageescapesurrealismmurderdeathloverevengekidnappingbetrayalfearmonsterdeceptionseductiondeath of fatherbrutality …supernatural powerredemptionfaithhopeapocalypseblindnessself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
| Mood: | darknesspoetic justiceaustralian supernatural |
| Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guywarrioraction heroex husband ex wife relationshipdeath of girlfriend |
| Story: | fire breathing dragonshieldhelmetskeletondragonlibraryswordbloodviolenceflashbackbare chested malekissfightexplosionknife …chasesurprise endingfirevoice over narrationbeatingcorpsefistfighthorseshot in the chestrescueslow motion scenepunched in the facebattlebrawlfalling from heightshowdownhand to hand combatbeddemonorgycombatdecapitationgood versus evilsurvivalbedroomassassinsword fightambushold manaxemassacremountainbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armyfictional wardouble crossunderwater scenekingcreaturenecklacetransformationone against manycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissionrace against timestatueevil manlightningopening action scenebraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionbow and arrowburned aliveflyingspearassassination attemptbreaking and enteringquestslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footagehaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturegiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
Three pets (Chance, a young dog unfamiliar with the world; Shadow, an aging, wise dog; and Sassy, a snobby cat) are left behind when their family goes on vacation. Unsure of what happened, the animals set out on a quest to find their family. This journey across America is very dangerous and the anim …als risk never seeing their masters again. The group of pets travel across forested mountains and areas of wide-open countryside, while their family searches for them in the same areas. (Read More)
| Themes: | escapefriendshipdysfunctional familywilderness |
| Mood: | affection |
| Locations: | farm |
| Characters: | family relationshipsboygirllittle girllittle boyhuman animal relationshipstepfather stepson relationshipdog actorcat actor |
| Story: | presumed deadjourneybased on noveldogremakerescuecatmountainon the roadrabbitreunionfirst partchickenwaterfallbear …loyaltytalking animalinjuryquestanimal attackveterinariansarcasmfalling into watergrasscross countrydog moviepitturkey the birdgolden retrieverskunkanimal sheltershrimplost in woodspet owner relationshipporcupinemountain lionsierra nevada mountainspet owner reunionboxer doglost pettriangle the musical instrumentanimal escapes pounduse of phrase bad hair day (See All) |
Nim Rusoe is a girl who joins her father, a scientist, when he does research on marine life on an island. It's just the two of them but she spends her time making friends with all the animals she encounters, chatting on the computer and reading the adventure books of Alex Rover. When her father goes … to do some research but when a storm strikes the island he doesn't come back, she gets worried and frightened. She then e-mails Alex Rover hoping that he will come but what she doesn't know is that Alex Rover is a woman who is agoraphobic and germaphobic. But her creation comes to life and eggs her to go. Unfortunately she has never gone anywhere before and is denied her necessities like her sanitary gel by the customs officer at the airport. In the meantime, Nim tries to be strong while waiting for Alex to arrive. (Read More)
| Subgenre: | coming of ageabsurdismslapstick comedyfish out of water |
| Themes: | courageescapesurrealismfearheromemorytravelparanoiapanicnear death experienceobsessive compulsive disorder |
| Mood: | rainnightmare |
| Locations: | beachforesthelicopterairplaneboatbathtubdesertwatertaxiairportwoodsseashiprooftopocean …jungletaxi drivercampfirestormsan francisco californiastorm at seaboat accident (See All) |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboygirldancerwritersecurity guardaustralianamerican abroadsingle fatherhuman animal relationship …ship captain (See All) |
| Story: | treehousewhalepresumed deadlifting someone into the airpiratebookf ratedcharacter name in titlebased on novelflashbackfightdancingphotographchasesurprise ending …telephone callfirevoice over narrationcryingcell phonefoodrescueslow motion scenecomputercamerafalling from heightlettervomitingtearsbedhallucinationislandtelephonescientistsubjective cameraswimmingsurvivalsoccerflashlightcookingmountainvideo cameramontageeatinginternetmapfishradiofishingchild in perilbathunderwater scenetreeauthordangerelectrocutionfantasy sequencecharacter's point of view camera shotactor playing multiple rolesproduct placementstorytellingrace against timesuitcasemissing personreadinglightningisolationloss of mothersingle parentanswering machinefarceheavy raineggmachetequesttouristsurvivorcaptivespiderflatulencesharkhome movietorchfull moonpassportreverse footagefloodtelescopechild's point of viewbraveryinvasionfanmisunderstandinganimated sequenceobesitypower outageevacuationnovelistrowboatlostvolcanoaerial shote mailrainstormcaptureturtlecliffsailorbarbecuelanterndead motherbonfirenewspaper clippingfast motion scenecamelexplorationnovelshipwrecklizardeditorsailboattween girlsailingfish tankimaginary friendseagullhurricanelavawormsouppalm treemotorboatcruise shipclimbing a treesurrogate mothermicroscopewet t shirtmetal detectorgame playingrescue from drowninganimated creditsgolden gate bridgereclusemountain climbingrock climbingtreadmillagoraphobialeg injuryfemale writertropical islandscottish accenthelicopter pilotcoconutseal the animalrole modelvolcanic eruptioncatapultpinatatidal wavealternate worldlifeboatqueenslandbelchingsatellite dishcratersouth pacificwet jeansspyglasswater pumpstarfishlost at seapelicansea lionsolar powertug of warclosing credits sequencetoolswindsurfingsea turtleashwading in watertropicssinking boatcalling parent by first nameport a pottymarine biologistarachnophobiaanimated scenecall for helpmonsoonhomeschoolinghiding in a treeman versus naturespear fishingnational geographic magazineroasted pigsatellite phonecan openerdesolate islandplanktonsecurity checkpointalonenessboatmanbuccaneerhula danceroverboardoceanographerair hostessamerican expatriatesextantflossing one's teethtropical stormfear of spidershand sanitizersatellite telephonewoman girl relationship (See All) |
After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.
| Subgenre: | martial artssword and sorceryepicsword and fantasyhigh fantasy |
| Themes: | escapeghostmurderdeathloverevengebetrayaldeceptionobsessioninsanitygreedself sacrifice |
| Mood: | poetic justice |
| Locations: | forestsnowboatdesertcastlecavewalled city |
| Characters: | father son relationshipfather daughter relationshipbrother brother relationshipbrother sister relationshipsoldiertough guywarrioraction heromayor |
| Story: | cowardwizardshieldpresumed deadhelmetdragonswordbased on novelviolencesequelflashbackdogfightexplosionknife …surprise endingfirecorpseshot to deathhorseshot in the chestshot in the headrescueslow motion scenepunched in the facebattlefalling from heightshowdownhand to hand combatdead bodydemonhallucinationcombatshot in the backdecapitationgood versus evilsurvivalsword fightambushaxemountaindeath of friendthroat slittingbridgearmystabbed to deathstabbed in the chestmapsevered headno opening creditschild in perilfictional warkingcreaturethird partnecklacedrowningstabbed in the backperson on firefantasy sequencestatuetentknocked outrabbittough girlopening action sceneringdeath of brotherpigmercenarysevered armbearrefugeesubtitled scenebattlefieldstylized violencecivil wariceropegolddestinydestructionbow and arrowhead buttspearcageloss of friendloss of loved onetreasurehammercrying womanblockbustergiantjumping from heightpart of trilogyfaked deathknightforbidden lovehonorburialaction heroineanimal attackgoatcrushed to deathfemale warriorbarefootdwarfdual wieldstabbed in the throat3 dimensionalchaosevacuationfalling to deathstabbed in the headstabbed in the legsexy womandeath of loved oneloss of brothermoral dilemmaprequelpipe smokingauctionbatelfinvisibilityanti warreturning character killed offruinsapparitionwoman cryingfemale fightertoweramputeearcherycrownstabbed in the armeaglewoman kills a manfriends who live togethergoblinstabbed in the shoulderfinal battlearcherraveneight word titleshape shifterstabbed in the facecorrupt officialexploding housewoman fights a manshapeshiftinghit with a hammersorceressinfantryjewelcockney accentanimal killingarmorytear on cheekcity hallepic battlescottish accentadaptationbanishmentgold coinjail breaksuit of armorfranchisestabbed in the footcousinarsenalliterary adaptationsecret passagewayhidden doorgiant creaturecatapultanti villainman dressed as a womanmultiple cameosoutnumberedfalling through icebridge collapsebell towerelkballadeerorchobbitmiddle earthacorngiant wormtunicgemstonescepterprequel and sequelgiant birdhogsinger offscreenminstrelrock throwinglive action remakebare foot womansmoking a pipecollapsing bridgefemale archergiant batpeace negotiationgold ringstone bridgewhite magicblack bloodpile of goldarmy on the march (See All) |
Matilda Wormwood is an exquisite and intelligent little girl. Unfortunately, Matilda is misunderstood by her family because she is very different from their ways of life. As time passes, Matilda finally starts school that has a kindly teacher, loyal friends and a sadistic principal. As she gets fed …up with the constant cruelty, Matilda begins to realize that she has a gift of telekinetic powers. After some days of practice, Matilda suddenly turns the tables to stand up to her parents and outwit the principal. (Read More)
| Subgenre: | cult filmblack comedydark comedy |
| Themes: | friendshipangersupernatural powerdysfunctional familyadoptioncruelty |
| Locations: | schoolwater |
| Characters: | family relationshipsfather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipfemale protagonistteacherbabybest friendlittle girlsingle mothervillainteacher student relationshipaunt niece relationshipbaby girl |
| Story: | librarianchild protagonistlifting someone into the airlibrarybooktitle spoken by characterf ratedcharacter name in titlebased on novelone word titlecryingbased on bookcatclassroomcooking …child abusefbidollreadingdirected by starsingle parentflyingdresswoman with glassesfbi agentstealingoverallsvillainessmilkgirl with glasseswatching televisionchild's point of viewmisunderstandingironytime lapse photographythrown through a windowtelekinesisgeniusclose up of eyesforename as titlereading aloudsarcasmmathematicselementary schoolschool principalcottageprincipalblackboardglassfemale heroroller skatingadopted daughtercarrotfemale athleteswingingprecocious childchild prodigyfat womanglobepancakewagonhung upside downcerealfederal bureau of investigationphone bookhula hooplifting a female into the airbraided hairgluefirst day of schoolchalkspellingpsionic powerneglected childribbonchild neglectreference to moby dickadoptive motherhopscotchoverweight childdisbelieving adultsiren the alarmadoptive mother adopted daughter relationshipspinningdedicated teacherprincipal's officechocolate cakelibrary bookthrowing foodroller bladessix year oldchild geniussleepmaskbad parentssupergluecharacter calls female sirhair ribbonshot putbad parentingegg beatermunich olympicsnewtfirst grade teacherhammer throwreference to ishmaelteaching oneself to read (See All) |
Inventor Gepetto creates a wooden marionette called Pinocchio. His wish that Pinocchio be a real boy is unexpectedly granted by a fairy. The fairy assigns Jiminy Cricket to act as Pinocchio's "conscience" and keep him out of trouble. Jiminy is not too successful in this endeavor and most of the film … is spent with Pinocchio deep in trouble. (Read More)
| Subgenre: | fairy tale2d animationdisneybased on fairy tale |
| Themes: | magic |
| Mood: | rainnight |
| Locations: | boatseaitaly |
| Characters: | father son relationshipboy |
| Period: | 19th century1880s |
| Story: | magic wandyoung boywhalelifting someone into the airbooktitle spoken by charactercharacter name in titlebased on novelone word titledancingsingingfirecryingmirrorcat …liebeerislandcandlefishchildunderwater scenespankingcigar smokingtransformationpuppetumbrellablockbusterpoolfaked deathcarnivalappleanthropomorphismstarunderage drinkingfairytitle appears in writingbilliardswishsmokecoinlyingdonkeyforename as titlefoxgoldfishmetamorphosisconsciencealtered version of studio logounderage smokingfamous scorestarssnoringcarriagehuman becoming an animalreading a letterwish fulfillmentstudio logo segues into filmmarionettesneezingpadlocknosepuppeteerrotoscopingpinocchiocuckoo clockcricket the insectjackassschool kidsmona lisafishbowlswallowed wholepuppet theaterafipet fishanthropomorphic toycagedevil smilestorybook in opening shotwishing on a starhitting oneselfanthropomorphic insectsplashing water on one's faceblowing one's nosecharacter turns greenwirelessjiminy cricketanthropomorphic foxtalking foxunable to sleep (See All) |
Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.
| Subgenre: | martial artssuperheroabsurdismepicslapstick comedydark fantasyscience fantasylive action and animation |
| Themes: | courageescapesurrealismmurderdeathrevengekidnappingbetrayalfeardrunkennessmonsterdeceptionbrutalitysupernatural powerredemption …celebritysadismalcoholismpanicapocalypsedisabilityrevolutionself sacrificespace travelprison escapenorse mythology (See All) |
| Locations: | new york citybarchurchforestelevatorvillagewoodsouter space |
| Characters: | father son relationshiptattoobrother brother relationshipbrother sister relationshipzombiesoldieralienhostagetough guywarrioraction heroalcoholicvillaincousin cousin relationshipfather …alien monster (See All) |
| Story: | fire breathing dragonshieldhelmetskeletondragonbookswordtitle spoken by charactercharacter name in titleviolencesequelflashbacktwo word titlebare chested malefight …explosionknifechasesurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightbased on comicshowdownheld at gunpointbeerhand to hand combatdemonriverfightingcombatdecapitationgood versus evilsurvivalfoot chasesword fightbased on comic bookambushname in titleaxemassacremountainbasketballbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestweapontied to a chairsevered headdisarming someoneone man armyfictional wardouble crossspaceshipunderwater scenecreaturefemme fatalethird parttransformationtalking to the cameraon the runduelattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissionrace against timestatuecover upkicked in the facetough girllightningopening action scenebraceletscene during end creditsmanipulationspeechexploding bodythreatbrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadbattlefieldprincestylized violencestrong female characterhenchmanapplausedestinywolfdestructionbow and arrowflyingracehead buttspearelectronic music scoresociopathbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplanetblockbustereccentriccamprebeljumping from heightclubskullrebellionknightlaserhomeaction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footagecameohaunted by the pastvisionbootsbraveryfight to the deathdual wieldimpostorsonmercilessnesschaosresurrectiondeath threatevacuationprophecyescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault rifleknife fightwisecrack humorhologrambounty huntereye gougingcapturearmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemfinal battlecrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwoman murders a manwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All) |
A beautiful, pure-hearted young woman, Maleficent has an idyllic life growing up in a peaceable forest kingdom, until one day when an invading army threatens the harmony of the land. Maleficent rises to be the land's fiercest protector, but she ultimately suffers a ruthless betrayal - an act that be …gins to turn her pure heart to stone. Bent on revenge, Maleficent faces a battle with the invading king's successor and, as a result, places a curse upon his newborn infant Aurora. As the child grows, Maleficent realizes that Aurora holds the key to peace in the kingdom - and perhaps to Maleficent's true happiness as well. (Read More)
| Subgenre: | fairy taledark fantasybased on fairy tale |
| Themes: | betrayalmagicredemptionfirst love |
| Locations: | forestfrancecastle |
| Characters: | father daughter relationshipteenage girlfemale protagonistlittle girlwitchevil witchrevenge motive |
| Story: | fire breathing dragonfairy godmothercrowshielddragontitle spoken by characterf ratedcharacter name in titleone word titlekissface slapassassinarmyno opening creditschild in peril …kingprincessnecklacecursegiftbattlefieldbirthday cakewolfflyingmutilationwitchcraftvillainessfairyfemale lead3 dimensionalfirst kisskingdomdaggersunsetneedleteenage loveborder crossingtrue loveno title at beginningcottage16 year oldelectric shockfall from heightmetamorphosisscarecrowaltered version of studio logoravenshape shifterclumsinesstear on cheekvillain turns goodwingsadaptationmagical powerfalling off a clifffall to deathliterary adaptationcoronationironcaught in a netuninvited guestchristening14th centurymagical creaturehornsspellcastingprince charmingheaddresssleeping beautyretellingrolling down a hillevil spellfairy tale landscenic beautywinged dragonmonarch butterflyfawnback hand slapfinger ringmud fightprostheticmad kingknight in armortree creature (See All) |
The once hideous ogre Shrek is now living a good life with wife Fiona and his three children. But he soon has a meltdown in front of them and his friends during his kids' birthday party. He suddenly wants to be a real ogre like he was before he ever met Fiona. So he turns to devious deal maker Rumpl …estiltskin for help. At first, Shrek lives the life he once lost and everything is good. But he soon finds out that he has been set up by Rumplestiltskin, who now rules the land with an ironed fist. Teaming with friends Donkey, Fiona and Puss in Boots, Shrek is in for the fight of his life as he tries to get his life back before time runs out. (Read More)
| Subgenre: | fairy talecgi animationfairy tale parody |
| Themes: | friendshipdanceheroredemption |
| Locations: | castle |
| Characters: | friendbabywarriorbest friendvillainwitch |
| Story: | fire breathing dragonlifting male in airhappy endingshielddragoncharacter name in titlesequelkissbased on bookmirrorcatbattlebirthdaycombatambush …birdkingprincessduelcursepuppetpigqueenbirthday cakewolfslow motiontalking animalcakequestmousehunterfourth partfrogfemale warriorresistance3 dimensionalswamp3ddungeonbounty hunteralternate realityarmorkingdomcontractpetsidekickdonkeysunsetfluteselfishnesstrue lovefilm starts with textcookiechandeliereyeballleadergladiatorpitchforklifting person in airbreakdancetear on cheekgoosemartinistarts with narrationfathorse drawn carriagedealdecoylordogrecupcakecartouthousestory continued during end creditsalternate worldpinocchiomagical mirrorhalf breedhuntedline dancingcomic sidekickgingerbread manwanted3d sequel to 2d filmmud bathshrektrojan horselazypuss in bootsroartripletgingerbreadexploding animalchanging a diaperfar far awaydeal makingungrateful father (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
| Subgenre: | cult filmmartial artstragedysword and sorceryepicsword and fantasy |
| Themes: | courageescapemurderdeathlovefriendshiprevengekidnappingpregnancytortureweddingmonsterherodeceptionmagic …memorydeath of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeance (See All) |
| Mood: | rain |
| Locations: | forestvillagewoodsfarmlakecastle |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guywarrioraction herovillainuncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All) |
| Story: | crowwizardpresumed deadlibrarybookswordbloodviolenceflashbackkissfightexplosionknifechasefire …cryingblood splatterfoodhorserescueslow motion scenebattlefalling from heightshowdowntearshand to hand combatrunningneighborcombatsubjective cameragood versus evilsurvivalwinecandlesword fightaxemassacremountainstabbingthroat slittingbridgeeatingarmymixed martial artsprisonermapdisarming someonefictional warkingprincessnecklaceduelgraveattackpoisonninjapassionreadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralbattlefieldchild murderdestinybow and arrowspearmachetecaptivestabbed in the stomachwitchcraftgenocidehonorburialslaverampagetelescopethunderbraveryloss of sonbased on video gameshovelmedieval timespridedungeoncapturearmorraidsiegelieutenantkingdomsword duelblack magictelekinesissmokedaggerimprisonmentheroismpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downsorcererfantasy worldsword and sandalheirclimbing a treetitle in titleflamearcherdeath of grandmotherfacial scarsorceryman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekshot with a bow and arrowbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
After being trapped in a jungle board game for 26 years, a Man-Child wins his release from the game. But, no sooner has he arrived that he is forced to play again, and this time sets the creatures of the jungle loose on the city. Now it is up to him to stop them.
| Subgenre: | fish out of water |
| Themes: | couragesurrealismfriendshipmagictime travelfirst lovemissing child |
| Mood: | breaking the fourth wall |
| Locations: | beachforestmotorcyclecemeterysmall townjungleabandoned factorybicycle chase |
| Characters: | family relationshipsfather son relationshipmother son relationshipmother daughter relationshipbrother sister relationshippolice officerbullypsychiatrist |
| Period: | 1990s1960s19th century20th centurychristmas party1860syear 1969 |
| Story: | presumed deadlifting someone into the airlibrarymansiontitle spoken by characterone word titlesurprise endingcar accidentshotgunarrestrifleheld at gunpointhandcuffsrevolverriver …orphanaxebridgeapologyno opening creditschild in perilhit by a carunderwater sceneconfessionprologuefactoryactor playing multiple rolesconvertiblesubtitled scenemonkeyfireplaceheavy rainelephanthunteroverallsblockbustercgianimal attackearthquakerampagefloodstealing a carconstruction sitechaostime lapse photographylionatticrefrigeratormutationbullet timebatimpersonating a police officerhiding in a closetcrocodiletween girlshoefriends who live togetherboard gamefather son reunionmotorcycle coprecluseimprovised weaponbased on children's bookanimal killingloss of parentsrainforestlootinggiant spiderhuman becoming an animalrhinocerossanta claus suitauto theftmosquitogiant insectchestzebraexterminatorvortexnew hampshirequicksandstampedegun storetailconveyor beltaltering historypelicaninvestment bankertrailer narrated by hal douglasmonsoonsporting goods storepoison ivybig game hunterinsect attackcarnivorous plantyear 1869dybbuk boxcar through wallanimal driving a cartrailer narrated by nick tate (See All) |
An English librarian called Evelyn Carnahan becomes interested in starting an archaeological dig at the ancient city of Hamunaptra. She gains the help of Rick O'Connell, after saving him from his death. What Evelyn, her brother Jonathan and Rick are unaware of is that another group of explorers are …interested in the same dig. Unfortunately for everyone, this group ends up unleashing a curse which been laid on the dead High Priest Imhotep. Now 'The Mummy' is awake and it's going to take a lot more than guns to send him back to where he came from. (Read More)
| Subgenre: | martial artsswashbuckler |
| Themes: | escapesuicidereligionprisondrunkennesshero |
| Mood: | car chasehorror movie remake |
| Locations: | airplanedesertshipairplane accidentairplane chase |
| Characters: | brother sister relationshippriestaction heroamericanamerican abroadbabe scientist |
| Period: | 1920s |
| Story: | cowardlibrarianlibrarybookswordtitle spoken by characterbloodviolencetwo word titlegunkissknifechasepistolfire …shootoutshot to deathblood splatterfistfighthorsemirrorremakecatbattlegunfightbrawlshowdownhand to hand combatrevolverfightingcombatsword fightambushmixed martial artsmapno opening creditsanti herodisarming someonekingcurseperson on firehangingglassesfirst partsevered armundeadpowerhead butttreasureblockbustertorchearthquakeguardreverse footagesanddual wieldegyptprophecyenglishdynamitedaggercameltombburied alivemummyfireballplaguesecret societygramophonecrash landingpyramidchainedbriton abroadancient egyptbiplaneshoulder holsterangry mobeclipsecolt .45secret doorcairo egyptstudio logo segues into filmbalisongsandstormbolt action riflenorth africasevered tonguespit takeswordplayhidden treasurepharoahprotectorbritish womanancient civilizationbritish mancavalry chargeegyptologyfortune hunterancient culturelost cityregicidelocustpublic hangingsaved from hangingancient bookforeign legionancient religioncolor remake of black and white filmfliesamerican manscarabancient curseancient textveiled womanancient burial groundgiza egyptegyptian curseriver of bloodbiblical plagueshuman versus undeadparasite underneath skinancient ritualegyptian mummyancient architecturehonorable death (See All) |
Soren, a young barn owl, is kidnapped by owls of St. Aggie's, ostensibly an orphanage, where owlets are brainwashed into becoming soldiers. He and his new friends escape to the island of Ga'Hoole, to assist its noble, wise owls who fight the army being created by the wicked rulers of St. Aggie's.
| Subgenre: | cgi animation |
| Themes: | courageescapekidnappingbetrayalherounlikely hero |
| Characters: | brother brother relationshipbrother sister relationshipsoldier |
| Story: | librarianhelmetjourneybased on novelpunctuation in titleplace name in titleanimal in titleapostrophe in titlegood versus evilsnakeno opening creditskingtreequeenslow motion …talking animalorphanageanthropomorphism3 dimensionalarmorowlflightnannywormfeatherbird in titleblacksmithstudio logo segues into filmbrother versus brotherrulerbrother against brotherbarn owlheroic deedsnowy owl (See All) |
A young neurosurgeon (Gene Wilder) inherits the castle of his grandfather, the famous Dr. Victor von Frankenstein. In the castle he finds a funny hunchback called Igor, a pretty lab assistant named Inga and the old housekeeper, frau Blucher -iiiiihhh!-. Young Frankenstein believes that the work of h …is grandfather is only crap, but when he discovers the book where the mad doctor described his reanimation experiment, he suddenly changes his mind... (Read More)
| Subgenre: | cult filmhorror spoofmadcap comedy |
| Themes: | kidnappingmarriagemonstertheatrepanicblindnesscheatinginheritance |
| Mood: | spoofnightmareparodybreaking the fourth wallwedding night |
| Locations: | traincemeteryvillagewoodscastleusalaboratory |
| Characters: | husband wife relationshippolicepolice officerstudentlittle girlprofessorcheating on one's girlfriend |
| Period: | 1970s1940s1930s |
| Story: | lifting male in airthunderstormmad scientistlifting someone into the airskeletonlibrarybookcharacter name in titlebased on novelsex scenedancingsingingsurprise endingcorpsehorse …mirrorblondepaintingjailclassroomscientistcleavagecandlestrangulationcoffincreaturecigar smokinggraveperson on firelightninghangingtrappremarital sexratstagecabinflowerexperimentdestinyfireplacefarcehypodermic needlegothicblockbusterskullbriderailway stationviolintorchfull moonburglaryhit in the crotchtheatre audiencesketchfrustrationdungeonfogsexy womancapturehousekeeperblind mangadgetpolice inspectorsurgeonbrainflat tireviolinistirreverencefianceejournallecturemakeoverwellgramophonescalpelassistantblackboardgiving a toastsoupkitefriends who live togetherchainedorchestral music scoresmall breastsnewlywedhorse and wagonhermitsecret passagereference to charles darwinvillagerlifting person in airhunchbackfrankenstein's monstertap dancinggrave diggingsittingjail breakportrait paintingmedical experimentphonograph recordhornreanimationtransylvaniaturbanprosthetic limbgallowsmedical schoolgrandfather clockhowlinglifting an adult into the airblowing a kisscaught in a netdartsedativespit takename changebattering ramcastle thundersearch partygrave robbingashtrayone armed manmusic hallbookcasecharadescobweblecture hallreference to gary coopertown meetingprosthetic body partbrain transplantcreator creation relationshipplaying with foodseesawmusical sequence in non musical workdoor knockerknife in the thighstabbing oneselfsadistic prison guardshoeshine boyexpression taken literallymedium breastswipemob scenefrankenstein spoofprivate librarywartsilly walkmoving bookcase (See All) |
Oscar Diggs ('James Franco'), a small-time circus magician with dubious ethics, is hurled away from dusty Kansas to the vibrant Land of Oz. At first he thinks he's hit the jackpot-fame and fortune are his for the taking. That all changes, however, when he meets three witches, Theodora ('Mila Kunis' …(qv)), Evanora ('Rachel Weisz' (qv)), and Glinda ('Michelle Williams (I)' (qv)), who are not convinced he is the great wizard everyone's been expecting. Reluctantly drawn into the epic problems facing the Land of Oz and its inhabitants, Oscar must find out who is good and who is evil before it is too late. Putting his magical arts to use through illusion, ingenuity-and even a bit of wizardry-Oscar transforms himself not only into the great and powerful Wizard of Oz but into a better man as well. (Read More)
| Subgenre: | slapstick comedyfish out of watersteampunkchrist allegory |
| Themes: | courageescapesurrealismlovefriendshiprevengekidnappingbetrayaljealousyfeartorturedeceptionmagicsupernatural powerredemption …faithhopefreedomnear death experienceunlikely herocheating death (See All) |
| Locations: | forestcemeterywoodswheelchaircastlestormwalled city |
| Characters: | family relationshipsgirlsoldierhostagesister sister relationshiplove trianglewitchengineerevil witch |
| Period: | 1900s |
| Story: | magic wandcrowwizardpresumed deadjourneykissdancingexplosionsingingknifechasefirehorserescuebattle …falling from heightshowdownrivergood versus evilfoot chaseorphanambushaxedisguisemontagearmymapfalse accusationanti herofictional wardouble crosscreaturefemme fatalegraveyardprincessnecklacetransformationon the runattempted murderscreamingclownelectrocutionattackstorytellingstatueknocked outlightningmanipulationscargiftloss of fatherwaterfallflowerfireworksmonkeybattlefieldhatecircusgoldfalling down stairsrevelationflyingspearlooking at oneself in a mirrortalking animalquestcatfightagingmagiciantreasurehidingwitchcraftvillainesseccentricservantjumping from heightfaked deathcarnivalanimal attackbroken legapplecannonfull moonanthropomorphismbraveryfairyimpostorpower outageevacuationprophecyimmortalityexilecon artistlionthrown through a windowfogcapturekingdomsmokepalacerocketcon manillusionmagic tricklevitationhit in the facestrongmanfireballfilm projectorcrowntornadocornfieldcrash landingreluctant herofall from heightscarecrowtrumpetbroken heartcapesewing machinechainedmeteorhot air balloonmusic boxkansasgrudgefake moustacheforce fieldthronetop hatbanishmentgold coinbubblecrystal ballzero gravitystowawayguerilla warfarevisionarygunpowderleather pantsgluespear throwingalternate worldcoin tossprojectionwizard of ozchariotmagician's assistantfighting in the airtwo sistersreference to thomas edisonmagical ringflying broomorigin storywandcharlatanreference to houdinigreen skinoptical illusionozsleight of handdark forestpoison appleshowmanblack hatbroomstickporcelainyear 1905heir to throneflying monkeyred hatgood witchmunchkintalking monkeyconcealing the truthblack cloaklife debtpoppy fieldgoing over a waterfallhole in floorwitch hat (See All) |
It's been five years since Hiccup and Toothless successfully united dragons and vikings on the island of Berk. While Astrid, Snotlout and the rest of the gang are challenging each other to dragon races (the island's new favorite contact sport), the now inseparable pair journey through the skies, cha …rting unmapped territories and exploring new worlds. When one of their adventures leads to the discovery of a secret ice cave that is home to hundreds of new wild dragons and the mysterious Dragon Rider, the two friends find themselves at the center of a battle to protect the peace. Now, Hiccup and Toothless must unite to stand up for what they believe while recognizing that only together do they have the power to change the future of both men and dragons. (Read More)
| Subgenre: | cgi animation |
| Themes: | deathrevengedeath of fatherself sacrifice |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipwarrior |
| Story: | helmetdragonjourneysequelsingingrescuesecond partcompetitionno opening creditsdeath of husbandsacrificeloss of loved one3 dimensionalvikingno title at beginning …whistlingflaming arrowfuneral pyresanctuaryblowgunhuman flight (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
| Subgenre: | conspiracyabsurdism |
| Themes: | escapekidnappingmoneyfearmagicangerdeath of fathersupernatural powerdeath of motherabductioncrueltypanicmissing child |
| Locations: | beachrestaurantschoolhotelsnowsmall townbicycletaxielevatorkitchenpolice carenglandocean |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipdoctorgirlpolice officerpolicemanbabylittle girllittle boymaid …witchgrandmother grandson relationship (See All) |
| Story: | tree houseyoung boytreehouselifting someone into the airbased on novelsingingsurprise endingcryingbased on bookunderwearrescuecatmaskpaintingtears …runningbirthdaysubjective cameragood versus evilfoot chaseorphanbedroomcandlemountaindisguisesnakechildradiodrawingchild in perilsearchcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationmissing personscreamspeechdisappearancepursuitwiggiftexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeeyeglassesapplauseeavesdroppingtalking animalcakecagefaintingcomic bookhatcookmousehidingwitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleaverhandcashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childbaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All) |
| Subgenre: | coming of agemartial artsblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | courageescapesurrealismmurderdeathfriendshiprevengekidnappingmoneybetrayaljealousyprisonfearfuneralmonster …deceptionmagicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | forestboatlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | giant squidshieldeaten alivehelmetswordtitle spoken by charactercharacter name in titlebloodviolenceflashbackdogbare chested malefightexplosionknife …chasesurprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditsslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveguarddwarfreverse footagecameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodyashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com