Please wait - finding best movies...
When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true. β¦When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)
Subgenre: | puppet animationdark fantasystop motion animationstop motioncult film |
Themes: | theatredeath of motherlonelinessangermonsterfearghostkidnappingsurrealism |
Mood: | movingnightmarerain |
Locations: | tunneltexaswoodsbicycleboatmotorcyclesnowforest |
Characters: | disappearance of one's fatherlittle boymermaidgrandmother grandson relationshiplittle girlactressfemale protagonistboysingerfather daughter relationshipmother daughter relationshiphusband wife relationship |
Story: | cat and mousedowsing rodeye cut outknitting needlemoving crewcotton candymoving vantea leavessearch for parenttheatre productiontheatre audienceplayer pianotalking catpet catbreaking mirror β¦mirror as portallaptop computerghost childstuffed toy dogblowing a raspberrywell shaftskipping stonemechanical handpoison oakseashell bikinitoy chestgarment buttonhigh divebig toppeeling skindowsinglorgnettecataloguepraying mantisold mansionparallel worldsthreadhummingbirdstuffed animal toyvoidspiderwebtoy trainslugalternate worldwallpaperfortune tellingnew hometrapezemilkshakeshakespearean quotationwalkerlemonadesecret doorblue hairsnowglobehorror for childrenhide and seekbeetleclothing storespotlightsecret passagebechdel test passedfantasy worldgame playingriddlesewingrainboworegonclueacrobatmichigancheesemetamorphosissleepbugspiral staircasebicyclingold dark houserunning awaystuffed animaleyeglovesforename as titleneedlecandyreflectionbatpajamascanepet dogbalconyscene after end creditsfogshadowparachutethunderstormscissorschild protagonist3 dimensionalinsectimpostorticklingthundercorsetcannoneccentriclifting someone into the airmousetalking animalcakefireplaceteaeyeglassescircuspizzareference to william shakespearesleepinggardenstageratdisappearancepianistflowerslightningtentdollsuitcaseangelbuxomkeyold womansearchdinnereatingcandleflashlightbedroomorphanprayerpianoneighbortearslettercameracatcomputerrescuemirrorfooddreamsongcell phonecryingvoice over narrationsingingtitle spoken by characterphotographcharacter name in titleone word titlebased on novelblooddog (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
Subgenre: | conspiracyabsurdism |
Themes: | death of motherangerfearkidnappingmoneyescapemagicdeath of fathersupernatural powerabductioncrueltypanicmissing child |
Locations: | bicyclesnowbeachrestaurantschoolhotelsmall towntaxielevatorkitchenpolice carenglandocean |
Characters: | little boygrandmother grandson relationshiplittle girlboyfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipdoctorgirlpolice officerpoliceman β¦babymaidwitch (See All) |
Story: | pet catmetamorphosisbicyclingeyeglovescandylifting someone into the airmousetalking animalcakeeyeglassesstagedisappearanceold womansearch β¦candlebedroomorphantearscatrescuecryingsingingbased on novelsurprise endingbased on bookunderwearmaskpaintingrunningbirthdaysubjective cameragood versus evilfoot chasemountaindisguisesnakechildradiodrawingchild in perilcigar smokingtransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationmissing personscreamspeechpursuitwiggiftexploding bodyloss of fatherblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeapplauseeavesdroppingcagefaintingcomic bookhatcookhidingwitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingface masknotebookbirthday presentcheering crowdshoelistening to radiocabin in the woodssoupconventionmeat cleaverhandtreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalyoung boyrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childtree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All) |
When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa β¦rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)
Subgenre: | puppet animationstop motion animation |
Themes: | monsterfeardeathgrief |
Mood: | rain |
Locations: | bicycleswimming poolcemeterysmall townpolice carbaseballsewer |
Characters: | little boylittle girlhusband wife relationshipfather son relationshipmother son relationshipteacherstudentbabymayor |
Story: | pet cathorror for childrenbatpet dog3 dimensionalthunderstageratlightningdollsearchcandleflashlightneighbortears β¦catrescuecryingsingingphotographone word titledogexplosionfirecorpsewatching tvsecretrunningclassroomscienceambulancecoffindrawinghit by a carcreaturegravemicrophonesuburbumbrellabaseball batscreamspeechnewspaper headlinerecord playerexperimentapplauseballoonwatching a moviespiderlifelossphone boothfrogaudiencehome moviecarnivaltorchfull moonpromiseshovelaquariumturtlechainuncleposterfiremantombenergyelectricitynotebookgategiant monsterfencepopcornelementary schoolgoldfishbellblackboardbaseball gamekitebased on short filmfrankensteinbackyardwindmillroller skatesgravestoneanguishpigtailsmovie cameradog moviebaseball fieldfairslimearm slinghunchbackangry mobphonograph recordreanimationfairground3 dmovie projectorexhumationniececadaverloftbanneromenscience experimentspeakerclotheslineumpiregrave robbingscreenauditoriumbaseball gloveremake by original directorscience teacherschoolhousebaby strollerscience fairbaseball pitcherscience projectnerd boydeath of a petsurgical stitchesvacuum cleaningmanhole coverpet cemeteryfrench poodleback to lifefrankenstein spoofboltelectric kiss (See All) |
Pre-teen Jeliza-Rose's parents are hopeless drug addicts. When pa, rocker Noah, finds ma's OD'd, he fears to be charged with homicide and takes Jeliza along to his ma's place, in a desolate country region. With Noah passed out, the girl mentally transfers to a fantasy world she and her doll heads en β¦ter magically. Jeliza's adventures also star the crazy locals, notably Dell, and Dell's grown but intellectually disabled brother Dickens. (Read More)
Subgenre: | dark fantasycult filmindependent filmfairy talebased on fairy talemodern fairy tale |
Themes: | death of motherlonelinessfearsurrealismdeathpregnancydrinkingdeath of fathersupernatural powerdrug usedysfunctional familyinsanitymental illnessabusedeath of wife |
Mood: | nightmareavant garde |
Locations: | bartrainbusrural settingkitchenfarmsubmarineschool bus |
Characters: | boysingerfather daughter relationshipmother daughter relationshipfamily relationshipsboyfriend girlfriend relationshipbrother sister relationshipgirlmusicianreference to godgrandmother granddaughter relationshipfrench kiss |
Story: | lemonadefantasy worldbugold dark housestuffed animaleyeshadoweccentrictalking animalsleepingdollsuitcaseeatingflashlightorphan β¦prayerpianomirrorfooddreamsongsingingphotographbased on novelbloodsexflashbackkisscigarette smokingexplosionknifefirebeatingcorpseurinationdrinksecretfalling from heightpaintingbookvomitingriflesunglassesrunningbeddead bodyhallucinationguitarswimmingbandstabbingrock bandchild in perilritualunderwater scenevoice overtreedrug addictscreamingpuppetfantasy sequencestorytellingreadingrabbitdomestic violencescarwigcrossrock 'n' rollisolationloss of fatherloss of mothercult directorheroinheart attackflirtingpickup truckhypodermic needlefaintingguitaristdenmarkdrug abuseflatulencesharkskullfalse identitypeeping tomdrug overdoseimaginationrock concertinnocenceshoeswhipjunkiemakeupdynamiteatticlipstickalternate realitywedding dressfamily dinnerlanternfieldpumpkinshaved headbrainsouthern accentminingface maskdinner partymummynecrophiliapedophiliadead fathermental retardationabandoned housebeefarmhousetween girlsquirrelimaginary friendwhisperinglistening to a radioelectric guitaranttrain trackstrain ridepieseizurecleaningfart jokerock musicianheroin addictaltarman childepilepsyclose up of eyedelivery boyalice in wonderlandwingspillow fightchildhood sweetheartrocking chairwagondutch anglecar wreckdecomposing bodymirror ballpassenger traintreasure chestapplying makeuptaxidermymousetrapprairiefireflygrave diggerpinatapeanut buttershooting uplobotomyspider webcandy bardissectiontrain wreckpretendinggeesechild neglectphalluswatchingapple piereference to alice in wonderlanddesecrationembalmingdeath by overdosetrain derailmentwonderlandtransistor radioexploding trainfeather boajutlandtalking dollreference to barbie the dollscrubbingalonenessplaying dress upshotgun shellurinating on the groundburritodead treementally handicapped personrabbit holebroken dollpillow feathersspasticdoll's headribcagehead scarlightning bugcrushed skullfalling off a bedswim fins (See All) |
The teenager Sarah is forced by her father and her stepmother to babysit her baby brother Toby while they are outside home. Toby does not stop crying and Sarah wishes that her brother be taken by the Goblin King. Out of the blue, Toby stops crying and when Sarah looks for him in the cradle, she lear β¦ns that he wish was granted and the Goblin King Jarethhas taken him to his castle in the Goblin City in the middle of a labyrinth. Sarah repents an asks Jareth to give Toby back; but the Goblin King tells that she has to rescue her brother before midnight, otherwise Toby will be turned into a goblin. Soon Sarah teams up with the coward goblin Hoggle, the beast Ludo and the knight Didymus and his dog Ambrosius in her journey. Will they rescue Toby in time? (Read More)
Subgenre: | cult filmcoming of agesword and sorcerysteampunk |
Themes: | angermonsterfearkidnappingsurrealismfriendshipbetrayalmagicforgivenessmythology |
Mood: | rain |
Locations: | woodsforestcastlecavecampfirestorm |
Characters: | father daughter relationshipfriendteenage girlgirlbabycrying baby |
Period: | 1980s |
Story: | fantasy worldriddlemetamorphosispet dogthundercannonlifting someone into the airgardenlightningtentsearchcandletearscatrescue β¦mirrordreamsongcryingsingingtitle spoken by characterphotographone word titledogdancingfireurinationslow motion scenebattleswordmaskbookrunningriversubjective cameragood versus evilsnakechild abusechildkingcreaturejourneytransformationlegendcostumepuppetrace against timebraceletringactor shares first name with charactertrapbrothertied upchickensisterrockropeundergroundelectronic music scorequestbabysitterhelmetcaptivetoygiantladderknighttorchclockcelebrationfull moonguardwindbraveryfairystairslaughterlionlipstickarmorgrowing upwishfortune tellerowlweathermemory lossspelljewelrystrugglegatejunkyardmazeselfishnesswallstepmotherbeast16 year oldsorcererbellwormfemale heromissingeyeballtrollgoblincowardsiblingtrapdoorcockney accentthe muppetsalice in wonderlandpitsnoringlabyrinthsittingcrotch shotbattle axecrystal ballwish fulfillmentmasqueradeperilmorphingbad smellclock towervirtual setlancelifting a male into the airpeachfantasy lifesentrymasked ballactor voicing multiple charactersgownmasquerade partycitadelbogtrumpeterdoor knockerfoot bridgebulgerevulsionescher stairwayactress voicing multiple charactersoubliettebaby cribpea shootertalking worm (See All) |
Alice, an unpretentious and individual 19-year-old, is betrothed to a dunce of an English nobleman. At her engagement party, she escapes the crowd to consider whether to go through with the marriage and falls down a hole in the garden after spotting an unusual rabbit. Arriving in a strange and surre β¦al place called "Underland," she finds herself in a world that resembles the nightmares she had as a child, filled with talking animals, villainous queens and knights, and frumious bandersnatches. Alice realizes that she is there for a reason--to conquer the horrific Jabberwocky and restore the rightful queen to her throne. (Read More)
Subgenre: | dark fantasyfairy talefish out of waterlive action and animationhigh fantasy |
Themes: | angermonsterfearsurrealismmarriageescapemagicinsanityexecutionself sacrifice |
Locations: | woodsforestlondon englandshipcastlechina |
Characters: | little girlfemale protagonistfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipteenage girlsoldierdancermythical creature |
Period: | 19th century1800s1870s |
Story: | talking catfantasy worldriddlebalcony3 dimensionalimpostorlifting someone into the airmousetalking animalcakegardenflowerslightningkeycandle β¦pianocatcomputerdreamcharacter name in titlebased on noveldogf ratedflashbackkissfightdancingpartyfirehorseface slapslow motion scenebattleswordpaintinglierunninghallucinationhandcuffssubjective cameradecapitationsword fightmansionarmyprisonermapfishsevered headno opening creditsbirdpainteranimalfictional warjourneymarriage proposalnecklaceflash forwardattempted murderliaractor playing multiple rolesdragonrabbitpigfirst parttwincult directorqueenmonkeychesssisterdestinyspearwoundquesthatblockbusterfrogtorchclockcelebrationfemale warrioranthropomorphismimaginationtelescopebootsfananthropomorphic animalprophecysibling rivalryenglishrosebutterflyengagementeye gougingknife throwingstabbed in the eyeeye patchpuppyhorse and carriageteleportationcrowdhorseback ridingvictorian erabeheadinginvisibilitywedding ceremonyruinsdoubtstairwayestatecrownhuntpocket watchfallingeyeballmushroompotiondisembodied headwindmillcoderepeated linereturning homepsychotronic filmtalking dogslapalice in wonderlandthronetop hatred hairvulturecanceled weddingsailing shippower strugglecaterpillarimplied nudity19 year oldscrollbanishmentsuit of armorlordfalse namehedgehogjugglershrinkingcandelabrared rosemagical potionmagical swordbased on young adult novelexecutionerfireflyscarred facefire breathing dragongazebotea partykeyholeempressengagement partyplaying cardsame actor playing two characterswhite rabbitevil queensentenced to deathflamingokilled with a swordlisprocking horseharehookahteapotcocoondrawbridgemonarchwhite rosethe color redwardrobe malfunctionfalling into a holefemale slaps maleblowing smoke in someone's faceknife in handprosthetic body partbloodhoundmonocletalking horsebugleflock of birdslive action remakemoatsedan chairtrumpetersudden change in sizemanaclessugar cuberose gardenchanging sizetree stumpdragonslayerfake noseforced perspectivemad hatterfantasy landdodogrowing in sizelawn partyopening creditsoverweight boyrabbit holetalking mouseanimal wearing clothesanthropomorphic flowercheshire catlewis carrollqueen of heartsrose bushtartblowing one's nosedomino fallbig headtalking animalstalking frogaccidental nuditycolor in character's namefalling down a holegap toothedlawn croquetbattle for thronejabberwockyleg chainsred queenhead huntinglive action adaptationmistaking reality for dreamrivalry over throneslaying a dragontalking flower (See All) |
The story of Seita and Satsuko, two young Japanese siblings, living in the declining days of World War II. When an American firebombing separates the two children from their parents, the two siblings must rely completely on one another while they struggle to fight for their survival.
Subgenre: | tragedysemi autobiographical |
Themes: | death of motherlonelinessfearghostsurrealismdeathfriendshipmoneymemoryrobberytheftdeath of fatherillnessdyinghomelessness β¦starvationradiation (See All) |
Mood: | nightmarerainanime |
Locations: | bicycleboathospitalbeachtrainschoolcemeteryairplanebathtubwaterjapanshiptruckstormtrain station β¦fire station (See All) |
Characters: | boysingermother daughter relationshipfather daughter relationshipfamily relationshipsfather son relationshipmother son relationshipteenagerfrienddoctorchildrenbrother sister relationshipteenage boygirlphotographer β¦thiefjapanesemothercousin cousin relationshipaunt niece relationshipaunt nephew relationshipjapanese soldier (See All) |
Period: | world war two1940syear 1945 |
Story: | bugcandyscissorsinsectsleepingdolleatingorphanneighbortearslettercameracatfoodsong β¦cryingvoice over narrationsingingphotographbased on novelbloodflashbackexplosionthree word titlebased on true storyfirebeatingcorpsehorseurinationundressingbombrunningdead bodyswimmingsurvivalbandsubwayapologybirdbathgraveyardgravetreeattackumbrellareadingdeath of childringfarmercountrysideflowerfireworksrecord playersisterdisastericedestructionmedicineinjuryrecordingtold in flashbackstealingfrogtorchburialjanitortokyo japaninnocencebombingshoesfanhungerdead childdaydreamdeath of sisterswingraidmineduckhorse and carriagepumpkinpost world war twoanti warruinscremationbandageelementary school14 year oldemperorseagullclimbingflypursestretcherantmailboxkimonoashestomatowatermelonair raidin medias ressurrendergymnasticspotatoburn victimorgandiarrheashelterfleeingphonographtoothbrushstrawberrybroomfloodingricewagontantrumbucketwashingmosquitowashing dishesdeath of parentemaciationcartabandoned minebomb shelterjapanese armyleechstovefireflyimitationcuttingolder actors younger roleshummingmelonplayingmalnutritionmarblesibling relationshipgrapepiggy back ridefirst aidjapanese flagdebriskamikazemale tearswartimerailroad stationfirebombcombcartwheelimperial japannoodlesrationingstrawbutterrashacid raincharcoaltin canradiation poisoningburning a dead bodybeanstalkheart troubleself sufficiencyfallout shelterstrafinghorrors of warsandboxwater canteenwadingmintfirehouseherringplumjapanese navykobe japanhair clipworld warribcageolder brother younger sisteremperor of japanbroken water pipeimitating the firing of a gunmosquito nettingshovelling (See All) |
Hugo is an orphan boy living in the walls of a train station in 1930s Paris. He learned to fix clocks and other gadgets from his father and uncle which he puts to use keeping the train station clocks running. The only thing that he has left that connects him to his dead father is an automaton (mecha β¦nical man) that doesn't work without a special key. Hugo needs to find the key to unlock the secret he believes it contains. On his adventures, he meets George Melies, a shopkeeper, who works in the train station, and his adventure-seeking god-daughter. Hugo finds that they have a surprising connection to his father and the automaton, and he discovers it unlocks some memories the old man has buried inside regarding his past. (Read More)
Subgenre: | steampunksilent moviesilent filmmakingfrench filmmakingdieselpunk |
Themes: | theatrelonelinessangerdeathlovefriendshipdrinkingdrunkennessescapefilmmakingmagicmemorydeath of fatherobsessionpoetry β¦photographyfalling in lovewritingdog in love (See All) |
Mood: | nightmarefilm history |
Locations: | snowrestauranttrainschoolcemeteryparis francebathtubfrancemuseum |
Characters: | little boymermaidlittle girlactressboyhusband wife relationshipfather son relationshippolicemother son relationshipfriendbrother brother relationshipteenage girlteenage boygirlpolice officer β¦policemandancermusicianactorphotographerwriterthiefartistfilmmakerfilm directorfrenchuncle nephew relationship (See All) |
Period: | 1930s |
Story: | theatre audiencespotlightspiral staircaserunning awayforename as titlepet dog3 dimensionalcircusstagekeysearchorphantearscameracat β¦rescuedreamcryingvoice over narrationphotographcharacter name in titleone word titledogflashbackdancingexplosionchasetelephone callfirebased on bookcorpseslow motion scenedrinkarrestsecretbookrunningdead bodycaferobotrivertelephonesubjective camerafoot chasenewspapername in titleold manmontageno opening creditschilddrawingchild in perilbathgraveyardtheatergravelibraryauthorprologueuniformpassionstatuereadingscreampursuitsadnessworld war onecinemafloweractingpoettrustpoemapplauseentertainmentbreaking and enteringcagefamehappinessmagiciantoyhidingwatching a moviewristwatchtimeaudienceladderrailway stationorphanagefollowing someoneorchestraclockembarrassmentguardmovie theatregypsychild's point of viewinventorwizardmakeup3dlaughterfilm setdrunksketchbookstorecapturesnowingnotelanternbonfireholding handsmusic bandposterbeing followedsaving a lifemagic tricknotebookeiffel tower parisfilm clipmachinefilm projectortween girlflaskshow businesspocket watchfallingtrain tracksindustryfilm studioashescollectorentertainercarpenterhiding placevaultcarousellimpcinematographercollectionenigmalobstermovie cameramerry go roundkiss on the cheekpenhouse fireapprenticeloudspeakerhookguard dogoverhead shotmovie posterwrenchcard tricktantrumboy girl relationshipspectatorreference to charlie chaplinmusetrain conductormausoleum3 dmovie projectordead brotherstreet kidshopkeeperoil lamptoy storeinkdead parentsgalasideshowsteamfake beardleg bracefire breathing dragontoy soldierseine riverdobermanscavengerdreamerlooking through a keyholerepairmanclock towerdeath of uncletrain wreckscreenpastrypicking a locklarge format cameramementomagician's assistantlock picknewsstandpost world war onepresentationslidewar injurydachshundtoolscupboardeiffel towerauteurnotre dame cathedraljazz combobook sellernightshirtreference to london england3d glassesdestroying propertymagic actillustrationtrain derailmentrailroad trackshistory of cinemalong underwearreference to rudolph valentinowind up toyclimbing a wallcroissantwearing clothes in a bathtubfilm preservationmechanicalreference to jules vernetraveling circusclockworkfilm restorationautomatoncrankreference to buster keatoninnovatorfilm historianwicker basketdoberman pinschertrain enginereference to douglas fairbanksreference to harold lloydtrampledantiquariandream within a dream within a dreamlistening at a doorreelgodfather goddaughter relationshipsense of timearc de triomphebroken chaircelluloidclockmakerovationpurpose in lifereference to georges meliesarmoireflower selleryear 1895film academygearsreference to the lumiere brothersbass fiddlehand crankedoil canstanding on a chairwind upfootlightsmechanical dragonmechanical manreference to hal roachshoe heelsmelling a flower (See All) |
A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.
Subgenre: | suspense |
Themes: | surrealismmurderdeathrapedrinkingfuneralinvestigationvoyeurismmemoryobsessionredemptionpoetryhome invasionhopemurder investigation β¦death of daughterafterlifemissing child (See All) |
Mood: | rain |
Locations: | bicyclesnowhospitalschoolcemeterybathtubtaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water |
Characters: | little boylittle girlfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipdoctorbrother sister relationshipteenage girlteenage boyserial killerdetective β¦policemandancerphotographersister sister relationshipgrandmother granddaughter relationship (See All) |
Period: | 1970syear 1973 |
Story: | stuffed animal toysnowglobeeyeglassesflowerslightningsuitcasesearcheatingcandleflashlightneighbortearscamerafooddream β¦cryingvoice over narrationtitle spoken by characterphotographbased on novelblooddogf ratedflashbackkisscigarette smokingdancingknifechasethree word titletelephone callfirebeatingcorpseblood splatterwatching tvdrinkfalling from heightpaintingbookrunningbirthdaydead bodyvoyeursubjective camerasocceraxemontageno opening creditspainterunderwater sceneflash forwardtreestalkersuburbfantasy sequenceevil manreadingbaseball batpursuitsuspicionhatestrong female characterrecord playerpoembreaking and enteringhatjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesshopping mallfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarreckless drivingnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwrecklost lovevacuum cleanerbroken windowdigging14 year oldfalling into watercornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositychild killerwatching someonebreaking down a doorbeing watcheddollhousetoy storechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinewall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All) |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β¦hanted. (Read More)
Subgenre: | dark fantasycoming of agetragedyfairy taleslapstick comedyfish out of waterdisneybased on fairy tale |
Themes: | death of mothermonsterfearkidnappingsurrealismloverevengejealousyescapedancedeceptionmagicobsessionsupernatural powerblackmail β¦redemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All) |
Mood: | poetic justice |
Locations: | woodssnowforestbarparis francebathtubvillagefrancelakecastlerooftop |
Characters: | little boygrandmother grandson relationshipfemale protagonistsingerfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipbabyhostageartistlove trianglemaidwitch β¦single fatherex soldier (See All) |
Story: | spiral staircaseeccentrictalking animalfireplacereference to william shakespearegardenlightningcandlebedroompianorescuemirrorvoice over narrationsingingtitle spoken by character β¦photographcharacter name in titledogflashbackbare chested malekissfightdancingexplosionpartychasesurprise endingpistolfirebeatingcorpsehorseshot in the chestremakeslow motion scenepunched in the facebattleswordkissingbrawlfalling from heightpaintingshowdownrifleheld at gunpointbedshot in the backsword fightmountaindisguisewomanmontagebridgefour word titlemapfalse accusationno opening creditsbirddrawingcontroversykingcreaturetransformationbartenderflash forwardattempted murderlibrarycursedangerprologuewidowerrace against timeknocked outmanipulationwigtied upcabinloss of motherlove interestqueenprincesingle parentchesswerewolficeropefalling down stairswolfdressheroineheavy rainhunterloss of wifeblockbustercomposerservantjumping from heightculture clashstrong female leadcgitorchcompassionanimal attackclockfull moonanthropomorphismfight to the deathinventorfalling to deathescape attemptballensemble castbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monstermarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillfamous scoremusketclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstudio logo segues into filmstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All) |
Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing β¦ voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)
Subgenre: | suspense |
Themes: | angerfearghostmurderdeathfriendshiprevengemarriageinfidelityadulteryvoyeurismextramarital affairsupernatural powerunfaithfulnesspanic |
Mood: | rain |
Locations: | boatsnowrestaurantswimming poolcemeterybathtubrural settinglakelaboratoryyacht |
Characters: | mother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipfriendteenage girlteacherstudentmusicianteacher student relationshippsychiatristprofessorghost in a mirror |
Period: | 2000s |
Story: | pet catlaptop computerpet dogmousefireplaceteagardenratkeycandleneighbortearscatcomputermirror β¦cell phonecryingphotographdogbloodinterviewpartythree word titlesurprise endingshowertelephone callcar accidentwatching tvsecretbathroomcollegewinewomanbathunderwater sceneroommategraveyarddrowninggravebinocularselectrocutionpossessionmissing personcollege studentdeath of husbandhauntingsuspicionmurdererhaunted housetherapyrunawaypickup truckoccultgothichammertherapistblockbusterdrug overdoseresearchboston massachusettsanxietyspyingpieropening a doorphoto albumvillain played by lead actordockseancefireballphysicianfencesailboatparamedicshoedruggedcelloouija boardgeneticshitchcockiansleeplessnesspoltergeistcellistfootprintmissing girl911power failurevermonthair dryervisionswriting on a wallsteamcocktail partyouijasource musiclock of hairvaliumglass shardmurder by drowningalimonyprinceton universityempty neststepping on glasssound systemhair dryer falling into a bathtubreference to jonas salkreference to madame curie (See All) |
Alice is a daydreaming young girl. She finds learning poems and listening to literature boring. She prefers stories with pictures and to live inside her imagination. One day, while enduring just such a poetry reading, she spots a large white rabbit...dressed in a jacket and carrying a large watch. H β¦e scurries off, saying he's late, for a very important date. She follows him through the forest. He then disappears down a rabbit hole. Alice follows, leading her to all manner of discoveries, characters and adventures. (Read More)
Subgenre: | cult filmfairy tale2d animation |
Themes: | angersurrealismmagic |
Locations: | forestbeachseaenglandocean |
Characters: | female protagonistgirlsister sister relationship |
Period: | 19th century1860s |
Story: | talking catspiderwebsecret passagefantasy worldcanemousetalking animalcaketeagardenflowerskeytearscatdream β¦cryingsingingtitle spoken by charactercharacter name in titlebased on noveldogpartychasethree word titlefirefalling from heightbirthdayfishjudgetrialbirdanimalbirthday partyunderwater scenekingcreaturetransformationsmokingtreeumbrellarabbitunderwaterflowertwinfireworksqueenmoonsisteregghathammerblockbusterladderrealityeaten aliveanthropomorphismimaginationchild's point of viewsandanthropomorphic animalrosesunbutterflyirreverencevictorian erainvisibilitybottlelizardcrownharmonicajurypocket watchtoastgiving a toastcookiemushroompipereading a bookaltered version of studio logomatchredcarpenterparallel universecarrotlobstercardalternate dimensioncalendardooralice in wonderlandsugarlabyrinthcaterpillartitle appears in songminiaturizationdaydreaminghedgehogangryshrinkingoystertea partykeyholesneezeplaying cardit was all a dreamwhiteshoremalletwhite rabbitdimensionsentenced to deathcroquetflamingopaintbrushbad temperwalrusrocking horsestarfishmustardharehookahteapotfalling into a holejamwonderlanddoorknoblift skirtsudden change in sizebird's nestrose gardenchanging sizesmoke ringteacupangry womanhybrid animalmad hatteranthropomorphic rabbitbloomersdodogrowing in sizerabbit holeanimal wearing clothesanthropomorphic flowergiantesscharacter shaped holecheshire catdodo birdenlargementlewis carrollno narrationqueen of heartsanthropomorphic sunred paintpied pipermispronounciationtalking flower (See All) |
Peter Pan (Williams) has grown up to be a cut-throat merger and acquisitions lawyer, and is married to Wendy's granddaughter. Captain Hook (Hoffman) kidnaps his children, and Peter returns to Never Land with Tinkerbell (Roberts). With the help of her and the Lost Boys, he must remember how to be Pet β¦er Pan again in order to save his children by battling with Captain Hook once again. (Read More)
Subgenre: | cult filmswashbuckler |
Themes: | kidnappingrevengechristmasheromagicdysfunctional familyadoption |
Locations: | boatsnowairplanelondon englandenglandbaseballcity of children |
Characters: | little boymermaidlittle girlboyfather daughter relationshipmother daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipchildrenbrother sister relationshipgirllawyerself discovery |
Period: | 1990s20th century |
Story: | seashell bikinifantasy worldacrobatlifting someone into the airold womanorphantearsrescuecell phonecryingtitle spoken by charactercharacter name in titleone word titlebased on noveldog β¦violencebased on playtelephone callbattleswordbedislandgood versus evilsword fightdeath of friendman with glassesno opening creditschilddrawingfictional warduelcostumeuniformstorytellinghuggingpiratecaptainslow motionblockbusteranthropomorphismreverse footagechild's point of viewfairyskateboardingsnowingdead boyplaysword duelvillain played by lead actoryellingbroken windowshoutingadventure herobaseball capbaseball gamechild kidnappingfriends who live togetherfather son estrangementoutlaw gangvictorychristmas lightsacrobaticshooksurname as titlefood fightlifting female in airstockholm syndromechristmas decorationsminiaturizationbig ben londonchild's drawingdollhouseteenager fighting adultreference to gandhicaught in a netflying manactress playing male rolefear of flyingbaseball glovechild fighting adulthook for handbattle of witstinker bellcaptain hookflying boyturbulencepants falling downgang that lives togethersheepdogslashexposed underwearopen windowexpression taken literallyanthropomorphic flowernever neverlandcrowingflying girlold english sheepdogthrowing a telephone out a window (See All) |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel β¦ Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
Subgenre: | suspensegothic horror |
Themes: | fearghostmurderdeathfriendshiprevengesuicidebetrayaldrinkingsupernatural powergriefadoptiondeath of wifevengeanceforgiveness β¦madnessdeath of daughterafterlifedeath in childbirth (See All) |
Mood: | nightmarerainhorror movie remake |
Locations: | woodsforestbeachtraincarbathtublondon englandvillagerural settingengland |
Characters: | little boylittle girlboymother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfriendgirlsister sister relationshipreference to godsingle fathersuicide by hangingbaby boy β¦ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All) |
Period: | 1910s |
Story: | ghost childwallpaperold dark housefogthunderstormthundereccentricfireplacesleepingdollkeysearcheatingcandletears β¦letterrescuemirrorfoodcryingphotographbased on novelblooddogviolenceflashbackfirecorpseslow motion scenedrinksecretpaintingrunningdead bodycolor in titletelephonenewspaperaxemansionwidowhouseaccidentdrivingchildbirdcoffindrawingjourneygraveyarddrowningflash forwardgravecurseprologuescreamingwidowerperson on firedeath of childskeletonhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of motherhaunted housesingle parentlooking at oneself in a mirrorcrucifixtoyloss of wifelossrailway stationclockloss of sonwizardlostsuperstitiondead childatticmurder of a childvoice over letterlanternbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionmental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorhearing voicespocket watchloss of childlocked doorbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicetidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All) |
Arthur is a spirited ten-year old whose parents are away looking for work, whose eccentric grandfather has been missing for several years, and who lives with his grandmother in a country house that, in two days, will be repossessed, torn down, and turned into a block of flats unless Arthur's grandfa β¦ther returns to sign some papers and pay off the family debt. Arthur discovers that the key to success lies in his own descent into the land of the Minimoys, creatures no larger than a tooth, whom his grandfather helped relocate to their garden. Somewhere among them is hidden a pile of rubies, too. Can Arthur be of stout heart and save the day? Romance beckons as well, and a villain lurks. (Read More)
Subgenre: | music videolive action and animationhigh fantasy |
Themes: | marriagepoliticsheromagicfreedomfirst lovefear of water |
Mood: | car chase |
Locations: | tunnelboatbarwatervillagerural settingfarmpolice carafrica |
Characters: | grandmother grandson relationshipboyfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipbrother sister relationshippolicemandancerwarriorvillaingrandfather grandson relationshipengineer β¦the familyboy hero (See All) |
Period: | 1960s |
Story: | beetlefantasy worldinsecteccentricmousereference to william shakespearesleepinggardendisappearancekeyeatingflashlightfoodvoice over narrationcharacter name in title β¦based on noveldogdancingchasetelephone callcar accidentswordmaskbirthdayriversword fighthouseapologyfictional warkingprincesspay phonestorytellingdebtmissing personspeechfirst partwaterfallflowergrandmotherprincerecord playerafricanchainsawbirthday cakeapplauserecordingtreasurephone boothfloodimaginationtelescopechild's point of viewgrandfatherinventormiracleballheartdungeonboarding schoolalternate realitylanternwishdictatorelfinvisibilitylocal blockbusterevictionportalinventionbeefallingtreasure huntexplorercountry houseopen endedpart live actionmagnifying glassracial stereotypelive actionbased on children's bookphonographsnoringtotalitarianismscrapbooktoy carminiaturizationbedtime storymidnightforeclosurebubbleconnecticuthusband wife reunionbreaking down a doorwater towerchild herowaspdebt collectormagical swordchimneylandownertreasure hunterbare midriffchild driving a carnative tribeblock of flatsrubyyin and yanglooking for workgarden gnometoolsirrigationdrinking strawsequel baitinggrandparent grandchild relationshipsudden change in sizevillain escapeswalnutpoppychanging sizereference to king arthurskull and crossboneschild warriorsword in stoneinvisible inkafrican maskafrican tribesmansleeping dropssubterranean worldwooden mask (See All) |
An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.
Subgenre: | coming of age2d animationdisneyswashbuckler |
Themes: | angerkidnappingsurrealismfriendshipjealousyheromagicchildhoodmythology |
Locations: | boatlondon englandseaenglandcavejunglecity of children |
Characters: | little boymermaidlittle girlboymother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipchildrenbrother brother relationshipbrother sister relationshipgirlnative american |
Period: | 1900s |
Story: | seashell bikinifantasy worldshadowchild protagonistlifting someone into the airorphanrescuedreamtitle spoken by charactercharacter name in titlebased on noveldogfightbased on playsword β¦bedislandgood versus evilsword fightmapjourneycigar smokingprincessduelattempted murderumbrellarabbitfirst partwaterfallbearmonkeypiratecaptainflyingwoundblockbusterimpersonationteddy bearclockexplosivefairypipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassesseagullcloudfriends who live togetheraltered version of studio logoskyoutlaw gangracial stereotyperaccoonhookpirate shiprhinocerosbig ben londonskunkhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandmagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All) |
God lives in human form as a cynical writer with his young opinionated daughter in present-day Brussels, Belgium. She concludes that her dad is doing a terrible job and decides to rewrite the world, descending to earth in search of her own 6 messengers to write a brand new testament and change the s β¦tatus quo. (Read More)
Subgenre: | martial artsblack comedydark comedyabsurdism |
Themes: | angermurderdeathfriendshipinfidelityreligionmoneyadulteryescapememorytheftinsanityunfaithfulnessillnesssadism β¦homelessnessfalling in lovephilosophy (See All) |
Mood: | rainsatiresurreal |
Locations: | tunnelbicyclehospitalbeachchurchairplanebathtubelevatorapartmentseacampfireearth |
Characters: | boyfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipdoctorbrother sister relationshipprostitutepolice officerserial killernursebabypriestreference to god β¦christianitybiblesnipercousin cousin relationshipgermandaughterolder woman younger man relationshiphomeless mandancing girlboy girl kiss (See All) |
Story: | running awaybalconythunderstorminsectmousecakeeyeglassescircuslightningdollkeysearchcandleneighborcomputer β¦mirrordreamsongcell phonecryingvoice over narrationsingingtitle spoken by characterbloodsexnuditybare breastsfemale frontal nuditybare chested malefightcigarette smokingdancingtelephone calltopless female nuditybeatingunderwearblood splattercar accidentwatching tvbikinikissingbare buttfalling from heightpaintingriflebeerrunningbedreference to jesus christclassroomstripperf wordsubjective camerafoot chaseaxemontagesuicide attemptfemale pubic hairfishchild abusecoffinbathvanlooking at the cameratalking to the camerapublic nuditylibraryprologuereadingscreamshot in the shoulderinjectionpursuitcrossbasementsadnesschickenshot in the armfreeze framestrong female characterrecord playersurgeryapplausetv newsbulletkilling an animaldresslooking at oneself in a mirrorlawscene during opening creditshathappinesscowboy hatcrucifixwatching a movieswimsuitimprovisationladderstrong female leadhomefatedead womanmilkwatching televisionmovie theatrebarefootmale prostituteadventurerbra and pantiesgrocery storenicknametrappedboxer shortscynicismblood on facebackpackhatredkickingmiracleshovelmakeupheavenbutterflyairplane crashtigerrefrigeratorbriefcaserecording studiobriefsinjusticearrowbrushing teethglobal warmingtelekinesisholding handsirreverencelaundrydead animalepisodic structurereading aloudname callingtelevision newsvacuum cleanergorillatrailer homefalling into waterbare chested boylocked doorpark benchapewashing machinechapter headingssick childgodbreaking a mirrorsleeping on a couchoverhead shotgospeljumping out a windowevangelistred light districthair dryerwatching someonebeing watchedmodel airplanehead bandagepeep showhula hoopdining halldisembodied handbrussels belgiumpenis slurwoman in a bathtubreference to allaharm castslip the undergarmentringing phoneringing telephonefile cabinetsuntan lotionadam and eveelderly manlocked uptext on screengarbage binjumping from a windowhit in the stomachwalking on waterarchitectural modelsiren the alarmliving alonesoup kitchenapostledestroying propertyempty swimming poolpregnant manwaiting in linesex maniacreference to franz schubertreference to the titanicreference to johann sebastian bachanimated sceneboy dressed as a girlshopping centerwall clockreference to marcel proustarctic circlecartoon chickentesticles slursleeping on a benchvomiting in a toiletboy dressed as girlmace spraydistorted soundreference to jean claude van dammeview through rifle scopeeye maskfield hockeyreference to baalsmall apartmentcartoon fishtouching handsmissing toothreflection in a windowromance subplotartificial armman in a bathtubmentally challenged malereference to pokemonamputated armapostlesbreaking a dishdefecation slurstolen keylast supper painting (See All) |
The impressionistic story of a Texas family in the 1950s. The film follows the life journey of the eldest son, Jack, through the innocence of childhood to his disillusioned adult years as he tries to reconcile a complicated relationship with his father ('Brad Pitt' (qv)). Jack (played as an adult by β¦ 'Sean Penn (I)' (qv)) finds himself a lost soul in the modern world, seeking answers to the origins and meaning of life while questioning the existence of faith. (Read More)
Subgenre: | independent filmcoming of ageepic |
Themes: | feardeathmarriagereligionjealousypregnancymemorytheftdysfunctional familyguiltgriefbullyingeducationphotographyhope β¦crueltychildhoodinheritanceafterliferegret (See All) |
Mood: | movingrainavant garde |
Locations: | texaswoodsbicycleforestbeachrestaurantschoolchurchswimming poolcemeterysmall townairplanebathtubdesertelevator β¦urban settingpolice carseacourtroombaseballouter spaceoceanchinastormrunning into water (See All) |
Characters: | little boygrandmother grandson relationshipboyhusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipafrican americanchildrenbrother brother relationshippolicemanmusicianbabypriest β¦thiefchristianreference to godbullywaitresschristianitycatholicchineseengineeryounger version of characterpregnant wifecrying babydeath of boydeath wish (See All) |
Period: | 1950s |
Story: | shadowchild protagonistinsectthundereyeglassessleepinggardenflowerssearcheatingcandleflashlightprayerpianotears β¦catmirrorfoodcell phonecryingvoice over narrationdogflashbackbare chested malekissfightdancingexplosiontelephone callfireface slapslow motion scenearrestpaintingbooklierunninglingeriedead bodycafeclassroomguitarriverswimminghalloweensurvivalnewspaperbridgehousesnakefishnonlinear timelinechild abuseapologyman with glassescoffinbathunderwater scenejourneygraveyarddrowningpaingunshotflash forwardtreeclownsuburbfired from the jobliarstorytellingreadingbaseball batcourtdeath of brotherchildbirthdeath of sonwaterfallflowerclasstrustkillingredheadhateblack americanrecord playermachismodestinybreaking and enteringlooking at oneself in a mirrorlistening to musicfaintingrecordingvandalismguitariststealingplanetswimsuitsharkladderbirthfollowing someoneend of the worldambitiondinosaurpromisewindsufferingmourningloss of sonkickingcigarette lighterbible quotecard playingsibling rivalrysunbutterflyvolcanoatticchoirswingbarbecueexistentialismgrowing upmarital problemloss of brotherchildhood memoryfast motion sceneshamebeing followedpiano playersermonspittinggiving birthhandshake12 year oldgardeningnotebookbaptismhomecomingreading aloudstairwayescalatorlooking out a windowabandoned houselizardvery little dialogueskyscrapernaivetyseagullwhisperingenvylavabubble bathstrokebare chested boyelectric shocktrain tracksuniverseswimming underwaterbreaking a windowguitar playernewborn babyclimbing a treefailuremeteorprehistoric timestelegramreading a newspaperstarscar radiotreehousegrassdistrustdeath by drowningtoy gunsilhouettefetuswaveplant in titleexpectant motherdomineering fatheroverhead shotsaying gracecourthousedare19 year oldkneelingexpectant fatherwater hosewashing dishesice cubehand kissingplanet earthsnoopinghoselooking in a windowjigsaw puzzlejumping on a bedorganiststeamheartbeatstained glass windowtrashcanloss of innocencelaundry drying on clothes linecar repairpower plantschoolyardsparklerlawn sprinklercosmosplayingelectric fanthree brotherswind chimeembryochild as main charactersunflowerancestrylearning to readblessinglighting a candlebig bangblowing bubblessomersaultdeath in familybad newsplainplaying catchtarkovskyesquebb guncrossing oneselfwading in waterwalking on a beachstrict fatherdaily lifedestroying propertyholding head underwaterpatentpipe organwatering cantime capsulewanting to dieartificial respirationhand clapping gamebegins with a quoteresentment toward fatherlimping manreference to johannes brahmsschool bellstreetlightrolling down a hilltree swingplanting a treebegins with a quotationreference to jobhanging out washingtolling bellorigins of lifeveinair rifleelectrical shockfloating in the airglass elevatorhairbrushglass coffinpraying handswaco texaseye maskfertilizationkicking a canpineconeddtdirgejumping from a treepantheismreference to arturo toscaninisurvival of the fittestdeath notificationbirth of sonhit with a boardice traylearning to walkparents arguing (See All) |
Following the death of his father in Mexico, Stephane Miroux, a shy insecure young man, agrees to come to Paris to draw closer to his widowed mother Christine. He lands a boring job at a calendar-making firm and falls in love with his charming neighbor Stephanie. But conquering her is no bed of rose β¦s for the young man and the only solution he finds to put up with the difficulties he is going through is escape into a dream world... (Read More)
Subgenre: | stop motion animationindependent filmabsurdismvideo |
Themes: | surrealismlovefriendshipsuicidejealousydrinkingdrunkennessescapeartmagicmemorytraveldeath of fathertime traveldating |
Mood: | movingnightmare |
Locations: | boatbarparis francebathtubtaxiapartmentpolice carfrancerooftopmexicomexico city |
Characters: | boysingerfamily relationshipshomosexualfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationshippolicemandancermusicianwriterartist β¦interracial relationshipfrenchemployer employee relationshipsingle fatherneighbor neighbor relationship (See All) |
Story: | praying mantisparallel worldsstuffed animal toysleepreflectionbalconyeccentriceyeglassessleepingpianistold womandinnerbedroompianoneighbor β¦lettermirrordreamsongvoice over narrationsingingphotographbloodsexfemale nuditymale nudityfemale frontal nudityflashbackmale frontal nuditykisscigarette smokingdancingmale full frontal nuditypartypantiestelephone callfireunderwearhorsewatching tvdrinkpaintingbooklierunningbedcar crashlow budget filmhallucinationmale pubic hairguitarrivertelevisiontelephoneswimminggay slurcookingbandconcertold mandrug dealerbridgewidowjokeapologydream sequencedrawingbathmarriage proposalparkspermcharacter's point of view camera shothalloween costumelong takedatetypewritersubtitled scenemoonbirthday cakedisasterpornographyanswering machineshavingflyingbreaking and enteringslow motiontape recorderhelmethatmagicianbuttockscomposerflatulencevirtual realityhome moviepart animationschizophreniarealityearthquakecelebrationremote controlreverse footageimaginationtrappedshoesconstruction siteinventorbackstagerejectiondrummerairplane crashvolcanoalternate realityskiingturtlevoice over letterbriefcasefieldbenchlandlordbraintelepathydrumshorseback ridingcoffee shopearphonesconfusionnew jobmagic trickbandagerepeated scenetime machinestairwayfenceinventiontrashbroken windowskyscraperclimbingteasinglanguage barriercloudlandladyhead injurysense of smellmoving incowarddarkroomacoustic guitarsushipark benchfeetgrassknittingcircular staircasedrillfart jokepillowcollectionman on firetelevision setschizophrenicunwanted kissdreamingorganspaghettishopping cartcalendarpeep holeclimbing out a windowsleepwalkingfootprintmodern artcutmuraljumping out a windowtalking to selftv hostbasssweatervoice over inner thoughtsfreezerdinner tablebody imagehand injurymirror balldaydreamingsubconscioustv setfloatinghead bandagecat costumedoor bellfalling out a windowgirl next doorpaper airplanereference to aristotlepitylive televisionsinkcross culturalfree loveillustratorfigurinemulticulturalismchalkdream worldphotocopiermother's boyfriendopening nightreference to mozartlesbian slurart collectionbear costumeanimal costumereference to wolfgang amadeus mozartmake believesideburnsthermometerframeski liftstocking capbicycle helmetfeng shuihole in the wallsleepwalker3d glasseslandlord tenant relationshipthe color redwoman as objectcardboardelectric razormonorailparallel timebackwardstelevision broadcastingarmpitreference to martin scorsesedreamscapeelectric drillvolcano eruptionmultiple languagesgraphic artistportfolioupright pianographic designerarmsclothes hangercopying machinereference to duke ellingtonsoaking feetfrench womanhandednessinner childbig bosschairliftgiant handsmall carbackground singerdrum rollnude imagepointy earscellophanedream machineno smoking signloft bedmechanical horsesubconsciousness (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β¦ing genuine courage. (Read More)
Subgenre: | dark fantasycult filmblack comedysupernaturalfairy taleslapstick comedy |
Themes: | monsterfearghostkidnappingsurrealismmurderdeathrevengemoneybetrayalprisondrinkingtorturedrunkennessescape β¦deceptionmagicmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All) |
Mood: | nightmarerain |
Locations: | woodssnowforestchurchcemeterysmall townvillagecastlecavegermany |
Characters: | boyfather daughter relationshipmother son relationshipfriendbrother brother relationshipprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove trianglewarrior β¦witchmayorfrench soldier (See All) |
Period: | 19th century1810s |
Story: | theatre productionfantasy worldshadowinsectcannonlifting someone into the airrateatingcandlecatrescuemirrorfoodtitle spoken by charactercharacter name in title β¦blooddogviolenceflashbackgunkissfightdancingexplosionknifethree word titlepistolfirecorpseunderwearhorseshot in the chestshot in the headdrinkbattleswordarrestfalling from heightbookriflerunningbedinterrogationhallucinationshot in the backdecapitationbound and gaggedwineold manaxestabbingwomanarmystabbed to deathprisonerstabbed in the chestweaponmapsnakesevered headman with glassestrialanti heroanimaldrawingchild in perildouble crossritualkingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingtied upsevered armgeneralfireworksqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundgothiccagehatbarnfraudtorchgoatstreet lifeback from the deadapplefemale warriorfull moonguardreverse footagecrossbowresurrectionstairscon artistdungeonarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltavernstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All) |
United Press International journalist Will Bloom and his French freelance photojournalist wife Josephine Bloom, who is pregnant with their first child, leave their Paris base to return to Will's hometown of Ashton, Alabama on the news that his father, Edward Bloom, stricken with cancer, will soon di β¦e, he being taken off chemotherapy treatment. Although connected indirectly through Will's mother/Edward's wife, Sandra Bloom, Will has been estranged from his father for three years since his and Josephine's wedding. Will's issue with his father is the fanciful tales Edward has told of his life all his life, not only to Will but the whole world. As a child when Edward was largely absent as a traveling salesman, Will believed those stories, but now realizes that he does not know his father, who, as he continues to tell these stories, he will never get to know unless Edward comes clean with the truth before he dies. On the brink of his own family life beginning, Will does not want to be the kind of father Edward has been to him. One of those stories from Edward's childhood - that he saw his own death in the glass eye of a witch - led to him embracing life since he would not have to fear death knowing when and how it would eventually come. The question is whether Will will be able to reconcile Edward's stories against his real life, either directly from Edward before he dies and/or from other sources, and thus allow Will to come to a new understanding of himself and his life, past, pβ¦ (Read More)
Subgenre: | fairy tale |
Themes: | lonelinessmonsterfearsurrealismdeathloveinfidelityreligionmoneyadulterypregnancyescapeweddingfuneralhero β¦robberyextramarital affairtheftdeath of fatherunfaithfulnessillnessdyingfalling in loveutopia (See All) |
Mood: | raindarkness |
Locations: | texaswoodsboatmotorcycleforesthospitalchurchswimming poolcarcemeterysmall townairplanebathtubwaterrural setting β¦wheelchairlakebaseballrussiacavejunglecampfirestorm (See All) |
Characters: | mermaidboysingerhusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipdoctorteenage boyteachergirlnursestudentdancerphotographer β¦babywriterthiefwitchfrenchself discoverypregnant wifeu.s. soldierolder man younger man relationshipmother in law daughter in law relationship (See All) |
Period: | 1980s1970s1960s1940s2000s1950s1930s |
Story: | mechanical handspotlighteyecaneshadowparachutethunderstormeccentriccircustentkeypianotearslettercat β¦computerdreamcryingvoice over narrationsingingtitle spoken by characterphotographbased on noveldogbloodfemale nuditynudityflashbackgunkissfemale rear nuditydancingpartychasepistolbeatingfistfightslow motion scenebare buttsecretshootinglierifleanimal in titlebedclassroomrevolverrivercriminalreporterswimmingbandbasketballarmyfootballhousesnakefishjokechildcoffinfishingunderwater scenejourneygraveyardpainflash forwardtreelegendkarateclownliaron the roadstorytellingringpursuitchildbirthautomobiledeath of husbandloss of fatherbank robberyflowermagical realismclasspoettwinsacrificeheart attackwerewolfpoemgoldwolfspiderbuttocksaccidental deathgiantmobstrangersheepparadecarnivalembarrassmentambitionpresumed deadbarefootgypsyshoesu.s. armyhungerco workerimmortalitymiami floridaoillostswampfat mancubasalesmanwedding ringeye patchgrowing uploss of husbandwedding receptioncrowpiano playernude swimmingstage performancemetaphortv commercialbeerear nudityyoung version of characterbank robberbeastsororitystrokemoroccounsubtitled foreign languagemarching bandswimming underwaterbankruptcyhearsealabamaidentical twinsmarriage engagementromantic rivalrytelegramfather son estrangementestrangementfather son reunionsecret missionhouse firemob violenceold housebonenight vision gogglesfamily feudfamily historykorean warvulturechemotherapyrocking chairfather in law daughter in law relationshipleaving homecongofootball gamebanjobrief female nudityventriloquistbutt nakedstudio logo segues into filmarmy lifeone eyed mannaked buttwoman's bare buttstorytellerparatroopericebergleechlifting an adult into the airdictionaryquicksandpower plantsiamese twinsspider webtraveling salesmanglass eyecircus performerterminal cancermultiple narratorslycanthropymilitary draftkorean war veteranbare butt womanlifting a male into the airfly the insectfire eatermilkmantrailer housesideburnssorority housecatfishreference to bob hopeconjoined twinsscience fairfalling off a ladderrefusing to eattall taleanimate treewichita kansassearch for truthwoolly mammothunreliable flashbackringmasterroses are red poemunreliable narrationbuickforced perspectivecarnydaffodilamazing grace the hymnlandscaperparallel montagechicken poxgold ringskywritingnewsweek magazinewhite picket fencecongenital heart defecthuman cannonballcar in a treecircus wagonpoet laureateshrinerwork in progress (See All) |
'Louisa May Alcott' (qv)'s autobiographical account of her life with her three sisters in Concord, Massachusetts in the 1860s. With their father fighting in the American Civil War, sisters Jo, Meg, Amy and Beth are at home with their mother, a very outspoken women for her time. The story tells of ho β¦w the sisters grow up, find love and find their place in the world. (Read More)
Subgenre: | coming of age |
Themes: | theatredeathmarriagechristmaspregnancydysfunctional familyillnesshopewritingfirst love |
Mood: | affection |
Locations: | snownew york cityparis francerural settingusa |
Characters: | little girlfemale protagonistsingermother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipsdoctorteenage girlgirlsoldierbabywritersister sister relationshipartist β¦maidprofessorpregnant wife (See All) |
Period: | winter19th century1860s |
Story: | pet catpet dogfireplacereference to william shakespearestagepianistcandlepianoneighbortearslettercatsingingbased on novelf rated β¦dancingpartytitle directed by femalepaintingoperaold manchild abusepaintervoice overmarriage proposalbinocularscostumechristmas treechildbirthreunionactingtwincivil wardressbirthrealityfeministchristmas evemay december romanceice skatingyoung loveboarding schoolgrowing upplayhorse and carriageviolinistvictorian eragiving birthtriple f ratedepidemicpublisherreading aloudtween girltomboysicknessenvykittenmailboxtutoramerican civil warbroken heartloss of sistermassachusettsmanuscripttelegramhorse and wagonexpectant motherchristmas carolhomeworkboarding housechristmas decorationsnightgownsheet musicreference to charles dickensgovernessoil lampstorytellerchalkboardfalling through icebuggyboarderu.s. civil warpost civil warfood shortagecurlingcanvasreference to walt whitmanreference to goethepantaloonemotional healingpregnant sisteremotional depressionreference to friedrich schillerscarlet feversnow sleddingbirth of twinsdance ball (See All) |
Subgenre: | martial artscoming of ageabsurdismslapstick comedyfish out of watersteampunkswashbucklersword and fantasychrist allegory |
Themes: | fearkidnappingsurrealismmurderdeathfriendshiprevengebetrayalescapeherodeceptionmagicfaithhopecourage β¦near death experience (See All) |
Locations: | woodsboatforestlondon englandshipouter spacecavecampfirecable car |
Characters: | mermaidboymother son relationshipchildrenbabyhostagewarriornative americanamerican abroadship captaincrying boyboy crying |
Period: | world war two1940s1930s |
Story: | alternate worldfantasy worldchild protagonist3 dimensionalcannoneccentrickeysearchflashlightorphanletterrescuevoice over narrationtitle spoken by charactercharacter name in title β¦one word titlebased on novelviolencegunfightexplosionknifechasesurprise endingpistolfirefistfightface slapslow motion scenepunched in the facebattleswordbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombrivercombatsubjective cameragood versus evilsword fightambushaxemountainmixed martial artsmapnunno opening creditschild in perilfictional warunderwater scenecreaturejourneyprincesson the runtrainingflash forwardattempted murdertreecharacter repeating someone else's dialogueprologueattackfugitivecharacter's point of view camera shotstatueevil manknocked outkicked in the facetough girlskeletonmartial artistexploding bodytied upthreatened with a knifebattlefieldstylized violencehenchmanflirtingropepiratedestinycaptainflyingspearslaverycowboy hatjail cellkicked in the stomachgiantjumping from heightirishorphanagetorchaction heroineanimal attacksocial commentarybald manslaveeaten alivefemale warriorguardvisionexplosivechild's point of viewbraveryfairydual wieldanimated sequencefalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestbooby trapmusical numbertribeminekingdomsword duelcellarflamethrowerprequelclose up of eyesheroismflagminingfemale fightershipwreckcrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfighter pilotreluctant heroilliteracyaltered version of studio logohumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanegiant animalpirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laborblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcewarrior racereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying fishflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All) |
In Victorian London, England, a little mouse girl's toymaker father is abducted by a peglegged bat. She enlists the aid of Basil of Baker Street, the rodent world's answer to Sherlock Holmes. The case expands as Basil uncovers the crime's link to a plot against the Crown itself.
Subgenre: | 2d animationdisney |
Themes: | angerkidnappingsurrealismdrunkennessinvestigation |
Mood: | rainnight |
Locations: | london englandcastlebar brawl |
Characters: | father daughter relationshipdetectivethiefvillaingirl crying |
Period: | 19th century1880s |
Story: | batshadowthunderstormmousetalking animalrattearscatsongcryingsingingtitle spoken by characterbased on noveldoghorse β¦battleanimal in titlerobotcriminalgood versus evilnewspaperbound and gaggedwinedisguisekingqueenmaniacprivate detectiveflyingballoonhatroyaltyvictimfemale tied upclockeaten aliveanthropomorphismanthropomorphic animalfalling to deathfallmustachekingdomanimal name in titlemudbanditvictorian erasidekickfinal showdownfountaintelling someone to shut uptreasonlizardmachinemegalomaniaccrownbellassistantfallingkickrobefriends who live togetherfinal battlecaperedpart computer animationoutlaw gangsherlock holmesfootprintbitehumankidnapbig ben londoncriminal mastermindcigarette holderangrywine bottleharpdirected by several directorsmale tied upchorusmousetrapcompanionreference to sherlock holmesreference to napoleoncastle thundercrying childbad tempermammalanthropomorphic mouserodentcockneytoy makercitizenreference to queen victoriacat versus mousebasset houndarch villainclaw fightegomaniacright hand mansinging animalgang that lives togetherlosing temperanger issuescat versus dogbig bentalking mouseimpersonating a soldieranimal villainanger anonymousdr watsonyear 1887talking ratbad temperedbroken wing (See All) |
Madame Souza, an elderly woman, instills in her grandson Champion (for who she acts as his guardian) a love of cycling. As a young man, he does become a dedicated road racer with his grandmother as his trainer. During a mountainous leg of the Tour de France in which Champion is racing, he goes missi β¦ng. Evidence points to him being kidnapped. Indeed, he and two of his competitors were kidnapped, the kidnappers who want to use the threesome's unique skills for nefarious purposes. With Champion's overweight and faithful pet dog Bruno at her side, Madame Souza goes looking for Champion. Their trek takes them overseas to the town of Belleville. Without any money, Madame Souza and Bruno are befriended and taken in by three eccentric elderly women, who were once the renowned jazz singing group The Triplets of Belleville. The triplets help Madame Souza and Bruno try to locate and rescue Champion. (Read More)
Subgenre: | cult filmsilent film |
Themes: | kidnappingsurrealismmurderdeathlovemoneydancetravelpovertymafiagamblingblindness |
Mood: | rainsatire |
Locations: | bicyclerestauranttraincarairplaneparis francefranceshipcampfirestorm at seatrain accidentsea storm |
Characters: | grandmother grandson relationshipboysingerprostitutedancermusicianbabysister sister relationship |
Story: | theatre productiontoy traincanepet dogthundereccentricpianistold womaneatingpianorescuefooddreamsongsinging β¦dogfemale nudityguncigarette smokingdancingexplosionchasefireshootoutcar accidentwatching tvshootingplace name in titlenewspaperwinebanddisguisebridgetoiletsubwayexploding carfishingvangunshottrainingumbrellamassagepursuitpigfireworksrecord playerhenchmanwaiterhand grenaderacerecordinghatfrogclockbikermechanictelescopeshoesteambathingdaydreambetrefrigeratortourflat tireshowbazookabarking dogwhalesenior citizeneiffel tower parisaccordionbarberjazz musicvery little dialoguevacuum cleanerwhistlehamburgerstatue of liberty new york cityknittingwavetap dancingbarber shoptriohit by a trainlawn mowercyclistsong and danceel traintricycleemaciationbaby carriageboy scoutexhaustionchimneypasticheocean linerpopsiclefigurinetopless dancingwatching a movie on tvbicycle racereference to fred astairetour de franceteam upfrench animationvictrolaanimated nuditybreaking through a wallsteamshiptap dancerlamp poststewpretending to be blindmaitre d'tripletdance teamreference to charles degaullesmokestacktrain enginebellevillecar off a bridgereference to josephine bakerclubfootegg beaterfat ladytadpoletuning forktransatlantic tripbicycle wheelboat rentalfrog legskillet (See All) |
A young girl is sent to live with her estranged father and his girlfriend at their new home. The father, Alex has plans to spruce up the home with the help of his interior decorator girlfriend, Kim. The previous owner of the home was a famous painter who mysteriously disappeared. Alex's daughter, Sa β¦lly, soon discovers the cause of the painter's disappearance. (Read More)
Subgenre: | suspense |
Themes: | monsterfearmurderparanoiaself sacrifice |
Mood: | horror movie remake |
Locations: | woodsforesthospitalbathtubairport |
Characters: | little girlfemale protagonistfather daughter relationshipboyfriend girlfriend relationshippsychiatristmaidstepmother stepdaughter relationship |
Story: | secret doorspiral staircaseold dark housechild protagonistfireplacegardendisappearancedinnercandleflashlightcamerabloodbare chested malepartyknife β¦fireremakepaintingmansionstabbed to deathdrawingchild in perilcreaturelibrarycharacter repeating someone else's dialoguescreamingcharacter's point of view camera shotknocked outlong takescarbasementcharacter says i love yousevered armgarageshavingfalling down stairsheavy rainarchitectcovered in bloodteddy bearcrushed to deathbroken legstabbed in the legtitle at the endhousekeeperlens flarecoinwoman in bathtubstabbed in the handhearing voicesbubble bathmushroomteethstabbed in the shoulderstabbed in the faceanimated creditspolaroid cameraflash camerastabbed with scissorstoothmuralhorse drawn carriagedinner tablehidden doorlooking through a keyholeunconsciousshower curtainbookcaseteeth knocked outtooth ripped outhiding under the coversstabbed with a screwdriverimpinterior designerarchitectural drawingchild psychiatristsilver dollarkoi pondprivate library (See All) |
Retired madame Adelaide Bonfamille enjoys the good life in her Paris villa with even classier cat Duchess and three kittens: pianist Berlioz, painter Toulouse and sanctimonious Marie. When loyal butler Edgar overhears her will leaves everything to the cats until their death, he drugs and kidnaps the β¦m. However retired army dogs make his sidecar capsize on the country. Crafty stray cat Thomas O'Malley takes them under his wing back to Paris. Edgar tries to cover his tracks and catch them at return, but more animals turn on him, from the cart horse Frou-Frou to the tame mouse Roquefort and O'Malley's jazz friends. (Read More)
Subgenre: | 2d animationdisney |
Themes: | kidnappingsurrealismjealousydancegreed |
Mood: | night |
Locations: | motorcycletrainparis francefrancetruck |
Characters: | singerdancerartistsingle mother |
Period: | 1910s |
Story: | talking catthunderstormmousetalking animaldisappearancepianistdinnerpianocatrescuesongsingingtitle spoken by characterdogfight β¦dancinghorserivergood versus evilnewspaperwomanbirdumbrellarecord playerjazzeavesdroppinghatfrogmilkanthropomorphismanthropomorphic animalfather figurebutlerfallhorse and carriagedrumseiffel tower parispaintaccordionfalling into watergramophonerailroadfriends who live togethertrumpetwindmillacoustic guitarpitchforksymboltrunktalking dogmotorcycle with a sidecarcarriagegoosesleeping pillchopstickshayharpskylinecastle thunderanimal protagonistbassistballadeerbowler hatmilkmantalking birdfishing polelead singertalking horsecroonertrumpetersinging animalanthropomorphic catdouble bassharpistexpression taken literallytalking mouseaccordionistbass voicebaritone voicespiraling eyesalto voicelead guitarist (See All) |
The fantastic tale of an 18th century aristocrat, his talented henchmen and a little girl in their efforts to save a town from defeat by the Turks. Being swallowed by a giant sea-monster, a trip to the moon, a dance with Venus and an escape from the Grim Reaper are only some of the improbable advent β¦ures. (Read More)
Subgenre: | cult filmblack comedyabsurdismsword and sorceryepic |
Themes: | angermonstersurrealismdeathloverevengesuicidejealousyprisontortureescapefuneralmemorysupernatural powergambling β¦executionjusticeamnesiagreek mythology (See All) |
Mood: | rain |
Locations: | beachwatershipcampfirestormsea monsterstorm at sea |
Characters: | actresssingerfather daughter relationshiphusband wife relationshipfather son relationshipdoctorbrother sister relationshipteenage girlgirldanceractorwitchofficer |
Period: | 18th century1700s |
Story: | theatre productiontheatre audienceticklingcannonmouselightningtentangelkeycandlelettersongsingingcharacter name in titlebased on novel β¦dogbloodfemale nuditykissdancingexplosionsurprise endingshot to deathunderwearhorsebattleswordarrestfalling from heightshootingriflerunningislanddecapitationoperawinenonlinear timelinesevered headbirdassassinationfictional warbathunderwater scenekingmarriage proposaltheaterlegendvirginscreamingstorytellingstatueskeletonreunionwaterfallqueencoweuropemooniceropepiratedestinybulletflyingcagequestelephanttreasuregiantcompassionburialorchestrahaircutanthropomorphismdwarfdiamondimaginationwindtelescopebackstageegyptrowboatrosesunvolcanosiegeturkey the countryhorseback ridingbeheadingwhaleaccordiontween girlhurricaneaustriacloudvienna austriawagerchandeliergoddessmosquenuclear bombhot air balloonmusketturkishbritish renaissanceharemvictorygrim reaperorganlockballroomhooksailing shipstrong mansnufffalling off a clifflabor strikecyclopsturbantorture chamberbaroneuropeanstruck by lightningdollhousegallowsnosehourglasseunuchparadoxexecutionerstampedesneezesultananchormortarbattering ramtroubled productionseashelldebrisphallusrejuvenationtrippymarksmancannonballtemper tantrumaltruismwhirlpoolquillsuperhuman speedvulcanbeauty and the beaststatue comes to lifeknickersliving statuefalling chandeliertickling feetstagehandturkish armyfake nosevenus the roman goddessball and chaincatherine the greatconstantinople turkeycherubmaydayfloating headlunacysandbagcrash helmetsand clockbellowscomrade in armsvenus emerging from a sea shell (See All) |
Living in India, Mary Lennox, a young, privileged girl, is left orphaned when her parents are killed in an earthquake. She is sent back to England where she goes to live on her uncle's estate. It is a fairly isolated existence and she has to find things to keep herself occupied. She finds a sickly y β¦oung boy...and a secret garden. (Read More)
Subgenre: | costume drama |
Themes: | death of motherlonelinessfriendshipmagicnaturedeath of fatherredemptiongriefhopecrueltychildhoodwealth |
Locations: | bathtubrural settingwheelchairindia |
Characters: | little boylittle girlboyfamily relationshipsfather son relationshipfriendgirlmaidcousin cousin relationshipemployer employee relationshipuncle niece relationshipself discovery |
Period: | 19th century |
Story: | lifting someone into the airgardenkeyorphanneighborcameradreamcryingvoice over narrationtitle spoken by characterphotographbased on noveldogfemale nudityf rated β¦firetitle directed by femaleunderwearhorseface slapsecretmansiondream sequenceportraitpuppetwidowerstrong female charactericeelephantloss of wifeservantstrong female leadtorchearthquakereconciliationchild's point of viewtime lapse photographyrosefrustrationyoung loveswinghousekeeperhorse and carriagebonfirepigeonunclehorseback ridingvictorian eratriple f ratedparalysismedical maskweedestatestaircasediscoverygardenerhideoutbellmusic boxhiding under a bedsick childcarriagetantrumpuppet showliverpoolsecret passagewaymanor househidden doormaster servant relationshipoil lampjigsaw puzzlesunlightwhite horseseedneglecttemperorphan girljigsawchild as main characterneglected childcomfortspiritual healingivorystrange noisebluebellsrobintapestryemotional healingshut inwidowed fatheryorkshire englandinner strengthchange of seasonswater lilymaharajaenglish gardenwoman slaps a girllearning to walk (See All) |
Set in Scotland in a rugged and mythical time, "Brave" features Merida, an aspiring archer and impetuous daughter of royalty. Merida makes a reckless choice that unleashes unintended peril and forces her to spring into action to set things right.
Subgenre: | coming of agecomputer animationslapstick comedycgi animation |
Themes: | ghostrevengemarriageescapedeceptionmagicredemption |
Locations: | woodsboatsnowforestvillageshipcastle |
Characters: | female protagonistmother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipteenagerbrother brother relationshipbrother sister relationshipteenage girlgirltough guywarriormaid β¦witchhunting party (See All) |
Story: | hide and seekbechdel test passedstuffed animalscene after end creditsshadow3 dimensionalcakefireplacelightningkeyrescuevoice over narrationtitle spoken by characterone word titledog β¦female nudityf ratedflashbackmale rear nuditydancingknifechasesurprise endingtitle directed by femaleshot to deathhorseshot in the chestslow motion scenepunched in the faceswordbare buttshowdownbirthdayriverswimminggood versus evilfoot chasesword fightambushaxemontagefishno opening creditskingprincessnecklacetransformationon the runtrainingflash forwardlegendcursecharacter repeating someone else's dialogueprologuescreamingrace against timetough girlprankcontestfeminismchickenwaterfallshot in the armbearqueenprincestrong female characterchessdestinyfalling down stairsspiritteen angstbow and arrowspearheavy rainlooking at oneself in a mirrorbuttocksrebelsheepstrong female leadtorchfateanimal attackapplefemale warriorshieldtarget practicebraveryscotlandrowboatpunched in the chestmedieval timesprideaerial shotrainstormknife throwingkingdomwisharrowblack magicsign languagecrowhorseback ridingtriple f ratedhit in the facebirthday presentstrongmanshot with an arrowyoung version of characterarcherycrowndomineering motherfemale heromooningmacguffinstablefight the systemheirarcherbowbagpipesanimal killingbanquetrock climbingmagic spellteenage herothronemedievalsuitorscottish accentbroomscotclothes rippinghuman becoming an animallordharptrackerrebellious daughterruinwood carvinginvisiblespit takeclanspear throwingteenage rebellionmatriarchytrackingone legged manrider horse relationshipwooden legmusic lessontug of warscottish highlandstripletscauldrongirl horse relationshipaxe throwingthrown from a horsebareback ridingredheaded girlcubriding bareback10th centuryirish wolfhoundtapestrypeg legceltdisney princessevil spelllutefemale horse riderfemale archerbetrothalplaying bagpipesbullseyehaggisanimal becomes humangirl riding a horsewill o' the wispfiery redheadwork horsedrumstickrefusing to believehighland gamesmenhir (See All) |
In 1944 falangist Spain, a girl, fascinated with fairy-tales, is sent along with her pregnant mother to live with her new stepfather, a ruthless captain of the Spanish army. During the night, she meets a fairy who takes her to an old faun in the center of the labyrinth. He tells her she's a princess β¦, but must prove her royalty by surviving three gruesome tasks. If she fails, she will never prove herself to be the the true princess and will never see her real father, the king, again. (Read More)
Subgenre: | dark fantasycult filmcoming of agetragedyfairy talemythologicalcoming of age filmspanish horrormexican horroradult fantasy |
Themes: | death of mothermonsterfearsurrealismmurderdeathlovepregnancytorturemagicmilitarymemorydeath of fatherbrutalityillness β¦sadismexecutioncrueltydeath of wifecommunismcourageself sacrificehuntingafterlifedeath in childbirthdying in childbirth (See All) |
Mood: | raingore |
Locations: | woodsforesttrainsmall townbathtubkitchenwheelchaircavespain |
Characters: | female protagonistsingermother daughter relationshiphusband wife relationshipfather son relationshipdoctorgirlsoldiernursebabypriestmotherfathermayorpregnant β¦military officerstepfather stepdaughter relationshipstepbrother stepsister relationshipmythical creaturedeath of girlpregnant mother (See All) |
Period: | world war two1940syear 1944 |
Story: | new homesecret doorsecret passagefantasy worldthunderstorminsectlifting someone into the airfireplacekeyeatingrescuemirrorfoodsongvoice over narration β¦singingcharacter name in titlebloodfemale nudityviolenceguncigarette smokingexplosionknifechasesurprise endinghorseshot in the chestshot in the headpunched in the facebattleshootingbookvomitinglierifleinterrogationrevolvershot in the backgood versus evilspycookingambushstabbingarmyfour word titlestabbed in the chestweaponchild abuseno opening creditsanti herocoffinkingcreatureprincesstransformationpainlimousinegravetreebinocularsliarpoisonumbrellastorytellingstatuereadingrabbitskeletonfarmerinjectiontragic eventtied upflowerloss of mothergeneralmagical realismsacrificequeenchild murderprincestrong female characterrecord playerdestinyshavingcard gamesabotagespiritsyringegrenadeburned alivewounddressheroinepropagandarecordingcookcaptivehammerhidingservantrebelfrogstrong female leadhomeburialfull moonpromiseimaginationchild's point of viewbraveryfairyresistanceshot in the facecard playingrosedead childfascismcapturehousekeeperlanternkingdomdaggerwar crimechauffeurdrugged drinkmuddead girlhorseback ridingbandagemazelotteryeuthanasiaportalbreadtween girlno title at beginningmedalfascistwhisperingparamedicbubble bathpocket watchdisciplinemercy killingfemale heroamputationtyrantmilitary uniformeyeballfeverspanish civil waranarchisthiding under a bedimmortalparallel universeinformermonumentstuttering10 year oldtailorpsychotronic filmcavalryalternate dimensionguerrillafetusgiant animalalice in wonderlandbludgeoningberetanarchismsuspendersphonographknife held to throatlabyrinthtoadcowardicebirthmarkstabbed in the mouthfeastlottery ticketparallel worldruthlessnesshand injurywalking stickfire fightyoung girlfantasy becomes realityhourglassleechlugermilking a cowlullabycalligraphytrain wreckchalkechomouthembryoreference to dwight d. eisenhowerlifting a male into the airsecret compartmentmorning sicknessinfiltratorlipsmagical creaturerationingstraight edge razorcult favoritesedationmagic booktrickerymagical stonereference to francocold feetrootantibioticwater millneck wounddead treeopening creditshedge mazefaunmandraketalking to an unborn babychild heroinefig treerabbit huntingration carddead child with eyes openfur stolestitching one's own woundimaginary childpolishing bootsstone carving (See All) |
Pongo and Perdita have a litter of 15 puppies. Cruella De Vil takes a fancy to the pups, and wants to get hold of them, as well as more pups, to make herself a lovely dalmatian skin coat... Cruella hires some thugs to kidnap the pups and hold them at her mansion. Will Pongo and Perdita find them in β¦time ? (Read More)
Subgenre: | 2d animationdisney |
Themes: | angerfearsurrealismrevengemarriagechristmaspregnancyweddingabductionfashionfalling in love |
Mood: | car chase |
Locations: | snowcarlondon englandkitchenfarmenglandlaketruckstorm |
Characters: | husband wife relationshipfamily relationshipsmothermaidfatherpregnantpregnant wife |
Period: | 1960s |
Story: | moving vantalking catpet dogthunderstormtalking animalfireplacedisappearancelightningpianocatrescuesongcryingbased on noveldog β¦number in titlefightcigarette smokingexplosionchasetelephone callhorsewatching tvbattlebrawlgood versus evilnewspaperdisguisemansionwomancigar smokingparksmokingchildbirthcowhenchmanquestbarnstealingcrying womanvillainessblockbustercomposerbirthburglarchristmas evelaughtersongwriterpuppylaughingpipe smokingnannygiving birthpetcar troublegerman shepherdcartoon dogbottletelling someone to shut upblizzardpipefemale villainponddesignerevil womanslappingfur coattelevision setpentalking dogdog movieslapensembleexpectant mothercheckgoosefurreference to ludwig van beethovensnowstormcoatcar wreckexpectant fathermatchmakingbig ben londoncigarette holderfrozen lakeinkleashstovemockerycastle thundergreat danerich womananimal protagonistdalmatianred eyesbad temperbarkingbloodhoundtalking horseimpatiencecheck booklabradordognappinganimal matingsheepdogpomeranian doglittercollie doganimal trackautomobile chasepregnant animalhenchmenbarkspiraling eyesspotsoottalking pet (See All) |
It was no ordinary life for a young girl: living among scholars in the hallowed halls of Jordan College and tearing unsupervised through Oxford's motley streets on mad quests for adventure. But Lyra's greatest adventure would begin closer to home, the day she heard hushed talk of an extraordinary pa β¦rticle. Microscopic in size, the magical dust--discovered in the vast Arctic expanse of the North--was rumored to possess profound properties that could unite whole universes. But there were those who feared the particle and would stop at nothing to destroy it. Catapulted into the heart of a terrible struggle, Lyra was forced to seek aid from clans, 'gyptians, and formidable armored bears. And as she journeyed into unbelievable danger, she had not the faintest clue that she alone was destined to win, or to lose, this more-than-mortal battle... (Read More)
Subgenre: | epic |
Themes: | kidnappingsurrealismfriendshipdrinkingdrunkennessescapeabductioncourageenvironmentmissing child |
Locations: | boatforestlondon englandseashiprooftoplaboratoryairship |
Characters: | female protagonistboymother daughter relationshipfather daughter relationshipmother son relationshipfriendchildrentattoogirlwitchuncle niece relationship |
Story: | talking catpraying mantisfantasy worldcluemetamorphosischild protagonistmousetalking animalfireplacesearchcandleorphanlettercatrescue β¦voice over narrationbased on noveldogviolenceexplosionknifechasepistolfirehorsedrinkbattleswordshootingriflerunningcollegerobotdemoncolor in titlewinestrangulationmountainbridgemapsnakeno opening creditsbirdanimalchild in perilfictional warcontroversykingnecklacetransformationcursebinocularspoisonmissionstorytellingrabbitringpursuitneck breakingfirst partcabinbearsubtitled scenemonkeystrong female charactersurgeryexperimenticeeavesdroppingwolfbow and arrowflyingspearcagequestblockbusterskullstrong female leadstreet lifeclockfull moonwhiskeyadventurerchild's point of viewcrossbowfight to the deathintrigueprophecysoulalternate realityarmorglobal warmingowlclosethiding in a closetgateschemealarmarcticshot with an arrowarcheryclimbing through a windowfemale herohot air balloondeskshape shifterparallel universepolar bearmagnifying glassglacierbarrelchosen oneimmolationlifting person in airhawkvoyagecompassthronesurgical operationnorth poledustsledlordleopardoverheard conversationegyptianmother son reunionhourglassicebergvillainess played by lead actressfalconcaught in a netdog sledwatchtowerzeppelinheresyoxford universityaviatorfly the insectfalling over a cliffdisobediencebrushing hairchasmhiding under a tablesteamshipsea voyagechain mailraptoranimal skullgobletfjordchild thiefcollapsing bridgesighttalking bearpaddlewheel boatfate of the universefalling down a mountainice axesnow leopardbased on cult bookshoulder bagflying witchice bearspirit animal (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Subgenre: | fairy taledisneybiblical |
Themes: | angerfearsurrealismjealousyartmagicnaturetheftunrequited lovehopeunemploymentfreedombook of magic |
Mood: | rainarchive footagepoetic justice |
Locations: | woodsbicycleboatsnowforestnew york citytrainswimming poolhotelcarnightclubdesertwatertaxielevator β¦apartmentlakeshiptruckrooftopcaveoceansewerforest fire (See All) |
Characters: | little girlfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteacherpolice officerdancermusicianactorartistbullywaitresscomedianfisherman |
Period: | 1930swinter |
Story: | rainbowbatpet dogshadowthundermousefireplaceratpianistlightningdollsearchpianotearscat β¦rescuemirrorcryingdognumber in titlesequelkissdancingknifechasefirehorseremakefalling from heightbookrunningcaferiversubjective cameranewspaperaxemountainsubwaysnakefishdream sequencedrawingfishinganthologycoffeepaintreeportraitumbrelladragonrabbitscreamsadnessunderwaterbearnewspaper headlinemonkeyjazzicewolfdestructionfaintingperformanceelephantmagiciantoyoverallsclassical musicfrogtennisrailway stationpart animationviolinmilkorchestragoatclockembarrassmentapplepresumed deadanthropomorphismfloodtrappedhypocrisymisunderstandinganthropomorphic animalrejectionhungerdespairdrummerballlaughterlionbutterflyice skatingvolcanodaydreamspyingdeerturtlecliffduckboxhorse and carriageflightweathercoinjoycamelspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainwhalefoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatorwoodtemptationbeeperformerpopcornfalling into waterseagulllavaquitting a jobjacketsorcerercloudhostgreat depressionballerinadisappointmentimmaturityeaglealligatorasheshammockcrabmeteorpart computer animationhonestymistakeapepart live actiondrillpolar bearclumsinessconductorgymnasticskangaroowindowmiseryspringabstractcourtshipdoormanapprenticelocketgiraffenoiseblanketdoverebirthunicornrevolving doordance lessonregenerationstreet vendorice rinkbroombaldnesspaperdance classfaunacity parkconformityflorasheet musicsignextinctionnetsubway trainbucketbubblecoatphonograph recordvasehornrhinoceroswheelbarrowabstract artmovementfloatingostrichchestzebrajazz clubfigure skatinghard hatleashvolcanic eruptioncartcollisionnoseorganisticebergskunksunlightcarrying someonehippopotamusimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonflamingopet storeelkiciclemarqueenoah's arkmilkmanfatiguehopscotchmusic lessonscubalife jacketramppuddlestooltripping and fallingashcauldronjazz combotubewhirlpoolarkcentral parkdizzinesssupernovaspellcastingbillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathsleeping in a chairbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionflower petalhenpecked husbandpantaloonwalnutlinebranchteardropflipperglowing eyestepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirdflooded roomtrampleddog bonetimingfruit cartlily padmagical hatseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All) |
Growing up can be a bumpy road, and it's no exception for Riley, who is uprooted from her Midwest life when her father starts a new job in San Francisco. Like all of us, Riley is guided by her emotions - Joy, Fear, Anger, Disgust and Sadness. The emotions live in Headquarters, the control center ins β¦ide Riley's mind, where they help advise her through everyday life. As Riley and her emotions struggle to adjust to a new life in San Francisco, turmoil ensues in Headquarters. Although Joy, Riley's main and most important emotion, tries to keep things positive, the emotions conflict on how best to navigate a new city, house and school. (Read More)
Subgenre: | cult filmcoming of agecomputer animationcgi animationdisney |
Themes: | angerfearlovefriendshipmagicmemorychildhoodforgiveness |
Mood: | movingnightmare |
Locations: | trainschoolbuscityroad moviesan francisco californiaschool teacherbus stationmoving to city |
Characters: | little girlfemale protagonistboymother daughter relationshipfather daughter relationshipfamily relationshipspoliceafrican americanchildrengirlpolice officerstudentbabyfathercrying baby β¦chinese foodbaby cryinggirl crying (See All) |
Period: | 2000s2010s |
Story: | moving vanblue hairbechdel test passedrunning away3 dimensionaleyeglassespizzasleepingrattearscatdreamcryingf ratedflashback β¦two word titleclassroomcaliforniahouseapologyclowndragonscene during end creditsglassessadnessbearrunawayballooncopcageelephantstealinghammerblockbustergiantdinosauranthropomorphismimaginationface paintice skatingcartoonice hockeyboyfriendcliffmustachegrowing uptrophychildhood memoryhockeyjoynew jobfire extinguisherfemale teacherelementary schooltomboyimaginary friendlavadolphinkidcloudfemale heromovie studioafrican american womannewborn babyschoolteacherredhonestygreen11 year oldiphonedemolitiongolden gate bridgeminnesotakidskangaroobow tiehandbagraccooneyespre teentear on cheekmiddle schoolunicornmindbluecerealfalling off a cliffnew housenecktielight bulbnewbornsubconsciousfrench friesnosegreen hairhomesicknesspinkmotivationalfirst day of schooleveryday liferunning away from homechased by a dogsneaking outyellowstudentsblonde childerased memoryapathydisgustschool kidsbreakfast cerealcamera shot from inside human bodyemotionpurplehouse of cardsbig noselazysan franciscotryoutsbroccoliopening creditswaking up from a nightmareemotionsmemory erasurecomputer generated imageryred squarecrybabydizzybig eyesfirst placefrench frypunishedrolling eyes (See All) |
Two young girls, Satsuki and her younger sister Mei, move into a house in the country with their father to be closer to their hospitalized mother. Satsuki and Mei discover that the nearby forest is inhabited by magical creatures called Totoros (pronounced toe-toe-ro). They soon befriend these Totoro β¦s, and have several magical adventures. (Read More)
Subgenre: | cult filmfairy tale2d animation |
Themes: | supernatural power |
Mood: | rainanime |
Locations: | woodsbicycleforesthospitalschoolbusvillagerural settingjapanfarm |
Characters: | little girlfemale protagonistfather daughter relationshipmother daughter relationshipchildrengirlsister sister relationshipjapanesemotherfather |
Period: | 1950ssummer |
Story: | new homesecret passagebechdel test passedthunderstormchild protagonistneighborcatcharacter name in titlef ratedthree word titlebathtreemini skirtumbrellamissing person β¦universitymagical realismsisterspiritflyinghomewindlosthappy endingwellbus stopjapanese schoolgirlshort skirtsuper powerfamous scoretuberculosispsychotronic filmcountry lifealternate versionmultiple english dubsnew neighborsick motherstar died before releasesibling relationshiptwo sistersrice fieldmagical creatureacornill motherspritewalking in the woodsgirl wearing a miniskirtolder sisterleaveforest spiritlost girlgrovesootshorthaired girl (See All) |
This is the story of a young witch, named Kiki who is now thirteen years old. But she is still a little green and plenty headstrong, but also resourceful, imaginative, and determined. With her trusty wisp of a talking cat named Jiji by her side she's ready to take on the world, or at least the quain β¦tly European seaside village she's chosen as her new home. (Read More)
Subgenre: | cult filmcoming of age2d animation |
Themes: | surrealismfriendshippregnancymagic |
Mood: | anime |
Locations: | bicycleforestbusurban settingseacitystormbicycle accidentairship |
Characters: | female protagonistmother daughter relationshipteenage girlpolicemanartistmaidwitchself discovery |
Story: | talking catstuffed animalscene after end creditsthunderstormtalking animalold womancatrescuecharacter name in titledogthree word titlesurprise endingtelephone callbased on bookfalling from height β¦runningaccidentwhite pantiesbirdradioscene during end creditsgiftcabineuropeflyingwitchcraftcommunityhitchhikingfull moonairplane crashrainstorminspirationinventionfemale friendshipfriendship between girlsbakerycabin in the woodsdisappointmentpiekindnessfeversick childblack catbakingbroompancakecourierrainy nightsmall businessmultiple english dubsfreight trainstar died before releaseclock towerzeppelinseaside townmother figurebird attackparty invitationbad weatherteenage witchhereditary gift of witchcraftdirigibledelivery servicefamous themeartist modelseduction between girlsultralight aircraftgood witchcourier servicegoodwill (See All) |
When mankind is about to come to an end, a group of scientists decide to create and populate a city deep underground. The city of Ember is to last for 200 years after which its inhabitants are to retrieve from a strong box instructions to return to the surface. Over time however, the message is lost β¦ and life in Ember is rapidly deteriorating. Their power supply is failing and food is being rationed. It's left to two young adults to unearth the secret of Ember and to lead the way out. (Read More)
Subgenre: | post apocalypsedystopiasteampunk |
Themes: | monstersurrealismdeathfriendshipescapedeath of fatherpanicapocalypseself sacrifice |
Mood: | darkness |
Locations: | tunnelboatschoolcavetrying to escapecity mayor |
Characters: | boysingerfamily relationshipsfather son relationshipfriendboyfriend girlfriend relationshipdoctorteenage girlteenage boygirlsister sister relationshipmayorgrandmother granddaughter relationshipengineer |
Period: | future |
Story: | secret doorbeetleinsectsleepingold womaneatingcandleflashlightorphanfoodsongvoice over narrationsingingtitle spoken by characterbased on novel β¦fightchasethree word titlearrestsecretbookplace name in titlerunningrobotscientistsubjective camerasurvivalbandpoliticiandrawingunderwater scenecreaturedrowningprologuelocker roomreadingcity name in titlepursuitloss of fathersacrificerockanswering machineloyaltyteen angstbreaking and enteringwarehousehammerhidingarchitectlosscommunityend of the worldmechanicguardfloodinventorchaospierboxjobgraduationelectricitydockstairwaytreasonblackoutlaundromatmessagegreenhouseindustrymarching bandsunrisecorrupt politiciancodedeath of grandmotherclawsorrowdeath by drowningclimbing out a windowgiant animalfictional cityfloodingpower failureoathwheelbarrowfoster homemessengerhard hatjumping on a bedsteamwashing clothespineapplecape the garmentassignmentpicking a lockone legged manwater slidebegins with narrationmachinerystore roomtoolswater pipeplumbingunderground cityrube goldberg machinebiospherefirst jobbio domecorrupt mayorpower generatorcontraptionwater wheelbrownoutfloor planjob assignmentstorage roombeating a rugminer's lamp helmetsubterranean worldwhispering into someone's earsubterranean city (See All) |
Nim Rusoe is a girl who joins her father, a scientist, when he does research on marine life on an island. It's just the two of them but she spends her time making friends with all the animals she encounters, chatting on the computer and reading the adventure books of Alex Rover. When her father goes β¦ to do some research but when a storm strikes the island he doesn't come back, she gets worried and frightened. She then e-mails Alex Rover hoping that he will come but what she doesn't know is that Alex Rover is a woman who is agoraphobic and germaphobic. But her creation comes to life and eggs her to go. Unfortunately she has never gone anywhere before and is denied her necessities like her sanitary gel by the customs officer at the airport. In the meantime, Nim tries to be strong while waiting for Alex to arrive. (Read More)
Subgenre: | coming of ageabsurdismslapstick comedyfish out of water |
Themes: | fearsurrealismescapeheromemorytravelparanoiapaniccouragenear death experienceobsessive compulsive disorder |
Mood: | nightmarerain |
Locations: | woodsboatforestbeachhelicopterairplanebathtubdesertwatertaxiairportseashiprooftopocean β¦jungletaxi drivercampfirestormsan francisco californiastorm at seaboat accident (See All) |
Characters: | boymother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipgirldancerwritersecurity guardaustralianamerican abroadsingle fatherhuman animal relationship β¦ship captain (See All) |
Story: | alternate worldgame playinglifting someone into the airlightningsuitcaseeatingflashlighttearslettercameracomputerrescuefoodcell phonecrying β¦voice over narrationphotographcharacter name in titlebased on novelf ratedflashbackfightdancingchasesurprise endingtelephone callfireslow motion scenefalling from heightbookvomitingbedhallucinationislandtelephonescientistsubjective cameraswimmingsurvivalsoccercookingmountainvideo cameramontageinternetmapfishradiofishingchild in perilbathunderwater scenetreeauthordangerelectrocutionfantasy sequencecharacter's point of view camera shotactor playing multiple rolesproduct placementstorytellingrace against timemissing personreadingisolationloss of mothersingle parentpirateanswering machinefarceheavy raineggmachetequesttouristsurvivorcaptivespiderflatulencesharkhome movietorchpresumed deadfull moonpassportreverse footagefloodtelescopechild's point of viewbraveryinvasionfanmisunderstandinganimated sequenceobesitypower outageevacuationnovelistrowboatlostvolcanoaerial shote mailrainstormcaptureturtlecliffsailorbarbecuelanterndead motherbonfirenewspaper clippingfast motion scenecamelexplorationnovelwhaleshipwrecklizardeditorsailboattween girlsailingfish tankimaginary friendseagullhurricanelavawormsouppalm treemotorboatcruise shipclimbing a treesurrogate mothermicroscopewet t shirtmetal detectortreehouserescue from drowninganimated creditsgolden gate bridgereclusemountain climbingrock climbingtreadmillagoraphobialeg injuryfemale writertropical islandscottish accenthelicopter pilotcoconutseal the animalrole modelvolcanic eruptioncatapultpinatatidal wavelifeboatqueenslandbelchingsatellite dishcratersouth pacificwet jeansspyglasswater pumpstarfishlost at seapelicansea lionsolar powertug of warclosing credits sequencetoolswindsurfingsea turtleashwading in watertropicssinking boatcalling parent by first nameport a pottymarine biologistarachnophobiaanimated scenecall for helpmonsoonhomeschoolinghiding in a treeman versus naturespear fishingnational geographic magazineroasted pigsatellite phonecan openerdesolate islandplanktonsecurity checkpointalonenessboatmanbuccaneerhula danceroverboardoceanographerair hostessamerican expatriatesextantflossing one's teethtropical stormfear of spidershand sanitizersatellite telephonewoman girl relationship (See All) |
1903 London. Renowned playwright 'J.M. Barrie (I)' (qv) (James)'s latest effort has garnered less than positive reviews, something he knew would be the case even before the play's mounting. This failure places pressure on James to write another play quickly as impresario Charles Frohman needs anothe β¦r to replace the failure to keep his theater viable. Out for a walk with his dog in part to let his creative juices flow, James stumbles upon the Llewelyn Davies family: recently widowed Sylvia Llewelyn Davies (the daughter of now deceased author 'George L. Du Maurier' (qv)) and her four adolescent sons. James and the family members become friends, largely based on he and the boys being able to foster in each other the imagination of children, James just being the biggest among them in this regard. Sylvia also welcomes James into their lives, he who becomes an important and integral part of it. Among the six of them, the only one who does not want to partake is Sylvia's third, Peter Llewelyn Davies, who is still grieving the reality of their lives, where his father was there one day planning an outing for the family, and gone the next. Two other people who don't appreciate James in the Llewelyn Davies' lives are: his wife, Mary Barrie, who always feels the need to be the responsible one in their relationship and who feels threatened by his friendship with an unmarried woman; and Emma du Maurier, Sylvia's overbearing mother, who sees him as an obstacle to Sylvia moving on with her lβ¦ (Read More)
Themes: | theatredeath of motherdeathfriendshipmarriagefuneralgriefchildhood |
Mood: | movingrain |
Locations: | hospitalcemeterylondon englandengland |
Characters: | little boygrandmother grandson relationshipboymother daughter relationshiphusband wife relationshipfamily relationshipsmother son relationshipdoctorbrother brother relationshipactorwritersingle mothermaid |
Period: | 19th century1900s |
Story: | theatre productiontheatre audiencecanepet dogcannonlifting someone into the aircircusstagedinnerorphanneighbortearsdogtwo word titlebased on true story β¦based on playslow motion scenefalling from heightplace name in titlewidowtheaterauthorcostumeclownfantasy sequencecountrysideloss of fatherloss of motherbearterminal illnesschessapplausepirateloss of friendloss of loved onedysfunctional marriagerehearsaltimesheepcompassionorchestracamera shot of feetimaginationfairyproducermarital separationtuxedobroken armloss of husbandnewspaper clippingpipe smokingunhappy marriageinspirationperformerplaywrightstage playcottagecoughingkitemarriage problemscountry housepark benchspoonbow tiesailing shipred winesittingcity parkcricketdying youngpremierejumping on a bedinvestormusic conductorplayingplatonic lovebuggyedwardian eraopening nightreference to peter panhook for handcynicmake believetheatrical troupewalking the plankchildren's authoryear 1903reference to rudyard kiplingtear on one's cheekcough foreshadows deathnewfoundland dogtheatre ownerpremiere party (See All) |
To Greg Heffley, middle school is the dumbest idea ever invented. It's a place rigged with hundreds of social landmines, not the least of which are morons, wedgies, swirlies, bullies, lunchtime banishment to the cafeteria floor - and a festering piece of cheese with nuclear cooties. To survive the n β¦ever-ending ordeal and attain the recognition and status he feels he so richly deserves, Greg devises an endless series of can't-miss schemes, all of which, of course, go awry. And he's getting it all down on paper, via a diary - "it's NOT a diary, it's a journal!" Greg insists, preferring the less-sissyfied designation - filled with his opinions, thoughts, tales of family trials and tribulations, and (would-be) schoolyard triumphs. "One day when I'm famous," writes Greg, "I'll have better things to do than answer people's stupid questions all day." So was born the Wimpy Kid's diary. (Read More)
Subgenre: | ghost story |
Themes: | fearfriendshiprevengechristmasbetrayalwrestlinghumiliationbullying |
Mood: | rainbreaking the fourth wall |
Locations: | woodsbicyclesnowforestnew york cityschoolbusschool busschool bullyschool danceschool friend |
Characters: | little boyboysingerfamily relationshipsfather son relationshipmother son relationshipfriendchildrenbrother brother relationshipteenage boyteachergirldancermusicianphotographer β¦best friendbullyasian americangrandfather grandson relationshipchildhood friend (See All) |
Story: | stuffed animal toycheesecandychild protagonistpianistflashlightpianocameracomputermirrorsongcell phonevoice over narrationsingingphotograph β¦based on novelflashbackbare chested malefightdancingtelephone callunderwearurinationwatching tvrunningclassroomcompetitionmanhattan new york cityhalloweentoiletrock bandno opening creditsvantalking to the camerafive word titlelibraryfantasy sequenceumbrellaauditiondiaryhalloween costumeprankfilm within a filmfirst partclassgarageprivate detectivepickup truckcoachnerdwoman with glassesfaintingwalkie talkieamerican footballwatching a moviejanitorreconciliationchild's point of viewspanishanimated sequenceatticfriendship between boystitle at the endclassmatebroken armalarm clockwilhelm screamowlwrestlert shirtnarrated by characterporn magazinefire extinguishercafeteriascene before opening creditstrick or treatingjournaltween girlboy with glassespeer pressureschoolboylistening to a radiopopularityplaying a video gamealtered version of studio logooverweighttimes square manhattan new york citybadgesitting on a toiletsnowmanmolespray painttoilet paperjunior high schoolschool playjack o'lanternmiddle schoolpirate costumeboy girl relationshipdental bracescanteenanimated opening creditsstudio logo segues into filmguatemalakindergartenbroken handrottweilerbreakdancinggym classgym teacherbratbreaking the fourth wall by talking to the audienceschool lockerfirst day of schoolprecociousnessfat boygingerhand bandagereference to the wizard of ozboys' bathroomolder brotherschool cafeteriagarage bandtwister the gamegroup of teenagersfriends falling outwedgiebleachersschool yearbookarm in a castsleeping in a bathtubhaunted forestarm in a slingbobble head dollhole in the groundphysical educationcymbalsnotgirl on boys teamleaf blowerptaschool clubwimpthrowing water on someoneweed whackervenetian blindsvoice over diarymouth guardphotograph comes to lifeschool gymschool newspapersinging auditionteenage bandbroken friendshippotty trainingcleaning a bathroomestranged friendwrestling coachmiddle childschool electioncootiespink eyepottysecret languageunicorn costumewriting on an arm cast (See All) |
A rat named Remy dreams of becoming a great French chef despite his family's wishes and the obvious problem of being a rat in a decidedly rodent-phobic profession. When fate places Remy in the sewers of Paris, he finds himself ideally situated beneath a restaurant made famous by his culinary hero, A β¦uguste Gusteau. Despite the apparent dangers of being an unlikely - and certainly unwanted - visitor in the kitchen of a fine French restaurant, Remy's passion for cooking soon sets into motion a hilarious and exciting rat race that turns the culinary world of Paris upside down. (Read More)
Subgenre: | computer animationslapstick comedyfish out of watercgi animation |
Themes: | death of motherghostdeathlovefriendshipjealousydrinkingdrunkennesstheftobsessionabductioninheritancestarvation |
Mood: | rain |
Locations: | tunnelbicycleboatmotorcyclerestaurantparis francekitchenfrancerooftopsewerfrench restaurant |
Characters: | father son relationshippolicefriendbrother brother relationshipbrother sister relationshippolicemanlawyerthieffrenchuncle nephew relationship |
Story: | cheesetalking animalsleepingratlightningold womaneatingrescuefoodvoice over narrationtitle spoken by characterone word titledogviolenceinterview β¦flashbackkissknifechasetelephone callfireface slapshotgunwatching tvdrinkbookriflerunningcaferiverreporternewspapercookingwinewomanpainteranimalunderwater sceneroommateconfessionpoisonstorytellingblindfoldwaitereggtold in flashbackcookblockbusterchefanimal attackstreet lifefood in titlegas maskanthropomorphismanthropomorphic animalhungerevacuationrainstormchildhood memorynew jobhairapparitionsuccesseiffel tower parislast will and testamentbreadfalling into waterimaginary friendsoupchandelierdnamushroomsense of smellbreaking a windowgarbagetomatoheirpuppetryorchestral music scorepun in titleroller skatesin medias resmarketingmotor scooterovenrecipebitingtv show in filmstruck by lightningmotorcycle helmetshellmousetrapomenseine riversinkpesticideseparation from familyrat poisonbargedead ratgourmetla marseillaiseanthropomorphic mousecookbookfancy restaurantfood criticgastronomyomeletpantryspicehealth inspectorstarving artistsense of tastestepladdercleanlinesshaute cuisinesous cheffrench cuisinerotisseriechef's hatfood pornculinary schoolsnack foodculinary artistrat invasiongrowling stomachpots and panspulling someone's hairratatouille (See All) |
In a futuristic Japan, an outbreak of canine influenza spreads throughout the (fictitious) city of Megasaki with the risk of becoming contagious to humans. The city's authoritarian mayor, Kenji Kobayashi, ratifies an official decree banishing all dogs to Trash Island, which is immediately approved d β¦espite the insistence of Professor Watanabe, the mayor's political opponent who states he is close to creating a cure for the dog flu. The first canine deported from the city is a white and black-spotted dog named Spots Kobayashi, who served as the bodyguard dog of 12-year-old orphan Atari Kobayashi, the mayor's distant nephew and ward.
Six months later, Atari hijacks a plane and flies it to Trash Island (now nicknamed "Isle of Dogs") to search for Spots. After crash-landing, Atari is rescued by a dog pack led by an all-black canine named Chief, a lifelong stray. With their help Atari first finds a locked cage that presumably contains Spots' skeleton, but learns that it is not him. They then fend off a rescue team sent by Mayor Kobayashi to retrieve Atari. Atari decides to continue his search for Spots, and the pack decides to help him, but Chief declines because of his refusal to have a human "master". He is then convinced by Nutmeg, a female ex-show dog, to help the boy out of obligation. The pack seeks advice from sage-like dogs Jupiter and Oracle, who surmise that Spots might be held captive by an isolated tribe of dogs rumored to be cannibals.
Meanwhile, Watanabe finally⦠(Read More)
Subgenre: | stop motion animationstop motionconspiracydystopiaepic |
Themes: | angerfearmurderfriendshipsuicidechristmasmoneypregnancyescapecorruptiondepressionwrestlingpoetryadoptioncruelty β¦cannibalismfreedomwritingcouragesamurainarcolepsy (See All) |
Mood: | rain |
Locations: | boathospitalhotelhelicoptercemeteryairplanewaterairportjapancityshiplaboratory |
Characters: | boyfriendtattoojapanese womanbrother brother relationshipgirlsoldierstudentphotographerpriestwarriorjapaneseprofessoramericanuncle nephew relationship β¦mayorfemale scientisttattoo on backjapanese food (See All) |
Period: | futurethe future |
Story: | walkerspotlightcaneshadowparachuteeyeglassesstageratlightningkeysearchflashlightorphancameracat β¦computerrescuecryingvoice over narrationtitle spoken by characterphotographdogviolenceflashbackbare chested malefightexplosionthree word titletelephone callfirelickingunderwearbattleswordarrestbare buttliesunglassesanimal in titlerobothandcuffsislandclassroomriversciencecriminaltelephonescientistsubjective cameraswimmingsurvivalnewspapergangmountainvideo cameramansionmontagebridgepoliticianmapfishchild abusecoffindrawingfictional warbathjourneyvoice overflash forwardpilotlegenddangerprologueprotestpoisonmissionstatueskeletonhangingspeechsplit screenisolationsadnessschoolgirlelectionblindfoldgeneralclassgraffitinewspaper headlinedismembermentsubtitled scenehatesurgeryapplausetv newsloyaltywoundcagelistening to musicquestpropagandascene during opening creditshelmetcomadiseasesecurity camerademonstrationfraudchefdesperationjumping from heightladdertorchfateburialbossbroken legmoralitycultureguardremote controlguestbuddyresearchteamresistancecannibalplaneheadphonesprophecydrummerexileschool uniformenglishbathingairplane crashinfectiondemocracycapturetribeeye patchlanternbroken armextortionkingdompuppyrescue missionsirenowlwrestlerposterdrumsunderdogtranslatorbriberygiving birthpetbeheadingearphonesflag12 year oldkatanabrainwashinggatecremationbandageschemeepisodic structurecartoon dogsuit and tiename callingskirttelevision newsdeportationtrashanimal crueltyinsomniarumorcrashlanguagehospital bedwhisperingunited statesjapanese schoolgirlmegaphoneblackboardwormwhistlingferris wheeldeath penaltydnamonitorslingshotgarbagepoliticaltop secretcrabquarantinemaggotweekendsushioctopusplanoverhead camera shotdumpstervotingtalking dogcartoon catdog moviesilhouettedoormancolonyweight lossgogglesloudspeakerflash cameraoutbreakstory tellingguard dogsolidarityresearcherwhite coathumanwastelandbandanavoicedrinking alcoholfurmuralsignemergencyscrollbanishmentreference to mosesyoung boydog tagmascotmetropolistranslationyoungdoorbellbrain surgerydukesquidnews anchorwearing sunglasses insideawardsserumbubble gumsneezingrendezvousexchange studentstray dogtirewastecompanionentrapmentchimneykidneyordercanineberlincaught in a netrightsoracledog biteheadsetrunwaybamboodog loversockheavy breathingstickpharmaceutical companyabandoned shipanimal protagonistcommunity servicejapanese manlost dogschool expulsionsumo wrestlermen's toiletcontrol roomsailor uniformtext on screenkidney transplantname tagadoptive father adopted son relationshipchopsticks the eating utensilleg in a castclimbing a ladderforeign exchange studentdripping waterrobot dogtask forcedog foodcandlelight vigilkidney failurehair curlersmaster dog relationshipchocolate milkcorrupt mayorjapanese wrestlerman wrapped in a towelblack boxscene during closing creditstake offtesticles slurdog adoptionear piecemissing boywild dogabandoned amusement parkfish as foodimplied male nudityfoot bridgeplastic bottlesumo wrestlingblack dogdog cagedog trackinterspecies friendshippregnant animalhouse petschool newspapercartoon fishlos angeles timesred buttonbiohazard signmaster keybiting an earcartoon ratdog trickface offmad dogman's best friendwolf dogcartoon owlcomputer hackingdog biscuitdog fightspitting out a tooththree piece suitcartoon crabcub reporterred telephonerigged electionwashing a dog (See All) |
This is the tale of Harry Potter, an ordinary 11-year-old boy serving as a sort of slave for his aunt and uncle who learns that he is actually a wizard and has been invited to attend the Hogwarts School for Witchcraft and Wizardry. Harry is snatched away from his mundane existence by Hagrid, the gro β¦unds keeper for Hogwarts, and quickly thrown into a world completely foreign to both him and the viewer. Famous for an incident that happened at his birth, Harry makes friends easily at his new school. He soon finds, however, that the wizarding world is far more dangerous for him than he would have imagined, and he quickly learns that not all wizards are ones to be trusted. (Read More)
Subgenre: | dark fantasycult filmfairy taleepic |
Themes: | monsterghostfriendshipchristmasmoneyheromagicsupernatural powerdysfunctional familycelebrity |
Mood: | night |
Locations: | foresttraintrain stationschool of magic |
Characters: | little girlboyhusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfriendgirlbest friendbullyteacher student relationshipprofessorwitchuncle nephew relationshipaunt nephew relationship |
Period: | 1990syear 1991year 1992 |
Story: | new homefantasy worldlifting someone into the airtalking animaleyeglassesratkeyorphanletterrescuemirrortitle spoken by charactercharacter name in titlebased on noveldog β¦surprise endingslow motion sceneswordbirthdaygood versus evilhalloweensnakechild abuseno opening creditschild in perilcreaturetransformationuniformfirst of seriesmissiondragontough girlbankscarschoolgirlfirst partpowerstrong female characterchessoccultdestinygamehatwitchcraftblockbusterfrogstrong female leadbreakfastdwarfreverse footagebraverycrossbowzoowizardimmortalityboarding schoolstadiumfamily secretowlelfspellinvisibilitylevitationparalysissorcererpotiontrollidentical twinsorchestral music scoresorcerystutteringtrapdoorschool lifeunicornbroomhuman becoming an animalcult figuremagic wandwoman in uniformmysticchild herofemale ghostgiant creaturegrandfather clockbased on young adult novelinfirmarycloaklifting a male into the airmagical mirrorcentaursteam locomotivemirror does not reflect realityevil wizardflying broombrick wallelitismhereditary gift of witchcraftpoetry recitationinvisibility cloakmagical bookattempted child strangulationforced perspectivebad parentsmagical broomstickfictitious sportbad parentingbildungsromanescher stairwayhobgoblinpet as giftquidditchportrait comes to lifetrain platformmagical cloak11th birthdayfaerie talehuman chessboardsnowy owltripping while fleeing (See All) |
Dr. Joe Darrow is a recently widowed doctor. He is grieving due to the death of his pregnant wife in a Red Cross mission in Venezuela. Although being atheist, he began to believe that his dead wife wants to communicate with him, through her young patients in the Pediatrics of a Chicago hospital.
Subgenre: | black comedysuspensesupernaturaltragedymelodramaparanormal phenomena |
Themes: | angerfearghostdeathlovefriendshippregnancydrinkingfuneralsupernatural powerparanoiaguiltgrieffaithdeath of wife β¦panicdyingnear death experienceafterlife (See All) |
Mood: | raintearjerker |
Locations: | tunnelhospitalbarchurchairplanebusairportelevatorvillagewheelchairpolice stationpolice carchicago illinoisjungleschool bus β¦catholic schoolbus accident (See All) |
Characters: | little boylittle girlboyfather daughter relationshiphusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipfrienddoctorchildrenbrother sister relationshipgirlsoldier β¦nursepolicemanbabypriestlawyerbest friendsecurity guardcatholicemployer employee relationshipdeath of boy (See All) |
Period: | 2000s |
Story: | rainbowinsectthunderlightningcandleneighborcameramirrordreamcell phonetitle spoken by characterphotographone word titlesexflashback β¦bare chested maleguncigarette smokingchasesurprise endingtelephone callcorpsemachine guncar accidentslow motion scenedrinkarrestriflebeerhallucinationhandcuffsrevolverriverfoot chaseambulancearmysuicide attemptmapnunbirddrawingunderwater scenegraveyardnews reportdrowninglatex glovesgravepilotcharacter repeating someone else's dialoguewidowerpay phoneproduct placementrace against timedeath of childcrosswaterfallfreeze frameanswering machinerevelationflyingheavy rainscene during opening creditscomapatientcrucifixloss of wifedesperationparking garageback from the deaddrug overdoseattempted suicidepower outageresurrectionevacuationheavenassault rifleheartrainstormtribefemale doctorparrottranslatorapparitiondoubtphysicianinsomniafemale lawyerhearing voicesparamedicstethoscopetoastcolombiaemergency roomjumping into watersleeplessnessrescue from drowningsymboltietrespassingpackagebilingualismrainforestvenezuelabirthmarkred crossmistjumping off a cliffmessengercandelabraends with freeze framedefibrillatorschoolyardbirdcageriver rapidsmemorial servicedragonflyorgan donorwaking up from a comareference to christopher columbuscat scanorgan transplantwhite water raftinglandslidepoegelatinmudslidebrain deadintensive care unitmountain roadtribesmanaid workerair stripanesthesiologistnative nuditylaw professorrockslidejungle tribeflatlininghospital cafeteriabald spotgrief counseling (See All) |
Tokyo's nasty underside, seen primarily through the eyes of Oscar, a heavy drug user, whose sister Linda is a stripper. Oscar also has flashbacks to his childhood when trauma upends the siblings. Oscar's drug-fed hallucinations alter Tokyo's already-disconcerting nights, and after the police shoot h β¦im, he can float above and look down: on his sister's sorrow, on the rooms of a love hotel, and on life at even a molecular level. The spectrum's colors can be beautiful; it's people's colorless lives that can be ugly. And what of afterlife, is there more than a void? (Read More)
Subgenre: | cult filmexperimental film |
Themes: | death of motherfearghostsurrealismdeathlovefriendshipdrugsmoneybetrayaljealousyadulterypregnancyincestdeath of father β¦paranoiadrug usedyingabortionpolice investigationafterlifefear of death (See All) |
Mood: | nightmarenight |
Locations: | tunnelhospitalbarbeachhotelairplanebathtubtaxiairportelevatorapartmentjapanpolice carmotelstrip club β¦love hotel (See All) |
Characters: | grandmother grandson relationshiplittle girlboysingermother daughter relationshipfather daughter relationshipfamily relationshipshomosexualfather son relationshippolicemother son relationshipfrienddoctorbrother sister relationship β¦prostitutepolicemandancerbabybest friendjapanesejewcatholicolder man younger woman relationshipamerican abroadolder woman younger man relationshipgrandfather grandson relationshipgrandmother granddaughter relationshipgrandfather granddaughter relationshipcrying babygo go dancer (See All) |
Period: | future |
Story: | voidbalconysleepingeatingflashlightorphantearsmirrorfooddreamsongcryingsingingphotographblood β¦sexfemale nuditymale nudityviolencefemale frontal nudityflashbackbare chested malegunkissfemale rear nuditycigarette smokingfingeringdancingnipplesknifeleg spreadingchasethree word titlepantiestelephone callfirebeatingcorpseunderwearpenetrationcar accidentshot in the chestface slappunched in the facethongbare buttshootingpaintingbookrunningcar crashdead bodymarijuanasex standing upbathroomhallucinationstripperf wordsubjective cameraswimmingdrug dealercocainetoiletfemale pubic hairnonlinear timelineapologypainterbathritualroommatepoint of viewflash forwardspermdrug addicthotel roomscreamingfired from the jobpay phonecharacter's point of view camera shotmoaninglong takedeath of brotherpursuitchildbirthflowerhatepot smokingspiritflyingmorguebrother sister incestteddy bearpeeping tomstreet lifeback from the deadpromisebuddhistbra and pantiestokyo japanreincarnationpillspastbackstagejunkiestairscigarette lightercellphoneswingdressing roombuddhismlooking at self in mirrorlightexplicit sexg stringset upimperative in titlecremationbreast feedingrepeated sceneexotic dancerpregnancy testroller coasterforeignerdrug dealspreadeagleflareknocking on a doorlsdpsychedelicdance clubsitting on a toiletoverhead camera shotpole dancershared bathurnflashback within a flashbackfetuspole dancingloss of parentswrapped in a toweldrug tripexpatriatetalking to oneselfstrobe lightvoice over inner thoughtsfoster carehashishlife after deathdrug bustoperating roomheartbeatfirst personlullabyaudio flashbackout of body experienceabortion clinicneon lightecstasy the drugimpregnationmodel traincremated remainsdoor lockcarrying a dead bodytrippybowingspoken inner thoughtsblack lightnude dancingshot by the policeflashing lightabortionistacid the druginternmentinner monologuemissing someoneidentifying a dead bodysniffing pantiesdistorted soundchest woundcutting one's fingersex with friend's motherpolice stingtaking off someone's pantiesdoor buzzerfertilizationflushing drugs down a toiletsense of timedead fetusdog toyvaginal examchildhood promisedmtslap on the buttwetting one's pantsfinger in someone's anusflashback within a flashback within a flashbackkissing someone's breastspulling up pantsreference to amsterdam netherlandsspinning camera shotaborted fetusgruntingpulling up panties (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
Subgenre: | live action and animation |
Themes: | angerfeardeathdancemagicmilitarypanic |
Locations: | bicyclemotorcyclebeachsmall townlondon englandvillageenglandcastlejunglemuseumtrain stationsubmarine |
Characters: | little boylittle girlboysingerchildrenbrother brother relationshipsoldierdancermusicianpriestwitchgermanhuman animal relationship |
Period: | world war two1940syear 1940 |
Story: | pet catmetamorphosisbicyclinglifting someone into the airmousepianisttentcandleflashlightorphanlettermirrorsongcryingsinging β¦fightdancingexplosionknifepistolfirebased on bookmachine gunpunched in the facebattleswordbookriflebombrunningbedbritishislandcompetitioncombatsoccerold manfishchilddream sequencefishingkingcigar smokingnecklacetransformationgunshotlibrarybinocularsuniformfantasy sequencerabbitscreampursuitcountrysideunderwaterbearmonkeyapplauseropewaitercaptainentertainmentgrenadebow and arrowathleteflyingspearperformancerageelephantmagiciancaptivetoyenemywitchcraftfraudaudiencepart animationparadecolonelfull moonanthropomorphismshieldexplosiveinvasionanthropomorphic animalevacuationdrummerballcon artistlaughterlionarmorcliffraidsailortrophypigeoncrowdmusic bandposterrefereeplaying cardsimprisonmentspellauntmagic tricknotebookchoreographystreet marketperformergorillatween girlwhistlecrowndrummedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiounsubtitled foreign languagepotionpalm treealligatortrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentkangarooapprenticeliquidanimal that acts humangiraffelockballroomvulturehookmarchstreet vendorbroomretreatscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerleopardlongingostrichvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelinehyenaincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingroarcalypsochorinegoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All) |
When a bottle containing a plea for help from a little girl named Penny makes its way to the Rescue Aid Society, a mouse organization in the basement of the United Nations building dedicated to the rescue and well-being of anyone in need, it is up to the brave mouse Miss Bianca and her chosen partne β¦r, the shy janitor Bernard, to rescue the girl. Searching for clues at Penny's home at Morningside Orphanage in New York City, the two mice discover that the girl has been kidnapped by the evil pawn shop owner Madame Medusa and her companion Mr. Snoops. On the back of Orville the albatross, Miss Bianca and Bernard travel to the terrifyingly gloomy Devil's Bayou where they learn the shocking truth: the innocent young girl is being forced down into a dangerous, dark underground pirate's cave where she must find the Devil's Eye, the world's largest diamond and Madame Medusa's greatest obsession. Before returning safely home, Miss Bianca, Bernard, and Penny will have to combat Madame Medusa's two ferocious pet alligators Brutus and Nero with the help of Ellie Mae and Evinrude the dragonfly, as well as survive the raging tides inside the horrible pirate's cave. (Read More)
Subgenre: | tragedy2d animationpolitical satiredisney |
Themes: | angerfearfriendshipfaithbullyinghopegreedadoptionfalling in loveprejudicejusticecourage |
Mood: | rainaffection |
Locations: | new york citycarairport |
Characters: | little girlfemale protagonistself esteem |
Story: | spiderwebrainbowrunning awaybatcanefogthunderstormmousetalking animalsuitcasesearchorphanprayercatrescue β¦cryingdoginterviewflashbackkissexplosionchasetelephone callbased on bookunderwearshotgunswordfalling from heightliebedsubjective cameragood versus evilmapchild abuseradionews reportumbrellamissionpassionrabbitscreamskeletonthreatsadnesstrapfirst partunderwaterwhippingtrustpoemropeloyaltyhatspiderblockbusterskullteddy bearorphanageembarrassmentanthropomorphismjanitortensiondiamondinnocencestarhatredanthropomorphic animalironynew orleans louisianabroken glassanxietydespairescape attempthit on the headlaughtersuperstitiondynamitelipstickdeerturtlechairlanternboxlightreckless drivingowlshamejoycar troubletableunited nationsbottlesarcasmdiggingearringraftbus stopfalling into waterhugmessageshoewhistlingblizzardcookiekidnapperstatue of liberty new york citymailboxkindnesspotionmale protagonistfriends who live togetheralligatorperfumehammockpawnshopsorrowpitchforkrescue from drowningspoonmoleclumsinessegohandbagdeterminationhungariannoisecurtainbroomexploding boatnightgownchild laborbucketcoatcuriosityfireworkdamagehostilitybayoulazinessleafconfidenceexhaustionimitationstar died before releasecollapsemockerycastle thunderaudio flashbackblameanimal protagonistenthusiasmpsychological abusechild driving a carair ventcuckoo clockhalf dressed cartoon animalriverboatballadeercombtextbookanthropomorphic mousedefiancedragonflytidefishing rodrailgratitudestringfriday the thirteenthcomforthumilitywhirlpoolmisadventurebootfishing polepipe organwater pipepledgediversionalbatrossencouragementimpatienceanthemmessage in a bottlerolling pinbluebirdlost luggagesweepingsmokestackelectrical shockgoofy hollereleganceguide bookrescuermalevolenceelectrical wiresophisticationvalveabandoned boatassertivenessheadlampunderground caverncage elevatorinternational organizationmuskrat (See All) |
300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. β¦.. (Read More)
Subgenre: | cult film |
Themes: | angerfearghostrevengemagicsupernatural powerhumiliationunrequited lovefalling in lovebook of magic |
Mood: | high school |
Locations: | motorcyclecemeterymuseumsewer |
Characters: | little girlbrother sister relationshipteenage girlteenage boyzombiesister sister relationshipbullywitchevil witch |
Period: | 1990s17th century1700s |
Story: | talking cathorror for childrenbicyclingcandylifting someone into the airtalking animalcandlecatcryingsingingtitle spoken by charactertwo word titlecigarette smokingsurprise endingfire β¦bedsubjective cameradecapitationgood versus evilhalloweenhousetied to a chairtransformationpainvirginproduct placementdeath of childscreamscene during end creditshanginghalloween costumecabinhaunted houseundeadfalling down stairsburned alivehatwitchcraftspidertorchsevered fingerrejectionimmortalityhypnosischairhalloween partyarrogancemale virginspelldead animaltrick or treatingdoubtlightertombstonecottageshoerhyme in titlecabin in the woodssunrisepotionwarningnoosebus rideblack catpillowsaltlobsterwitch costumeliquidvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumelifting a female into the airroadkillcaged humanspit takechased by a dogevil laughterpet foodblown coverflying broomcurseddisbelieving adultlightingsiren the alarmsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettsmagical broomstickwitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All) |
The passage from this world to the fantasy kingdom of Stormhold is through a breach in a wall beside an English village. In the 1800s, a boy becomes a man when he ventures through the breach in pursuit of a fallen star, to prove his love for the village beauty. The star is no lump of rock, it's a ma β¦iden, Yvaine. Tristan, the youth, is not the only one looking for her: three witches, led by Lamia, want her heart to make them young; and, the sons of the dead king of Stormhold want her because she holds a ruby that will give one of them title to the throne. Assisting Tristan are his mother, the victim of a spell, and a cross-dressing pirate of the skies. Will Tristan win his true love? (Read More)
Subgenre: | cult filmcoming of ageepicswashbucklersword and fantasy |
Themes: | ghostkidnappingsurrealismmurderdeathlovebetrayalescapemagicunrequited lovehopedyingcourage |
Locations: | snowforestbeachbathtubvillagestorm |
Characters: | boyfriendteenage boybabywitchyounger version of characterevil witch |
Period: | 1870s1850s |
Story: | cheesethundermousesleepinglightningeatingcandleletterrescuemirrorfoodvoice over narrationtitle spoken by characterone word titlebased on novel β¦f ratedviolenceflashbackkissdancingexplosionchasefirehorseblondeswordfalling from heightrunningbirthdayscientistgood versus evilsword fightdeath of friendno opening creditsbirdcoffinbathunderwater scenekingprincesstransformationconfessionattempted murderargumentprologuerace against timedeath of brotherdeath of sontied upflowercross dressingqueenmoonprincepirateballoongothiccageelephantwitchcrafthonorslavetelescopemisunderstandingensemble castinsultlightstick fightmannequinhappy endinginvisibilitydead animaltowerblonde womancrownbroken mirrorfencingmeat cleaverimplied sexlong brown hairstaffcupwaltzstickcrossroadsliverblue blooddeath of kingtied togetherpushed off a cliffintestinemusic score features choirevil princesilver dress (See All) |