Best popular movies like Corpse Bride:

Do you need specific genre & keyword selection to find films similar to Corpse Bride?
<< FIND THEM HERE! >>

Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Corpse Bride (2005)

Set back in the late 1800s in a Victorian village, a man and woman by the names of Victor Van Dort and Victoria Everglot are betrothed because the Everglots need the money or else they'll be living on the streets and the Van Dorts want to be high in society. But when things go wrong at the wedding r β€¦ehearsal, Victor goes into the woods to practice his vows. Just as soon as he gets them right, he finds himself married to Emily, the corpse bride. While Victoria waits on the other side, there's a rich newcomer that may take Victor's place. So two brides, one groom, who will Victor pick? (Read More)

Subgenre:
gothic horrorpuppet animationdark fantasystop motion animationstop motionblack comedycult film
Themes:
beyond deathafterlifeabuseangerjealousyghostsurrealismrevenge
Locations:
woodschurch
Characters:
villainzombie
Period:
19th century
Story:
angry motherangry fatheranger issuesreunited familyrefusing to believeabusive parentshatefulfishmongerhot temperblack widowbranchex husbandbad temperscaredinterrupted wedding β€¦disembodied handfolk talepoisoneddecomposing bodyangryhorror for childrenabusive mothersnobproposalex wifeclumsinessstutteringdisembodied headmusketmaggotmeat cleavergroomeyeballwormunderworldfencingdead dogliving deadtorso cut in halfarrogancehorse and carriageabusive fatherwedding ringfat manbutlerresurrectionarranged marriagehatredbridegossipspidergothichateundeadeuropeskeletonevil manpoisoncandlewinepianopaintingswordcorpsefiretitle spoken by characterdog (See All)

The Brothers Grimm (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brothers Grimm (2005)

Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β€¦ing genuine courage. (Read More)

Subgenre:
dark fantasyblack comedycult filmsupernaturalfairy taleslapstick comedy
Themes:
ghostrevengesurrealismmurderdeathkidnappingmoneybetrayalprisondrinkingfeartorturedrunkennessescapemonster β€¦deceptionmagicmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All)
Mood:
rainnightmare
Locations:
woodschurchforestsnowcemeterysmall townvillagecastlecavegermany
Characters:
mother son relationshipfather daughter relationshipfriendbrother brother relationshipboyprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove trianglewarrior β€¦witchmayorfrench soldier (See All)
Period:
19th century1810s
Story:
decomposing bodymaggothorse and carriageresurrectiongothiccandlewineswordcorpsefiretitle spoken by characterdogcharacter name in titlebloodviolence β€¦flashbackgunkissfightdancingexplosionknifethree word titlepistolunderwearfoodhorsemirrorshot in the chestshot in the headrescuecatdrinkbattlearrestfalling from heightbookriflerunningbedinterrogationhallucinationshot in the backdecapitationbound and gaggedold manaxestabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsnakesevered headman with glassestrialanti heroanimaldrawingchild in perildouble crossritualkingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralfireworksqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundcagelifting someone into the airhatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfemale warriorfull moonguardreverse footagecrossbowinsectstairscon artistdungeonshadowarmorsnowinglanternlaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanyraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsetorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Nightmare Before Christmas (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Nightmare Before Christmas (1993)

Jack Skellington, the pumpkin king of Halloween Town, is bored with doing the same thing every year for Halloween. One day he stumbles into Christmas Town, and is so taken with the idea of Christmas that he tries to get the resident bats, ghouls, and goblins of Halloween town to help him put on Chri β€¦stmas instead of Halloween -- but alas, they can't get it quite right. (Read More)

Subgenre:
puppet animationstop motion animationstop motionblack comedycult filmholiday horror
Themes:
ghostchristmasmonstersupernatural powerunrequited love
Locations:
woods
Characters:
vampirewitchmayorghost dog
Period:
1990s
Story:
horror for childrengothicskeletoncorpsefiredogfalling from heighthalloweenfour word titlesnakeno opening creditsgraveyarddollchristmas treewerewolf β€¦mad scientistpresumed deadvisionpumpkinelfmummycartoon dogsplit personalityholiday in titlereindeerfamous scoremicroscopeguillotinejack o'lanternhunchbacksnowglobesleighmistrusteaster bunnytitle based on poemchristmas in dangerpumpkin headornamentevil toygarlandglowing eyehalloween songhollysaving christmaspet as gifttwo headed person (See All)

Sleepy Hollow (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sleepy Hollow (1999)

The curse of the headless horseman is the legacy of the small town of Sleepy Hollow. Spearheaded by the eager Constable Ichabod Crane and his new world ways into the quagmire of secrets and murder, secrets once laid to rest, best forgotten and now reawakened, and he too, holding a dark secret of a p β€¦ast once gone. (Read More)

Subgenre:
gothic horrordark fantasyblack comedycult filmfish out of watersteampunkamerican horrorsupernatural horroradult fantasy
Themes:
beyond deathjealousyghostrevengemurdermarriageprisonpregnancytortureheroinvestigationsupernatural powergreedmurder of familyamerican revolution β€¦american mythology (See All)
Mood:
gorenightmare
Locations:
churchnew york citycemeteryfarmtowntown bully
Characters:
husband wife relationshippolicedoctorserial killerdetectivebullywitchsniper rifle
Period:
18th century1700s
Story:
torso cut in halfspidergothicswordfiretitle spoken by characterbloodflashbackdreamblood splatterhorsedecapitationsword fightaxestabbing β€¦impalementsevered headcoffinchild in periltreelegendbased on short storycourtwighauntingloss of fatherblindfoldloss of mothercult directordismembermentsplatterchild murderoccultfaintinglifting someone into the airwitchcraftskullfaked deathcommunityveteranfight to the deathstabbed in the leghit on the headautopsypumpkinblack magiccrowhorseback ridingspellbeheadingscene before opening creditslast will and testamentevil spiritoutsidernaivetystepmothercornfieldpotionscarecrowfeverstabbed in the shoulderwindmillorchestral music scorerepeated linescytheman with no namejack o'lanterncontrolexpressionismbeetleflintlock pistolstagecoachsliced in twocardinal the priesttorture chamberheadextreme closeuphuman skullhorsemanjealous boyfriendmysterious eventsbased on legendconstablemagistratefainting manhorseback1790sdedicationnotarysororicidethrowing a knifegerman expressionismiron maidenjealous manjealous ragegeorgian eraheadlessarachnophobiaheadless horsemanportal to helldown blousedragged by a horseoptical illusionhorseback chasecovered bridgeknife in the thighkiss of deathamerican literatureflock of sheepflying batcostume horrorjumping from a moving vehicleautopsy roomman faintingquill pensleepy hollow new yorkmarriage certificatereference to washington irvingsharpened teethamerican folkloregathering woodgeorgian fashionlegendary characterlevitatingreference to ichabod cranereference to the legend of sleepy hollowwashington irvingchases on horsebackrecapitationshakingankhdesaturated colorsplaying a violinspinning camera shotwax sealdoor in the floorhessianjealous suitorparent killed in front of childtricome (See All)

Dracula Untold (2014) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula Untold (2014)

At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk β€¦s at a terrible cost. (Read More)

Subgenre:
tragedychrist allegory
Themes:
revengesurrealismmurderdeathlovesuicidekidnappingbetrayalfeardeceptionbrutalitysupernatural powerdeath of motherhopedeath of wife β€¦self sacrificemythologynear death experience (See All)
Locations:
woodschurchforestlondon englandcastlecave
Characters:
husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampirewarrioraction heroself mutilationex soldierself healingblood lust
Period:
15th century
Story:
decomposing bodyresurrectionhatredspidergothicskeletonevil mancandleswordcorpsefirecharacter name in titlebloodviolenceflashback β€¦bare chested maleexplosionknifechasesurprise endingvoice over narrationbeatingblood splatterhorserescueslow motion scenepunched in the facebattlefalling from heightshowdownhand to hand combatrunningdemonrivercombatsubjective cameragood versus evilsword fightambushaxemassacremountainthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in periltransformationon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingperson on firecharacter's point of view camera shottentlightningshot in the shoulderscarcrossthreatened with a knifedirectorial debutsevered armgeneralbare chested male bondagerefugeesubtitled scenebattlefieldfreeze frameprincestylized violencemaniacdestinywolfbow and arrowburned alivehead buttspearheavy rainhelmetcrucifixloss of wifeskulltorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequenceevacuationfalling to deathimmortalitythunderstormstabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armorsuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Prophecy (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Prophecy (1995)

"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit β€¦ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)

Subgenre:
dark fantasyblack comedycult filmindependent filmsuspensechristian horrorreligious horror
Themes:
jealousysurrealismmurderdeathkidnappingreligionbetrayalfearescapefuneralinvestigationdeceptionpsychopathbrutalitysupernatural power β€¦paranoiadepressioninsanitysadismevilhopepanicdyingapocalypsecannibalismhomelessnessdevilmurder of a police officernear death experienceghost townreligious conflict (See All)
Mood:
neo noirarchive footagedarkness
Locations:
churchhospitalschoolcemeterysmall townlos angeles californiadesertapartmentpolice stationpolice carrooftopcatholic churchschool busschool teacher
Characters:
zombiepoliceteachergirlsoldierpolice officernursedetectivepolicemanpriesthostagechristianlittle girlnative americanwaitress β€¦christianitypolice detectiveteacher student relationshipbiblesheriffgrandmother granddaughter relationshipcatholic priesthomeless mancoronerdeath wish (See All)
Period:
1990s
Story:
maggotliving deadarroganceresurrectiongothicundeadskeletonevil mancorpsefiretitle spoken by characterbloodviolenceflashbackgun β€¦kissfightcigarette smokingphotographexplosionknifesurprise endingvoice over narrationcryingbeatingshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewritten by directorbrawlfalling from heightshowdownheld at gunpointsunglassesdead bodydemonhallucinationhandcuffsprayerrevolvershot in the backgood versus evilsurvivalorphanflashlightcaliforniaambulanceimpalementsuicide attemptdinerdisarming someonecoffinnarrationchild in perilhit by a carfictional wardouble crossritualpolice officer killedgraveyardshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerperson on fireliarfirst of seriesmissionpossessionangelrace against timestatuecover upknocked outmanipulationexploding bodyfirst partprofanitygrandmothernewspaper headlinekillinghenchmanpizzamaniacpickup truckburned aliveelectronic music scoreshot in the stomachsociopathscene during opening creditsmorgueskullmind controlcolonelback from the deadcrime scenevisioncynicismcannibalmercilessnessprophecyreference to satanbible quoteheavenhit on the headpunched in the chestjumping through a windowthrown through a windowautopsyaerial shotarizonachoirsoulhealingeye gougingtribebody landing on a cardemonic possessionkilling spreeburned to deathexorcismnewspaper clippinglyingtelepathyclose up of eyesgothporn magazinelevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyshamanburnt bodybadgesymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingchantingtauntingchild with a gungrand canyoncourt martialluciferinvulnerabilitysatanhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithpyrokinesiskorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintpersonification of satandark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All)

The Mummy (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Mummy (2017)

Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.

Subgenre:
dark fantasyblack comedymartial artssupernaturalparanormal phenomenamonster movie
Themes:
angerghostsurrealismrevengemurderdeathfriendshipkidnappingbetrayalfearescapemonsterdeceptionmagicmilitary β€¦seductionsupernatural powerparanoiaredemptionsurveillanceevilpaniccourageself sacrificenear death experiencemurder of familyunlikely heroegyptian mythology (See All)
Mood:
darknesshorror movie remake
Locations:
woodschurchtrainforesthelicoptercemeteryairplanebusdesertlondon englandpolice carrooftopmuseumlaboratorytunnel
Characters:
zombiepolicedoctortattoosoldierpolice officerpriesthostagethieftough guywarrioraction herosecurity guardprofessoramerican abroad β€¦self mutilationbabe scientistamerican in the uk (See All)
Period:
2010s
Story:
decomposing bodyliving deadresurrectionspidergothicundeadskeletoncorpsefiredogbloodviolenceflashbackbare chested malefemale rear nudity β€¦fightexplosionknifechasesurprise endingpistolshootoutbeatingdreamshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestface slapremakeshotgunrescueslow motion scenepunched in the facebattlegunfightbrawlbare buttshowdownheld at gunpointbeerhand to hand combatsunglassescar crashhallucinationcombatscientistshot in the backsubjective cameragood versus evilfoot chaseflashlightambushstrangulationaxemassacreambulancedeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestsubwayman with glassesno opening creditsanti herodisarming someoneone man armycoffinassassinationdouble crossritualunderwater scenekingpolice officer killedfemme fatalenews reportshot in the legprincessdrowningtransformationflash forwardattempted murderpilotcursebinocularscharacter repeating someone else's dialoguebeaten to deathdangerprologuescreamingelectrocutionattackfantasy sequencecharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outlightningopening action scenemanipulationscarinjectionlaptopratthreatened with a knifemercenarypubsubtitled scenebattlefieldpowerak 47pickup truckmissiledestinyhand grenadegrenadedestructionassassination attempthypodermic needletape recordersecurity camerawalkie talkiemad scientisttreasuremorguesergeantkicked in the stomachvillainesspoolskullknightmind controltorchfateburialcolonelback from the deadiraqgun battleguardrampagecrime scenereverse footagemiddle eastvisiontarget practicebraveryu.s. armyconstruction sitefight to the deathpartnermercilessnesspower outageegyptstabbed in the neckevacuationimmortalityescape attemptspecial forcesstabbed in the legpunched in the chestairplane crashaerial shotparachutewisecrack humorcapturebulletproof vestdemonic possessionblack magictelekinesisdaggerstick fightmoral dilemmamedia coveragetelepathycrowclose up of eyestombsidekickalleyfinal showdownburied alivetasermummyconstruction workerpistol whiphuman monsterarmored carhuman sacrificeworld dominationdronecomic reliefsecret societymegalomaniacold flamesplit personalityfilm starts with textartifactpatricideman kills a womanoffscreen killingbitten in the neckmacguffinwoman kills a manaltered version of studio logoheirchainedarcheologistopen endedalter egowoman fights a manimmortalmatricidesubterraneangodwoman slaps a manjewelcockney accentmind readingimprovised weaponcar rolloverancient egyptarmy basechosen onestupid victimrelicbilingualismdeal with the devilthronemad doctorsecret roomfratricidecryptinfanticideregenerationtragic villainwomen's bathroomarchaeologistenglishwoman abroadsecret organizationbig ben londonzero gravityman fights a womanair strikecorporalcollapsing buildingserumpharaohharpoonsandstormrebootfragments of glassmultiple personality disordertreasure hunterexcavationpharoahhit with a car doorburied treasuresecret laboratoryexplosive decompressionarcheological digevil godjekyll and hydelondon undergroundjackhammerrubyinsurgentflipping caryin and yanglondon eyeairplane pilotcargo planecatacombcrusaderlovecraftianreanimated corpsereboot of seriessoldier of fortunebookshelfgemstonesarcophagusmercurycontemporary settingrogue soldierfaustianhieroglyphicsegyptian godsecret lairlondon busheir to thronemilitary operationliterary charactersecret chamber1190sburial sitefemale archeologistdark universemonster hunter (See All)

The Phantom Of The Opera (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Phantom Of The Opera (2004)

Begins when an opera ghost terrorizes the cast and crew of the French Opera House while tutoring a chorus girl. He finally drives the lead soprano crazy so she and her friend leave. The girl is able to sing lead one night but the soprano doesn't want her show stolen so she comes back. The ghost dema β€¦nds they keep giving his protege lead roles. Meanwhile, His pupil falls in love with the Vicomte de Chagny, but the Phantom is in love with Christine, his student. The Phantom is outraged by their love and kidnaps Christine to be his eternal bride. Will Raoul, the Vicomte, be able to stop this dastardly plan? (Read More)

Subgenre:
gothic horror
Themes:
ghostmurderdeathkidnappingheroobsessionunrequited lovetheatre
Locations:
snowcemeteryparis francewheelchairrooftop
Characters:
singerdancermusician
Period:
19th century1910s1870s
Story:
horse and carriagebridegothiccandleswordfiretitle spoken by characterbased on novelflashbackdancingexplosionsingingvoice over narrationhorsemirror β€¦face slapremakeslow motion scenemaskoperasword fightno opening creditsforeign language adaptationgraveyardcostumekeyproduct placementringstageunderwaterropeheroinefaintinglifting someone into the airtold in flashbacktorchbackstagetheatre audienceroseblack and whitedisfigurementdressing roomauctionchandelieropera singerdisfigured facemasked villainflashback within a flashbackbreaking a mirrorballroomtragic villainblack and white segues into colorchorusred rosecarrying someonebased on stage musicalyear 1919falling chandeliertheatre boxstagehandsecret laircolor segues into black and whitethrough the mirrorbased on stage musical based on novel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Coraline (2009) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Coraline (2009)

When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true.  β€¦When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)

Subgenre:
puppet animationdark fantasystop motion animationstop motioncult film
Themes:
angerghostsurrealismkidnappingfearmonsterlonelinessdeath of mothertheatre
Mood:
rainnightmaremoving
Locations:
woodsforestsnowmotorcycleboatbicycletexastunnel
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipsingerboyfemale protagonistactresslittle girllittle boygrandmother grandson relationshipmermaiddisappearance of one's father
Story:
horror for childrencandlepianotitle spoken by characterdogcharacter name in titlebased on novelbloodone word titlephotographsingingvoice over narrationcryingcell phonesong β€¦dreamfoodmirrorrescuecomputercatcameralettertearsneighborprayerorphanbedroomflashlighteatingdinnersearchold womankeybuxomangelsuitcasedolltentlightningflowerspianistdisappearanceratstagegardensleepingreference to william shakespearepizzacircuseyeglassesteafireplacetalking animalcakelifting someone into the airmouseeccentriccannoncorsetthunderticklingimpostorpet dogchild protagonist3 dimensionalinsecttheatre audiencescissorsthunderstormscene after end creditsparachutefogshadowbalconycanepajamaslaptop computerbatreflectioncandyforename as titleneedlestuffed animalrunning awayglovesold dark housespiral staircaseeyebicyclingbugsleeptheatre productionfantasy worldmetamorphosischeesemichiganacrobatclueoregonrainbowbechdel test passedgame playingsewingriddlesecret passagepet catclothing storehide and seekspotlightcat and mousebeetleblue hairsecret doorsnowglobeshakespearean quotationghost childlemonadetalking catfortune tellingwalkeralternate worldmoving vannew homecotton candystuffed animal toymilkshaketrapezetoy trainwallpaperslugspiderwebvoidparallel worldshummingbirdpraying mantisold mansionsearch for parentthreadplayer pianoknitting needlemirror as portalgarment buttonpeeling skincataloguehigh diveseashell bikinimechanical handbig topdowsing rodskipping stonemoving crewtea leavesblowing a raspberrybreaking mirrorlorgnettestuffed toy dogdowsingeye cut outpoison oaktoy chestwell shaft (See All)

Hocus Pocus (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hocus Pocus (1993)

300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. β€¦.. (Read More)

Subgenre:
cult film
Themes:
angerghostrevengefearmagicsupernatural powerhumiliationunrequited lovefalling in lovebook of magic
Mood:
high school
Locations:
motorcyclecemeterymuseumsewer
Characters:
zombiebrother sister relationshipteenage girlteenage boysister sister relationshiplittle girlbullywitchevil witch
Period:
1990s17th century1700s
Story:
horror for childrenarrogancespiderundeadcandlefiretitle spoken by charactertwo word titlecigarette smokingsingingsurprise endingcryingcatbedsubjective camera β€¦decapitationgood versus evilhalloweenhousetied to a chairtransformationpainvirginproduct placementdeath of childscreamscene during end creditshanginghalloween costumecabinhaunted housefalling down stairsburned alivetalking animallifting someone into the airhatwitchcrafttorchsevered fingerrejectionimmortalityhypnosischairhalloween partymale virginspellcandydead animaltrick or treatingdoubtlighterbicyclingtombstonecottageshoerhyme in titlecabin in the woodssunrisepotionwarningnoosebus rideblack catpillowsaltlobsterwitch costumeliquidvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumelifting a female into the airroadkillcaged humanspit taketalking catchased by a dogevil laughterpet foodblown coverflying broomcurseddisbelieving adultlightingsiren the alarmsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettsmagical broomstickwitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All)

League Of Extraordinary Gentlemen, The (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

League Of Extraordinary Gentlemen, The (2003)

Renowned adventurer Allan Quatermain leads a team of extraordinary figures with legendary powers to battle the technological terror of a madman known as "The Fantom." This "League" comprises seafarer/inventor Captain Nemo, vampiress Mina Harker, an invisible man named Rodney Skinner, American secret β€¦ service agent Tom Sawyer, the ageless and invincible Dorian Gray, and the dangerous split personality of Dr. Jekyll/Mr. Hyde. (Read More)

Subgenre:
cult filmmartial artssuperherosupernaturalsteampunk
Themes:
murderdeathsuicidebetrayalfuneralmonsterherounlikely hero
Locations:
carcemeteryparis francelondon englandseaitalyenglandafricagermanysubmarineu boatbar shootout
Characters:
villaindoctorhostagevampireaction heroamericandeath of herowitch doctor
Period:
19th centurywinter1890s
Story:
decomposing bodyfencingeuropeskeletonevil manpoisonpaintingswordtitle spoken by characterbased on novelbloodviolencefightexplosionknife β€¦chasesurprise endingpistolshootoutshot to deathfistfightmachine guncar accidentmirrorshot in the headshotgunrescuegunfightbrawlfalling from heightmaskbased on comicshowdownriflehand to hand combatbombrevolverscientistsword fightbased on comic bookold manaxedisguisestabbingimpalementmixed martial artsstabbed in the chestanti herodisarming someonepolice officer killedgraveyardtransformationfive word titleduellibrarystabbed in the backperson on firemissionkicked in the facetankopening action scenebankshot in the shoulderautomobileunderwatersecret agentberlin germanymissileshavingsabotageexploding buildingcarnivalburialcrushed to deathadventurertensiontarget practiceimmortalityknife fightalternate realitycapturetigerknife throwingmutationsword duelsecret identitydc comicsflamethrowermain character diesbatvictorian erainvisibilitystabbed in the handtimebombstrongmanfreaksuper powersfemale vampireadventure herodouble barreled shotgunsplit personalityfortressgramophonevenice italybitten in the necksuperhero teamvehiclepotionaltered version of studio logosiberiakenyademolitioninfiltrationsherlock holmeswinchester riflerepeating riflementor protege relationshiphinduismportrait paintingflame throwerchemistryfireworkstudio logo segues into filmsharpshooterdark heroinemediterraneaninvisible mantarget shootingreference to napoleondead sonsea captainvampire bitejekyll and hydelegendary herolead actor's last filmelixirdual personalityradical transformationarch villainsword canedirigibleends with funeralsuicide pillyear 1899muscle growthexcessreference to tom sawyerfoundrywarmongercaptain nemodorian grayliterary figureworld destructiongreat white huntermarksmanship (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Beauty And The Beast (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Beauty And The Beast (2017)

Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β€¦hanted. (Read More)

Subgenre:
dark fantasycoming of agetragedyfairy taleslapstick comedyfish out of waterdisneybased on fairy tale
Themes:
jealousyrevengesurrealismlovekidnappingfearescapedancemonsterdeceptionmagicobsessionsupernatural powerdeath of motherblackmail β€¦redemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All)
Mood:
poetic justice
Locations:
woodsbarforestsnowparis francebathtubvillagefrancelakecastlerooftop
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipsingerfemale protagonistbabyhostageartistlove trianglelittle boymaidwitchgrandmother grandson relationship β€¦single fatherex soldier (See All)
Story:
musketbutlercandlepianopaintingswordcorpsefiretitle spoken by characterdogcharacter name in titleflashbackbare chested malekissfight β€¦dancingphotographexplosionsingingpartychasesurprise endingpistolvoice over narrationbeatinghorsemirrorshot in the chestremakerescueslow motion scenepunched in the facebattlekissingbrawlfalling from heightshowdownrifleheld at gunpointbedshot in the backbedroomsword fightmountaindisguisewomanmontagebridgefour word titlemapfalse accusationno opening creditsbirddrawingcontroversykingcreaturetransformationbartenderflash forwardattempted murderlibrarycursedangerprologuewidowerrace against timeknocked outlightningmanipulationwigtied upgardencabinloss of motherlove interestreference to william shakespearequeenprincesingle parentchesswerewolficeropefalling down stairswolffireplacedressheroineheavy raintalking animalhunterloss of wifeblockbustereccentriccomposerservantjumping from heightculture clashstrong female leadcgitorchcompassionanimal attackclockfull moonanthropomorphismfight to the deathinventorfalling to deathescape attemptballensemble castrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monsterspiral staircasemarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillfamous scoreclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstudio logo segues into filmstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All)

The Great Mouse Detective (1986) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Great Mouse Detective (1986)

In Victorian London, England, a little mouse girl's toymaker father is abducted by a peglegged bat. She enlists the aid of Basil of Baker Street, the rodent world's answer to Sherlock Holmes. The case expands as Basil uncovers the crime's link to a plot against the Crown itself.

Subgenre:
2d animationdisney
Themes:
angersurrealismkidnappingdrunkennessinvestigation
Mood:
rainnight
Locations:
london englandcastlebar brawl
Characters:
villainfather daughter relationshipdetectivethiefgirl crying
Period:
19th century1880s
Story:
anger issuesbad temperangrywinetitle spoken by characterdogbased on novelsingingcryingsonghorsecatbattletearsanimal in title β€¦robotcriminalgood versus evilnewspaperbound and gaggeddisguisekingratqueenmaniacprivate detectiveflyingballoontalking animalhatroyaltymousevictimfemale tied upclockeaten aliveanthropomorphismanthropomorphic animalfalling to deaththunderstormfallshadowmustachekingdomanimal name in titlemudbatbanditvictorian erasidekickfinal showdownfountaintelling someone to shut uptreasonlizardmachinemegalomaniaccrownbellassistantfallingkickrobefriends who live togetherfinal battlecaperedpart computer animationoutlaw gangsherlock holmesfootprintbitehumankidnapbig ben londoncriminal mastermindcigarette holderwine bottleharpdirected by several directorsmale tied upchorusmousetrapcompanionreference to sherlock holmesreference to napoleoncastle thundercrying childmammalanthropomorphic mouserodentcockneytoy makercitizenreference to queen victoriacat versus mousebasset houndarch villainclaw fightegomaniacright hand mansinging animalgang that lives togetherlosing tempercat versus dogbig bentalking mouseimpersonating a soldieranimal villainanger anonymousdr watsonyear 1887talking ratbad temperedbroken wing (See All)

King Arthur: Legend Of The Sword (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
dark fantasyblack comedymartial artscoming of agesupernaturalsword and sorcerysword and fantasychrist allegoryrevisionist history
Themes:
angerjealousyrevengesurrealismmurderdeathfriendshipkidnappingmoneybetrayalprisonfearescapefuneralmonster β€¦deceptionmagicrobberydeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All)
Mood:
rainnightmaredarkness
Locations:
woodsforestboatlondon englandwatervillageenglandlakeshipcastlecavebrothelsewer
Characters:
husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy β€¦maidwitchuncle nephew relationshipmermaidself doubt (See All)
Story:
hatredevil manpoisoncandleswordcorpsefiretitle spoken by characterdogcharacter name in titlebloodviolenceflashbackbare chested malefight β€¦explosionknifechasesurprise endingbased on bookbeatingshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphangangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivecharacter's point of view camera shotknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Grand Budapest Hotel (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Grand Budapest Hotel (2014)

GRAND BUDAPEST HOTEL recounts the adventures of Gustave H, a legendary concierge at a famous European hotel between the wars, and Zero Moustafa, the lobby boy who becomes his most trusted friend. The story involves the theft and recovery of a priceless Renaissance painting and the battle for an enor β€¦mous family fortune -- all against the back-drop of a suddenly and dramatically changing Continent. (Read More)

Subgenre:
black comedyconspiracyabsurdismmadcap comedy
Themes:
jealousymurderdeathfriendshipmarriagemoneyprisonescapeweddingracismtheftpsychopathhumiliationpoetrygreed β€¦wealthinheritanceprison escapeescape from prisonmurder of sister (See All)
Locations:
churchtrainswimming poolhotelsnowmotorcyclecemeterybathtubbusbicycletaxielevatorcourtroomrooftopgas station β€¦museumsewercable cartwo on a motorcyclehotel kitchen (See All)
Characters:
policemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshiptattooboybrother sister relationshipsoldierpolice officerpolicemanwriterlawyersister sister relationshipthief β€¦artistlittle boymaidfrenchgermanolder woman younger man relationshippolice arrestbaker (See All)
Period:
1980s1960s1930swinteryear 1968year 1985
Story:
poisonedbutlerbridehateeuropepoisoncandlewinepaintingcorpsetitle spoken by characterdogsexfemale nudityblood β€¦male nudityviolenceinterviewflashbackbare chested malegunkisscigarette smokingphotographsingingknifechasepistoltelephone callcryingshootoutfoodface slappunched in the facecatarrestgunfightsecretletterbookrifletearsplace name in titlerunningbirthdaydead bodyreference to jesus christtelephonef wordsubjective cameradecapitationbisexualfoot chasegay slurnewspaperorphanflashlightold manstrangulationaxemountainstabbingmontageeatingarmywidowstabbed to deathprisonerimmigrantnonlinear timelinejudgesevered headnuntrialno opening creditspaintercoffindrawingfictional warbathvoice overold womanmarriage proposallooking at the cameratalking to the cameragunshotflash forwardconfessiontheatergraveauthorhotel roombinocularsuniformpay phonechampagnefugitivestatuepursuitgiftwitnessratcinemahandgunrefugeetypewriternewspaper headlinehenchmanflirtingeyeglassespoemwaiterfarcelawtreasurehidingwatching a movienosebleedphone boothservantaudienceladderpart animationfollowing someonemonkguardbloody noseattorneytelescopesevered fingerguestanimated sequencetitle appears in writingblack and white scenerosedeath of sisterblack eyefascismconvictskiingcliffsnowinglanternsirenpajamaspipe smokingimprisonmentman cryingbeing followednarrated by charactersaving a lifepresentbarking doghandshakemonasterypost warspiral staircaselast will and testamentsubtitlesalarmpolice chiefmotorbikeconfessionalsecret societytombstoneborder crossinghideoutjuryflaskold ladyfall from heightcookiebunk bedcripplesense of smellcheesedocumentheirperfumevanitycowardprison breakcodetelegraminmatereading a newspaperfacial scarspaplancarouseldead catblack catfiring squadmonumenteastern europefirst person narrationmemorialalpstoy gunhappy birthday to youtrapdoormerry go roundflashback within a flashbackstaffcaskettear on cheekwedding gownmentor protege relationshiptennis courtcentral europeluggagemultiple time framesbirthmarkfictional countrysledfingerreading a lettersuit of armortrolleyhooded figureoathstreetcarturbanhaypassenger trainvisawillalibiart theftskiersnitchobservatoryhotel lobbyborder guardmotorcycle ridingcologneluxury hotelpenis slurstabbedon the lamspeakerconciergeinternment campswitchhit with a rifle buttbullhornpastrywall safebellhopabbeyexhibitbondthree sistersconfession boothhotel ownerdeath squadspeaking to audienceyear 1932depositionscentstolen paintingcatacombsrope ladderknocking on doorpantrytrap doordumbwaiterelevator operatorpastry chefdelivery truckpushed off a cliffsleddingpastry shopski jumpkissing a dead bodyshoeshine boywicker basketpersian catpompositybobsledlaundry chuteloaf of breadstrychninebunkclubfoothanging from a ledgepolice whistletalking to a corpsesommelier84 year oldcoat checklying in statevaluable paintingchapter titlespastry boxreference to egon schiele (See All)

47 Ronin (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

47 Ronin (2013)

While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga β€¦to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)

Subgenre:
dark fantasyconspiracytragedysword and sorceryepicsword and fantasy
Themes:
ghostrevengesurrealismmurderdeathsuicidekidnappingescapeweddingmonsterdeceptionmagicdeath of fathersupernatural powerredemption β€¦unrequited lovesamurairitual suicide (See All)
Locations:
woodsforestsnowcemeteryvillagejapanlakeshipcastlecampfire
Characters:
husband wife relationshipfather son relationshipfather daughter relationshipsoldierhostagetough guywarrioraction heroteacher student relationshipwitchself mutilationsamurai swordhuman versus monstersamurai warriorhunting party
Story:
musketarranged marriagespiderpoisoncandleswordcorpsefiretitle spoken by characternumber in titlebloodviolenceflashbackbare chested maleexplosion β€¦knifechasesurprise endingbased on true storybeatingdigit in titleshot to deathblood splatterhorseshot in the chestshot in the headrescuebattleshowdowndemoncombatshot in the backdecapitationfoot chaseorphansword fightambushaxemassacremountaindisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacelegendstabbed in the backprologueperson on fireattackdragonmanipulationexploding bodyneck breakingtraploss of fatherdirectorial debutshot in the armbare chested male bondagebattlefieldstylized violencebow and arrowburned alivespearheavy raintempleexploding buildingwitchcraftvillainessgiantforbidden lovecgihonortournamentburialslavepresumed deadguardcrossbowfight to the deathstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingsword dueltragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offarchershape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All)

Idle Hands (1999) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Idle Hands (1999)

Seventeen year old slacker Anton Tobias wakes up one Halloween morning to discover that both of his parents have been turned into two headless Halloween decorations. After speaking to his equally irresponsible friends, Mick and Pnub, he discovers that his right hand has a blood-thirsty mind of its o β€¦wn and is hell-bent on wreaking havoc whether he likes it or not. (Read More)

Subgenre:
black comedycult filmmusic videodark comedyteen moviebody horrorscrewball comedy
Themes:
murderdeathfriendshipdeath of fatherdeath of motherdrug use
Mood:
gorehigh school
Locations:
hospitalpolice stationtruck
Characters:
husband wife relationshipteenagerfriendboyfriend girlfriend relationshipteenage boyserial killerpolicemanself mutilation
Story:
disembodied handdisembodied headmeat cleavereyeballliving deadundeadcorpsetitle spoken by characterdogbloodfemale frontal nuditydancingknifepistol β€¦rescueslow motion scenewatching tvcatmarijuananeighbordecapitationgood versus evilhalloweenflashlightbandstrangulationdeath of friendimpalementstabbed to deathmapsevered headanti herobreast fondlingpolice officer killedshot in the foreheadcharacter repeating someone else's dialoguepuppetelectrocutionangelhalloween costumebasementneck breakinggaragepot smokingtied to a bedsevered handcrushed to deathdamsel in distresscameostealing a carheadphonesstabbed in the headreference to satanthrown through a windowatticeye gougingslackerknife throwingduct tapedemonic possessionkilling spreenude woman murderedsmokedaggernewspaper clippingclose up of eyesstabbed in the handbongtaserdisposing of a dead bodytrailer homestonerphone sextwin brothermaking outhit by a truckbowling alleypatricideoffscreen killingutahhandhit with a shovelhiding under a bedmatricideknittingcut into piecesmemorialpentagramjack o'lanternzippo lighterreference to ludwig van beethovensevered earwriting in bloodbitten handlazinessmicrowavehigh school dancecircular sawhand through chestdevil costumehanged womangirl next doorscalpingincenseburnt handstabbed in the foreheadangel costumeashtraylyricistpriestessreference to mozartnun costumedrive thruasthma inhalerheadless corpsereference to o.j. simpsonbutt grabstabbed in the earhiding under the coverscrawling through an air shaftbody castreference to kevin costnerknitting needlepencil sharpenerfighting with selfcouch potatoburritoreference to kiss the bandcrawling handelectric carving kniferising from the grave (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Woman In Black (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Woman In Black (2012)

In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel β€¦ Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)

Subgenre:
gothic horrorsuspense
Themes:
afterlifeghostrevengemurderdeathfriendshipsuicidebetrayaldrinkingfearsupernatural powergriefadoptiondeath of wifevengeance β€¦forgivenessmadnessdeath of daughterdeath in childbirth (See All)
Mood:
rainnightmarehorror movie remake
Locations:
woodsbeachtrainforestcarbathtublondon englandvillagerural settingengland
Characters:
husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboygirlsister sister relationshipreference to godlittle girllittle boysingle fathersuicide by hangingbaby boy β€¦ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All)
Period:
1910s
Story:
reunited familyscaredhorse and carriageskeletoncandlepaintingcorpsefiredogbased on novelbloodviolenceflashbackphotographcrying β€¦foodmirrorrescueslow motion scenedrinksecretlettertearsrunningdead bodycolor in titletelephonenewspaperaxemansioneatingwidowhouseaccidentdrivingchildbirdcoffindrawingsearchjourneygraveyarddrowningflash forwardgravecurseprologuescreamingkeywidowerperson on firedolldeath of childhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of mothersleepinghaunted housesingle parentfireplacelooking at oneself in a mirrorcrucifixtoyloss of wifeeccentriclossrailway stationclockthunderloss of sonwizardlostthunderstormsuperstitiondead childatticfogmurder of a childvoice over letterlanternbriefcaseparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionold dark housemental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorhearing voicespocket watchloss of childlocked doorbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All)

Jane Eyre (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jane Eyre (2011)

After a bleak childhood, Jane Eyre goes out into the world to become a governess. As she lives happily in her new position at Thornfield Hall, she meets the dark, cold, and abrupt master of the house, Mr. Rochester. Jane and her employer grow close in friendship and she soon finds herself falling in β€¦ love with him. Happiness seems to have found Jane at last, but could Mr. Rochester's terrible secret be about to destroy it forever? (Read More)

Subgenre:
coming of ageperiod drama
Themes:
abusefriendshipsuicidereligiondeceptionmemoryparanoiainsanityillnessmental illnesscrueltyblindnessinheritancemadness
Mood:
rain
Locations:
churchschoolsnowenglandstorm
Characters:
friendchildrenbrother sister relationshipteenage girlfemale protagonistteachergirllittle girlolder man younger woman relationshipfrenchemployer employee relationshipaunt niece relationship
Period:
19th century1840s
Story:
horse and carriagegothiccandlepianopaintingfiretitle spoken by characterdogf ratedcharacter name in titlebased on novelbloodflashbacktwo word titlegun β€¦kissdancingsingingcryinghorsesecretletterbookclassroomprayerorphanbedroomdeath of friendbridgechild abusedrawingcigar smokingmarriage proposalgunshotflash forwardreadingcountrysidehuggingfireplacedesirewounddressheavy rainhatservantforbidden lovehaunted by the pastthunderministerfirst kisshit on the headschool uniformbelief in godboarding schoolwedding dresssnowinghousekeeperfieldchildhood memoryhorseback ridingdormitorysexual awakeningauntwedding ceremonyestatecorporal punishmentabandonmentstrokelocked doorbroken heartguardiancountry housestar crossed loverscaretakerlocked in a roomhouse fireveilcanceled weddingsaying graceglobenightgown19 year oldgirls' schoolcapgovernesscountry estatedollhouserite of passageorphan girlbelief in heavenfalling off horsebelief in hellribbonfree willbadmintonenglish countrysidebonnettyphuswedding veilgirls' boarding schoolmoor the landscapedying in someone's armswardyearningkeeping a secretone room schoolhouseservitudebridal veilhair ribbonhit with a booknursing someone back to healthhit on the head with a book (See All)

Batman: Mask Of The Phantasm (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Batman: Mask Of The Phantasm (1993)

Batman, the costumed crime-fighter who prowls the night skies in Gotham City, soon finds there's another vigilante in town knocking off prominent mob figures. Despite the scythe-like blade for a hand, a mechanical voice and the cloud of smoke that follows the figure wherever it goes, the police and  β€¦outraged officials mistake the homicidal crusader for Batman himself and demand that the city's longtime hero be brought to justice. Meanwhile, Andrea Beaumont returns to town. She is the lost love of Bruce Wayne, the billionaire playboy who is Batman's alter ego, and was an integral part of Wayne's decision ten years earlier to don the cape and cowl. Now, she is back in his life and is no less a disruption than the return of his old archenemy, The Joker, who has a stake in seeing the annihilation of this new vigilante, whoever it proves to be. (Read More)

Subgenre:
gothic horrorblack comedycult filmmartial artsconspiracysuperherotragedy
Themes:
angersurrealismrevengemurderdeathbetrayalfeartortureescapegangsterheroinvestigationdeceptioncorruptionpsychopath β€¦death of fatherbrutalityobsessionparanoiamafiainsanityunrequited lovehome invasionnear death experienceregret (See All)
Mood:
neo noirnightdarkness
Locations:
hospitalrestauranthelicoptermotorcyclecemeteryairplaneurban settingapartmentpolice stationshiprooftopsewerrooftop fightrooftop chasecar truck chase
Characters:
policefather daughter relationshipdoctorpolice officerserial killernursedetectivehostagelawyertough guywarrioraction herohitmansecurity guardpolice detective β€¦ex boyfriend ex girlfriend relationshippolice chasemysterious villainmysterious killer (See All)
Period:
1990s
Story:
wedding ringbutlerhatredgothicevil manpoisonswordcorpsefirecharacter name in titlebloodviolenceflashbackbare chested malekiss β€¦fightcigarette smokingphotographexplosionpartyknifechasesurprise endingpistolbeatingfistfightmachine guncar accidentshotgunrescuepunched in the facecamerabrawlfalling from heightmaskletterbased on comicshowdownheld at gunpointhand to hand combatbombcar crashinterrogationrobotrevolverfightingcriminalsubjective cameragood versus evilsurvivalfoot chaseassassinbound and gaggedbased on comic bookambushdisguisemansionbridgemixed martial artsnonlinear timelinefalse accusationanti herodisarming someoneone man armydouble crossunderwater scenefemme fatalecigar smokingmarriage proposalnecklaceon the runattempted murderlimousineone against manyorganized crimebinocularscharacter repeating someone else's dialoguebased on tv seriesclownelectrocutionumbrellacharacter's point of view camera shotrace against timestatuedebtcover upkicked in the facetough girlbaseball batlightningopening action scenebodyguardinjectionloss of fathervigilantenewspaper headlinestylized violencehenchmanmaniaccrime bosseavesdroppingfireplacedestructionrevelationhead buttassassination attemptmass murderhypodermic needleheavy rainmobsterloss of loved onehammerexploding buildingkicked in the stomachvillainessswat teamjumping from heightparking garageblack humorcrushed to deathmasked manthugrampagepump action shotgunhaunted by the pastconstruction sitemercilessnessmillionairesuper villainkicked in the crotchmental hospitalescape attemptmakeupamusement parkpunched in the chestdark herodynamitejumping through a windowbooby trapaerial shotsexy womanrainstormbody landing on a carlonerdark pasttragic herogadgetlaughingsecret identitykilling spreedc comicspsychoticflat tireengagement ringmob bosshit with a baseball batbatenglishman abroadgothspit in the facevigilantismdouble lifeskyscraperold flamebillionairebased on cartoonhired killerurban decayvigilante justiceoffscreen killingretroski maskfemale villainmoney launderingcruise shipfight the systemcapeheirstar crossed loversmafia bossorchestral music scoreoverturning caralter egoembezzlementrighteous rageclawcorrupt officialcrime fighterexploding housetragic pastmasked heromasked villaintheme parktommy gunscytheexploding airplaneman hits a womanfairjujitsusocial decaysocialiteevil clownmiscarriage of justiceattempted robberyextreme close upmasked superheromob hitcrime spreefictional citypolice commissionertragic villaincityscapejumping from a rooftopworld's fairgadgetrykiller clowngadget carfairgroundorigin of herothrowing starel trainman fights a womansuitcase full of moneyshurikenmasked vigilantecorrupt businessmanmanor houseman punches a womanpurse snatchersuper computerdark futuregas grenadeanti villainlimousine driverocean linerspit takecounterfeitforensic evidenceflying manoutrunning explosionenforcerclown makeupgrappling hookkeysi fighting methodjet packclown faceoxygen tankevil laughterprofessional hitsmoke grenadefighting in the airjokerpyromaniaccostumed herowrongfully accusedart decotoxinbatmobilecaped superherofuturistic aircraftgothammonorailone man crusadetooth knocked outmaking lovearchenemywounded manpersonal vendettacouncilorwarner brosbatcaveabandoned amusement parkbatwingbat signalglidingdisappeardc animated universefoot popping kissmetal handstrapless dressbat planebatman jokerrocket pack (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Alice In Wonderland (2010) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Alice In Wonderland (2010)

Alice, an unpretentious and individual 19-year-old, is betrothed to a dunce of an English nobleman. At her engagement party, she escapes the crowd to consider whether to go through with the marriage and falls down a hole in the garden after spotting an unusual rabbit. Arriving in a strange and surre β€¦al place called "Underland," she finds herself in a world that resembles the nightmares she had as a child, filled with talking animals, villainous queens and knights, and frumious bandersnatches. Alice realizes that she is there for a reason--to conquer the horrific Jabberwocky and restore the rightful queen to her throne. (Read More)

Subgenre:
dark fantasyfairy talefish out of waterlive action and animationhigh fantasy
Themes:
angersurrealismmarriagefearescapemonstermagicinsanityexecutionself sacrifice
Locations:
woodsforestlondon englandshipcastlechina
Characters:
husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenage girlfemale protagonistsoldierdancerlittle girlmythical creature
Period:
19th century1800s1870s
Story:
disembodied headeyeballhorse and carriagecandlepianopaintingswordfiredogf ratedcharacter name in titlebased on novelflashbackkissfight β€¦dancingpartydreamhorseface slapslow motion scenecomputercatbattlelierunninghallucinationhandcuffssubjective cameradecapitationsword fightmansionarmyprisonermapfishsevered headno opening creditsbirdpainteranimalfictional warjourneymarriage proposalnecklaceflash forwardattempted murderkeyliaractor playing multiple rolesdragonrabbitlightningflowerspigfirst partgardentwincult directorqueenmonkeychesssisterdestinyspearwoundtalking animalcakequestlifting someone into the airhatmouseblockbusterfrogtorchclockcelebrationfemale warrioranthropomorphismimaginationtelescopebootsfanimpostor3 dimensionalanthropomorphic animalprophecysibling rivalryenglishrosebutterflyengagementeye gougingbalconyknife throwingstabbed in the eyeeye patchpuppyteleportationcrowdhorseback ridingvictorian erabeheadinginvisibilitywedding ceremonyruinsdoubtstairwayestatecrownhuntpocket watchfantasy worldfallingmushroompotionwindmillcoderepeated lineriddlereturning homepsychotronic filmtalking dogslapalice in wonderlandthronetop hatred hairvulturecanceled weddingsailing shippower strugglecaterpillarimplied nudity19 year oldscrollbanishmentsuit of armorlordfalse namehedgehogjugglershrinkingcandelabrared rosemagical potionmagical swordbased on young adult novelexecutionerfireflyscarred facefire breathing dragongazebotalking cattea partykeyholeempressengagement partyplaying cardsame actor playing two characterswhite rabbitevil queensentenced to deathflamingokilled with a swordlisprocking horseharehookahteapotcocoondrawbridgemonarchwhite rosethe color redwardrobe malfunctionfalling into a holefemale slaps maleblowing smoke in someone's faceknife in handprosthetic body partbloodhoundmonocletalking horsebugleflock of birdslive action remakemoatsedan chairtrumpetersudden change in sizemanaclessugar cuberose gardenchanging sizetree stumpdragonslayerfake noseforced perspectivemad hatterfantasy landdodogrowing in sizelawn partyopening creditsoverweight boyrabbit holetalking mouseanimal wearing clothesanthropomorphic flowercheshire catlewis carrollqueen of heartsrose bushtartblowing one's nosedomino fallbig headtalking animalstalking frogaccidental nuditycolor in character's namefalling down a holegap toothedlawn croquetbattle for thronejabberwockyleg chainsred queenhead huntinglive action adaptationmistaking reality for dreamrivalry over throneslaying a dragontalking flower (See All)

Peter Pan (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Peter Pan (2003)

In stifling Edwardian London, Wendy Darling mesmerizes her brothers every night with bedtime tales of swordplay, swashbuckling, and the fearsome Captain Hook. But the children become the heroes of an even greater story, when Peter Pan flies into their nursery one night and leads them over moonlit ro β€¦oftops through a galaxy of stars and to the lush jungles of Neverland. Wendy and her brothers join Peter and the Lost Boys in an exhilarating life--free of grown-up rules--while also facing the inevitable showdown with Hook and his bloodthirsty pirates. (Read More)

Subgenre:
martial artsswashbucklersword and fantasy
Themes:
angerjealousymurderdeathfriendshipbetrayalfearheromagiclonelinesstheftadoptioncouragefirst love
Locations:
schoolsnowbathtublondon englandwatershipcastlejunglestormcity of children
Characters:
villainfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendbrother brother relationshipboybrother sister relationshipteachergirlstudent β€¦thieftough guynative americanaunt niece relationshipaunt nephew relationshipmermaidboy hero (See All)
Period:
1900s
Story:
musketfencinggossipskeletonpoisonswordtitle spoken by characterdogcharacter name in titlebased on novelviolencegunkissfightvoice over narration β€¦cryingrescueslow motion scenebattlelettershootingshowdownhand to hand combatbedislandclassroomfightingcombatbound and gaggedsword fightgangambushmixed martial artsweaponman with glassesno opening creditschilddisarming someoneone man armydrawingduelattempted murderone against manydangerstorytellingtough girlglassestrapunderwaterclassrecord playericepirategoldcaptainbow and arrowflyinghead buttheroinelifting someone into the airhattreasurehidingteddy bearfemale tied upcannonbarefoottelescopechild's point of viewfairychild protagonistrowboatlostrivalshadowyoung lovegrowing upsword duelparrotwilhelm screamnannyclose up of eyesflagswordsmangatecrocodiletween girladventure heroboy with glasseshanging upside downbankercloudwhistlingfeathersiblingsewingcomettop hathookshot with a bow and arrowflintlock riflenightgownflintlock pistolsolar systemwire fubig ben londonchild heromale tied upreference to cinderellapleadingchild in dangerteepeehook for handplay fightvictrolamake believepirate captainnightshirtwooden swordsaint bernard dogpulling hairflying boygirl in dangerwalking the plankjolly rogerskull and crossbonesboy in dangerfantasy landflying shipblushingmagical dustthimblecrowingfairy dustbarefoot boy (See All)

Interview With The Vampire: The Vampire Chronicles (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Interview With The Vampire: The Vampire Chronicles (1994)

It hasn't even been a year since a plantation owner named Louis lost his wife in childbirth. Both his wife and the infant died, and now he has lost his will to live. A vampire named Lestat takes a liking to Louis and offers him the chance to become a creature of the night: a vampire. Louis accepts,  β€¦and Lestat drains Louis' mortal blood and then replaces it with his own, turning Louis into a vampire. Louis must learn from Lestat the ways of the vampire. (Read More)

Subgenre:
black comedycult filmlgbt horror
Themes:
angerrevengemurderdeathbetrayalfearescapesupernatural powerguilttheatremurder of family
Mood:
gorerainnightdarkness
Locations:
carhelicoptercemeteryparis francewaterpolice carfrancesan francisco californiaamerica
Characters:
father daughter relationshipboyprostituteactorartistvampirelittle girlamericanamerican abroadvampire girlsame sex parents
Period:
19th century20th century18th century1870s
Story:
horse and carriagegothicundeadcandlepianocorpsefirebased on novelnuditybloodviolenceinterviewdancing β€¦singingsurprise endingpistolvoice over narrationcryinghorsemirrorrescuemaskrunningbeddead bodydecapitationgood versus evilorphanweaponanimalcoffinritualtreelibrarydangercostumescreamingcharacter's point of view camera shotdollpianistautomobileneck breakingratcinemachild murderdestinydressslow motiontape recorderlifting someone into the airhatslaverywatching a moviebuttocksblockbusteraudiencetorchslavenew orleans louisianaimmortalitytheatre audiencestairsswampdark herosundead childshadowhomoeroticismlaughingvoodooplaying cardsreflectionvictorian erastage showyellingtablelouisianaglovesplaguefemale vampirechandelieraudio cassetteteethritegolden gate bridgemind readinghouse firescytheliquidplantationsailing shipcurtaincustomsittinglifting female in airwoman's neck brokensexual innuendopoodlesliced in twocmnfbisexual mantwilightcandelabralifting male in aircarrying someonelifting an adult into the airclothed male naked femaleeroticismcmnf scenepleadingvampire human lovemarquee1790sbisexual malesiren the alarmdangerous friendmississippi rivergrand guignolgeorgian erachild vampireburial at seamonster as victimgirl in dangercostume horrorvampire driving a carreference to river phoenixtheater audiencetheater curtaindancing with dead body (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ninja Scroll (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ninja Scroll (1993)

A Journeyman ninja by name of Jubei stumbles upon a plague, an evil clan of demons, a national crisis, and a beautiful ninja girl.

Subgenre:
dark fantasycult filmmartial artssupernaturaltragedyepicadult animation
Themes:
angersurrealismrevengemurderdeathloverapemonsterheromagicseductiontravelsupernatural powerunrequited lovecruelty β€¦blindnessjusticemythologysamurainear death experiencerape and revengesupernatural powers (See All)
Mood:
goreneo noiranimepoetic justice
Locations:
forestboatwatervillagejapanshipblood in waterdeath at sea
Characters:
tattoojapanese womanaction herojapanesesamurai swordnear deathblood revengedeath of a girl
Story:
poisonedangrytorso cut in halfresurrectionpoisoncandleswordfirefemale nuditynuditybloodviolencebare breastsflashback β€¦bondagebare chested malegunsex scenekissfemale rear nuditychaselickingcryingbreast suckingblood splatterhorserescuepunched in the facekissingfalling from heightshowdownrunningdemonswimmingdecapitationgood versus evilspysword fightambushold manstabbingbridgearmymapsnakeunderwater scenecontroversycreaturetransformationduelone against manytreescreamingelectrocutionattackmissionninjaopening action scenescreammartial artistgovernmenthorse ridingunderwatersacrificeespionageblood spatterpowerstylized violencegoldmartial arts masterdestructionhead buttwoundquestsexual abuserageenemybuttockscrying womanbuttfaked deathhonornaked womanchop sockyfemale warriorpromiseseriessevered fingerkatana swordblood on faceteamevacuationimmortalitydark heroeye gougingstabbed in the eyeblind manbroken armsword duelarrowdaggerchallengeblindheroismbisexualitysaving a lifeswordsmanelectricitykatanaviolence against womenbandagekung fu classicrunning awayschemelong hairsexual violencemegalomaniacponytailclimbingmessageninjitsuforeplaypoisoningfinger cut offtravelingaction violenceextreme violencetreacherygraphic violencetragic loverighteous ragebloodshedjumpinggrassimmortalcut into piecesspitting bloodbloody violencearm cut offcoughing bloodwoman undressingviolent deathtreesdeath of loverscreaming womanloinclothepic battlejumpdirtarm ripped offcutscrollantidotedrinking bloodhaydark heroineshurikenheadbandfemale ninjawaspcompanionmagical swordninja warriorfireflylife and deathstabbedbamboomass deathninja masterriding a horsedeath of main charactergory violencetouching breastsfake deathviolence against a womanblood on mouthfeudal japantribalbloody sprayangry mandoomed loveflamescryelectrocutedbloodlustcut in halfdeath by firehole in wallwoman undressing for a mantoxinbloodystabbreast squeezingbreaking through a wallwoman electrocutedjapanimationviolenttasting bloodclimbing a wallcompanionshipancient timestragic deathbroken dreamlicking someoneblood spurtclimbdeath by swordkiss of deathlife savingcoughing up blooddeath of womanenemieshorse riderbloody liplong fingernailsbloodthirstyfaking a deathrock monstersnake womanblood dripbloody messbreaking through walldecapitatedultraviolencebamboo forestbloody waterchase scenetownspeoplejapanese governmentancient japanburn to deathnear death survivorsnakesanimated violenceclimbing a cliffdestroyed wallinsane violencetraveling companionburning shipcutting off fingerfingers cut offgushing bloodheroic deathmale companionpoisonerspit blood (See All)

The Crow (1994) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Crow (1994)

A poetic guitarist Eric Draven is brought back to life by a crow a year after he and his fiancee are murdered. The crow guides him through the land of the living, and leads him to his killers: knife thrower Tin-tin, drugetic Funboy, car buff T-Bird, and the unsophisticated Skank. One by one, Eric gi β€¦ves these thugs a taste of their own medicine. However their leader Top-Dollar, a world-class crime lord who will dispatch his enemies with a Japanese sword and joke about it later, will soon learn the legend of the crow and the secret to the vigilante's invincibility. (Read More)

Subgenre:
dark fantasyblack comedycult filmmartial artsallegory
Themes:
afterliferevengemurderdeathrapedrunkennessheroincestpsychopathbrutalitysupernatural powerjustice
Mood:
gorerainneo noirpoetic justice
Locations:
churchcemeterybathtuburban settingrooftopinner cityrooftop fighthelicopter chase
Characters:
policemother daughter relationshipwarrioraction herowaitressfiance fiancee relationshipmysterious villain
Story:
gothicundeadswordcorpsefiretitle spoken by characterfemale nuditycharacter name in titlebloodviolenceflashbackgunfemale rear nudityfight β€¦showervoice over narrationshootoutshot to deathblood splattershot in the chestshot in the headslow motion scenecatgunfightfalling from heightshootingshowdownhand to hand combatbombrock musicreference to jesus christguitarcombatkung fushot in the backsubjective cameragood versus evilhalloweensword fightbased on comic bookconcertmontagethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chesttied to a chairexploding caranti heroone man armychild in perilgraveyardmarriage proposalgunshotduelone against manycharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotfirst partdirectorial debutshot in the armvigilantearsonfreeze framecrime bossoccultfalling down stairssyringebulletloss of loved onedrug abusesergeantexploding buildingvillainessskateboardgun fubreakfastback from the deadgun battledrug overdosekatana swordnostalgiadual wieldstabbed in the throatironyjunkiedark herothrown through a windowgang rapedead maneye gougingslaughterbody landing on a carknife throwingsword dueltragic herolasersightmain character diesengagement ringjewelrystabbed in the handkendodetroit michiganfencemegalomaniacstabbed in the armhot dogbullet balletbased on graphic novelnihilismgun duelguitar playerraveshot in the handpawnshoptragic loverighteous ragedeath of title characterfart jokerock musicianblack copfade to blackrebirthoverhead shotstairwellexit woundlong haired malefalling off a roofjeet kune doorigin of herogrungehot dog standgun katadrinking gamegun saustar died before releasecold casefalling off a balconyabandoned churchlead actor's last filmindustrial musiccalling parent by first nameknife in handdeath of cast membercrowd surfingurban gothicnocturnaldark angelreference to amelia earhartsmashing guitarhole in handmusician in castflashback montagerain fightslow motion shootoutcharred bodyeyes pecked outdevil's nighteve of weddingmurder of fiance (See All)

Dracula 2000 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula 2000 (2000)

In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β€¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)

Subgenre:
black comedycult filmmartial artscoming of agesuspensesupernaturalheist
Themes:
surrealismrevengemurderdeathfriendshipsuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of fathersupernatural power β€¦paranoiasurveillanceevilhome invasionpanic (See All)
Mood:
gorenightmare
Locations:
churchschoolcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church
Characters:
father daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest
Period:
2000s
Story:
resurrectionhatredgothicundeadevil mancandlepaintingswordcorpsesexcharacter name in titlenumber in titlebloodviolenceflashback β€¦bare chested malegunfightphotographexplosionpartyknifelesbian kisschasesurprise endingpistoldreamshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the facearrestbrawlfalling from heightshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomflashlightambushold manstrangulationmassacredisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlescene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throatmercilessnessnew orleans louisianaimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Crimson Peak (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Crimson Peak (2015)

Edith Cushing's mother died when she was young but watches over her. Brought up in the Victorian Era she strives to be more than just a woman of marriageable age. She becomes enamored with Thomas Sharpe, a mysterious stranger. After a series of meetings and incidents she marries Thomas and comes to  β€¦live with him and his sister, Lady Lucille Sharpe, far away from everything she has known. The naive girl soon comes to realize not everything is as it appears as ghosts of the past quite literally come out of the woodwork. This movie is more about mystery and suspense than gore. (Read More)

Subgenre:
gothic horrorghost storysupernatural horrorperiod film
Themes:
ghostmurderlovefuneralincestpsychopathdeath of mothergriefnovel writing
Mood:
rainnight
Locations:
hotelsnowelevatorrural settingwheelchaircityenglandusafuneral in the rain
Characters:
husband wife relationshipfather daughter relationshipdoctorbrother sister relationshipserial killerwriting a novel
Period:
winter
Story:
poisonedhorse and carriagegothiceuropepoisoncandletitle spoken by characterdogbloodmale nudityviolenceflashbackmale rear nuditytwo word titlesex scene β€¦dancingknifeface slapbare buttletteralcoholmansionstabbed in the chestdinnerchild abuseno opening creditsvoice overlibrarybeaten to deathportraitumbrellaautomobileloss of motherhaunted housetypewriterstrong female characterapplauseteademonstrationmorguevillainessbrother sister incestcoitusstrong female leadhomicideshovelballvoice over letterplaying pianolocation in titlewoman in bathtubnarrated by characterheartbreakpiano playingwhisperingpartial female nuditytaking a bathtoastblizzardwalkingwarningcowgirl sex positionaltered version of studio logomanuscriptredhit with a shovelstabbed in the facewoman slaps mancoughing bloodwoman slaps a mantrunkhorse drawn carriagereading a letterstabbed multiple timesborderline personality disorderbigamymissionary positionrainy nightwaltzcandelabramothstray dogstabbed in the bellyman carrying a womanbloody handhuman skeletonbegins with narrationhaunted mansionlock of haircleaverclaymurderer duowoman wearing a red dressfemale murderercholerawoman in bathfacial cutbuffalo new yorkreading letterwraithfancy dressfountain penincestuous overtonesarchitectural modelcowboy sex positionold mansionreference to jane austenexcavatorscale modelstabbed with a penself defencebegins with a flashbackblowing out a candlekey ringbloody hand printpiano recitalpomeranian dogyear 1893brutal murderophthalmologistford model tfather murderedformal danceformal dinnergothic romanceplaying fetch with a dogpushed off a balconyreference to arthur conan doyleseveral time periodsdead flyyear 1887year 1896camera shot of a woman's bare feetdisrepairgraveside ceremonyoverflowing sinkpersonal checkman wearing a top hatwax cylinder (See All)

The Last Witch Hunter (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last Witch Hunter (2015)

The modern world holds many secrets, but the most astounding secret of all is that witches still live amongst us; vicious supernatural creatures intent on unleashing the Black Death upon the world. Armies of witch hunters battled the unnatural enemy across the globe for centuries, including Kaulder, β€¦ a valiant warrior who managed to slay the all-powerful Queen Witch, decimating her followers in the process. In the moments right before her death, the Queen curses Kaulder with her own immortality, forever separating him from his beloved wife and daughter in the afterlife. Today Kaulder is the only one of his kind remaining, and has spent centuries hunting down rogue witches, all the while yearning for his long-lost loved ones. However, unbeknownst to Kaulder, the Queen Witch is resurrected and seeks revenge on her killer causing an epic battle that will determine the survival of the human race. (Read More)

Subgenre:
dark fantasyblack comedyconspiracysupernaturalchristian horror
Themes:
afterliferevengesurrealismmurderdeathkidnappingbetrayalprisontortureescapefuneralmonsterinvestigationdeceptionmagic β€¦memorysupernatural powerapocalypseblindnessvengeancenear death experiencemurder of family (See All)
Mood:
darkness
Locations:
churchnew york citybarsnowairplanetaxikitchenapartmentcavecatholic churchschool bus
Characters:
tattoosoldierpriesthostagetough guywarrioraction herowaitressbiblewitchcatholic priestevil witch
Story:
decomposing bodymaggotresurrectiongothiccandleswordcorpsefirebloodviolenceflashbackfightexplosionknifesurprise ending β€¦pistolvoice over narrationcell phonedreamshot in the chestshotgunrescuebattlefalling from heightshowdownheld at gunpointinterrogationhallucinationshot in the backgood versus evilassassinstrangulationaxemassacremountaindeath of friendimpalementstabbed to deathprisonerstabbed in the chestno opening creditsanti heroone man armycoffinassassinationchild in perilfictional wardouble crosscreaturefemme fataleflash forwardtreecursestabbed in the backprologueattackmissionrace against timecover uplightningopening action sceneshot in the shouldermanipulationbodyguardexploding bodythreatened with a knifequeenarsonstylized violenceocculttraitorbow and arrowburned aliverevelationassassination attemptheavy raincrucifixwitchcraftimpersonationirishmind controltorchend of the worldback from the deadbar fighteaten alivepresumed deadretirementcrime scenepump action shotgundamsel in distressreverse footageimmortalitycigarette lighterdark heroheartaerial shotlonercanedark pastdressing roomtragic heroblack magicburned to deathtelekinesisteleportationtelepathyimprisonmentspellenglishman abroadsuffocationnarrated by characterillusionfire extinguisherstabbed in the handbongold dark housegiant monsterhitlerbrooklyn bridgegun held to headcomic reliefplaguesecret societyflycrystalgreenhousepocket watchbakerydruggedman kills a womanoffscreen killingmacguffinpotionfashion showaltered version of studio logosole black character dies clichetimes square manhattan new york citycathedralopen endedrighteous ragetragic pastdeath of familysubterraneancamera phonesymbolfemale bartendermind readingpentagrampenrookieglowing eyesheart in handmagic spellchrysler building manhattan new york cityregenerationselfiechantingdiscovering a dead bodybattle axeenglishwoman abroadsecret doorsecret organizationchemistryarsenalman fights a womanrepressed memorypossewarlockirongiant creaturehand through chestcherrycouncilcatwalkstalinalternate worldlucid dreamswarmstabbed through the chestinside the mindweather manipulationfacial cutshape shiftingbiographeraxe throwingnapoleonarsenicblowing smoke in someone's facehuman brandingsiamese catclose up of handflaming swordwitch hunterlife forcesword throwingrapid healingsnapping fingersgiant treeair hostessmental manipulationdead flystabbed through the backweapons cabinetblack plaguefalling down a holecircumscribed pentagramwoman wearing lingeriegummy bearman holding a babyswarm of flies (See All)

Dorian Gray (2009) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dorian Gray (2009)

A naive young man. A lovelorn artist. A corruptible Lord. A deal with the Devil. It all paints a dark picture of a Victorian London and how the rich and infamous party at their peril. Here, the telling of time and its consequence of experience for life's treasures' takes its toll on the body, mind a β€¦nd soul. The haunting and bleak tale of power, greed, vanity and inevitable self-destruction is ever present amongst the deceit, opium dens and sin. (Read More)

Subgenre:
gothic horror
Themes:
jealousymurdersuicidereligionpregnancyfuneraldeceptioncorruptionsupernatural poweryouthinheritance
Locations:
brothel
Characters:
father daughter relationshipartistgay kisssuicide by drowning
Period:
19th century1890s
Story:
gothicpianopaintingswordfirefemale nuditycharacter name in titlebased on novelcigarette smokingprostitutionorgyorphanchild abusepainterconfession β€¦portraitsadomasochismdead womanimmortalityvictorian eraopiumhedonismdeal with the devilhigh societyrole modelsecret lifemasqueradeintoxicationinnocence lostmoral corruptionabsinthegineternal youthimmoralityvicepuritymasked balldeath of pregnant womanbad influencemaggotsdeath of expectant motherdorian grayfear of agingreference to dorian graybody in riverreference to the picture of dorian grayreference to the picture of dorian gray the novelsuicide of pregnant woman (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dead Alive (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dead Alive (1992)

Deep in the lush jungles of the isolated Skull Island lies the habitat of the elusive, yet endangered and utterly vicious "Simian Raticus", or better known as by its common name, the Sumatran Rat-Monkey, a hideous mix of a virus-carrying slave-ship rat and a tree monkey. Presently, back in New Zeala β€¦nd's Wellington, the oppressed Lionel Cosgrove who lives with his despotic mother Vera, has finally found his soulmate, Paquita, but sadly, his world will rapidly change when after a stroll at the local Zoo, a live specimen of the rare species will bite Vera. Now that she's got the "bite", with the infection spreading and turning Vera into a festering, puss-squirting living dead ravenous for flesh, things are bound to get out of hand, as an ever-growing collection of stiffs and other stimulant-enhanced zombie misfits detained in Lionel's house basement will demand immediate action. Poor Lionel he needs to step up and clear up the mess, but above all, summon the courage to confront his decomposing mummy and the family's ugly secret. Will he save the day? (Read More)

Subgenre:
black comedycult filmindependent filmmartial artsdark comedyb movieb horrorbody horrorgross out comedyindependent horrorzombie outbreak
Themes:
surrealismmurderdeathtorturebrutalitysadismexploitationcannibalism
Mood:
gorespoof
Locations:
backwoodsback country
Characters:
zombiepriestmotherterrorself mutilationzombie lovezombie sexualityzombie babyzombie girl
Period:
1950s
Story:
disembodied headdead dogliving deadtorso cut in halfundeadpoisonbloodviolenceone word titleflashbacktwo word titlepartyknifeblood splatterface slap β€¦punched in the facefalling from heightvomitinglow budget filmdecapitationimpalementtied to a chairsevered headanti herohit by a carcontroversydrowningbeaten to deathperson on firekicked in the faceattempted rapeexploding bodypremarital sexsevered armdismembermentmonkeykilling an animalmutilationsevered handcovered in bloodcheating husbandback from the deadeaten alivemexicanreverse footagebloody noseinvasionspanishhit in the crotchcannibalgash in the facezookicked in the crotchbutchershovelstabbed in the headexploding headthrown through a windowsevered legnew zealandlatinadirector cameoburied alivespit in the facedomineering motherbody in a trunkhillbillyextreme violenceflesh eating zombiewalking deadcut into piecestongue in cheekbreaking through a doorsevered footbutcheryheart in handzombie attackexploitation filmhead ripped offarm ripped offalternate versionstabbed in the mouthlawn mowerreanimationhand cut offface ripped offzombie childbodily dismembermentflesh eatingsevered facetrailer narrated by percy rodriguezanthropophagusover the topentrailshead cut in halfpart stop motionzombificationblenderbody partsleg ripped offstop motion scenegross outsex with the undeadzombie bitecult favoritejack danielscamera shot from inside human bodyhand through headsex with a zombieexploding eyeneedle in eyelawn gnomemutant babynagging motherwalking through a wallkilled with a lawnmowerzombie invasionforeign versiondead monkeyhouse burningzombie animallungs ripped out (See All)

Sweeney Todd: The Demon Barber Of Fleet Street (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sweeney Todd: The Demon Barber Of Fleet Street (2007)

In the Victorian London, the barber Benjamin Barker is married to the gorgeous Lucy and they have a lovely child, Johanna. The beauty of Lucy attracts the attention of the corrupt Judge Turpin, who falsely accuses the barber of a crime that he did not commit and abuses Lucy later after gaining custo β€¦dy of her. After fifteen years in exile, Benjamin returns to London under the new identity of Sweeney Todd, seeking revenge against Turpin. He meets the widow Mrs. Lovett who is the owner of a meat pie shop who tells him that Lucy swallowed arsenic many years ago, and Turpin assigned himself tutor of Johanna. He opens a barber shop above her store, initiating a crime rampage against those who made him suffer and lose his beloved family. (Read More)

Subgenre:
gothic horrorblack comedycult filmtragedymelodrama
Themes:
jealousyrevengemurderweddingdeceptionincestpsychopathblackmailunrequited lovecannibalism
Mood:
social satire
Locations:
restaurantlondon englandsewer
Characters:
husband wife relationshipserial killerkillerlustbaker
Period:
19th century1850s
Story:
gothicpoisoncorpsetitle spoken by charactercharacter name in titlebloodflashbacksurprise endingface slapremakerescuethroat slittingwidowchild abusejudge β€¦trialchild in perilconfessionkeywidowerperson on firefantasy sequencewigmurdererwhippingdismembermentshavingburned alivemass murderlifting someone into the airloss of loved oneassaultsevered handcovered in bloodpicnicpresumed deadcorsetsevered fingerunderage drinkingstabbed in the neckdeath threatlove at first sightblood on shirtyoung lovesailorcaneasylumcellarvictorian erablood on camera lensvillain played by lead actorabuse of powerbeggarescaped convictbody in a trunkinfatuationbakeryrazorwagercrushed headguardianrighteous rageadopted daughterloss of familytrapdoorbarbershopsocial injusticefake accentovenlifting female in airtrail of bloodprotective malesexual predatorsecret dooraccomplicebased on stage musicalname changeoff screen rapeimplied rapeestranged daughteruxoricidemother figureseamancockneycrushed handgrand guignolmadhousealetwitchingprotective fathermeat piesweeney toddgrinderbarber chair (See All)

An American Tail (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

An American Tail (1986)

Fievel is a young Russian mouse separated from his parents on the way to America, a land they think is without cats. When he arrives alone in the New World, he keeps up hope, searching for his family, making new friends, and running and dodging the cats he thought he'd be rid off.

Themes:
angermurderescapeheromafia
Mood:
rain
Locations:
new york citystormsewersea monster
Characters:
family relationshipsfather son relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerbrother sister relationshipbabyjewishbullyjewrussianmayorrussian jewkiller cat
Period:
19th century1880s
Story:
anger issuesbad temperangrypianofirekissthree word titlecryingcatcriminalgood versus evilsurvivalorphanbandgang β€¦disguisebathcigar smokingimmigrationpop musicreunionratfirst partrecord playerhenchmancard gamepokercoptalking animalhong kongmouseloss of loved onebeardfraudclassical musicirishviolinappleanthropomorphismwhiskeyanti semitismfloodimaginationinvasionsoapnostalgiaitalian americanimpostoranthropomorphic animallove at first sightdespairdrummerlostthunderstormcon artistoutlawmustachepigeonsmokecoinseparationaccountantstreet gangcockroachaccordionalarmseagullbubble bathrazorcheeserallyteethslingshotknittingscoldingstatue of libertygang leaderbarrelberetnoisetop hatticketduetbird cageshakespearean quotationwavesgoonnosechorusconfidenceclarinettenorcastle thunderspeech impedimentsopranoseasicknesssweatshopgrandmahanukkahgrandparenthalf dressed cartoon animalsecret revealedmaster of disguiseballadeerbowler hatanthropomorphic mouseroller skatetrue identity revealedgrandpagrowlingsobbingtubacat versus mousebarefoot cartoon animalpogrombubblescossackhiccupmockingevil catright hand manirish immigrantpoker chipearsfake nosereference to shakespeare's twelfth nightboat dockcat attackscally capbaritoneloss of family membergang bossroaringanger anonymousbabushkafake earsknit capamerican tailpurring (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Adventures Of Baron Munchausen (1988) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Adventures Of Baron Munchausen (1988)

The fantastic tale of an 18th century aristocrat, his talented henchmen and a little girl in their efforts to save a town from defeat by the Turks. Being swallowed by a giant sea-monster, a trip to the moon, a dance with Venus and an escape from the Grim Reaper are only some of the improbable advent β€¦ures. (Read More)

Subgenre:
black comedycult filmabsurdismsword and sorceryepic
Themes:
angerjealousysurrealismrevengedeathlovesuicideprisontortureescapefuneralmonstermemorysupernatural powergambling β€¦executionjusticeamnesiagreek mythology (See All)
Mood:
rain
Locations:
beachwatershipcampfirestormsea monsterstorm at sea
Characters:
husband wife relationshipfather son relationshipfather daughter relationshipdoctorsingerbrother sister relationshipteenage girlgirldanceractoractresswitchofficer
Period:
18th century1700s
Story:
musketeuropeskeletoncandlewinesworddogfemale nuditycharacter name in titlebased on novelbloodkissdancingexplosion β€¦singingsurprise endingsongshot to deathunderwearhorsebattlearrestfalling from heightlettershootingriflerunningislanddecapitationoperanonlinear timelinesevered headbirdassassinationfictional warbathunderwater scenekingmarriage proposaltheaterlegendvirginscreamingkeyangelstorytellingstatuetentlightningreunionwaterfallqueencowmooniceropepiratedestinybulletflyingcagequestelephantmousetreasuregiantcompassionburialorchestracannonhaircutanthropomorphismdwarfdiamondimaginationwindtelescopeticklingbackstageegyptrowboattheatre audiencerosesunvolcanosiegeturkey the countryhorseback ridingbeheadingwhaleaccordiontween girltheatre productionhurricaneaustriacloudvienna austriawagerchandeliergoddessmosquenuclear bombhot air balloonturkishbritish renaissanceharemvictorygrim reaperorganlockballroomhooksailing shipstrong mansnufffalling off a clifflabor strikecyclopsturbantorture chamberbaroneuropeanstruck by lightningdollhousegallowsnosehourglasseunuchparadoxexecutionerstampedesneezesultananchormortarbattering ramtroubled productionseashelldebrisphallusrejuvenationtrippymarksmancannonballtemper tantrumaltruismwhirlpoolquillsuperhuman speedvulcanbeauty and the beaststatue comes to lifeknickersliving statuefalling chandeliertickling feetstagehandturkish armyfake nosevenus the roman goddessball and chaincatherine the greatconstantinople turkeycherubmaydayfloating headlunacysandbagcrash helmetsand clockbellowscomrade in armsvenus emerging from a sea shell (See All)

Creepshow (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Creepshow (1982)

Five tales of terror are presented. The first deals with a demented old man returning from the grave to get the Father's Day cake his murdering daughter never gave him. The second is about a not-too-bright farmer discovering a meteor that turns everything into plant-life. The third is about a vengef β€¦ul husband burying his wife and her lover up to their necks on the beach. The fourth is about a creature that resides in a crate under the steps of a college. The final story is about an ultra-rich businessman who gets his comeuppance from cockroaches. (Read More)

Subgenre:
black comedycult filmamerican horror
Themes:
surrealismrevengedeathadulteryfeartorturemonstersurveillancevengeancehunting
Mood:
gorepoetic justice
Locations:
beachcemeterywheelchairfarmseacity
Characters:
villainzombiefamily relationshipsterror
Period:
19th century1980sfuture1830s
Story:
meat cleaverliving deadskeletonwinebloodviolenceone word titlecigarette smokingshowermirrorbased on comicriflealcoholtelephonehalloween β€¦based on comic bookvideo camerachild abusesevered headcreaturegraveyardanthologycigar smokingshot in the foreheadgraveattackfirst of serieslightningsplit screentrapfirst partunderwatercult directorfreeze framekilling an animaljeepcakecomic bookvisitgrindhousepart of trilogyvictimpart animationback from the deadfull moonwhiskeyjanitorthunderanimated sequencedark humorinsecttitle appears in writingaquariumseasidebordercanefamily dinneropening a doorpumpkinvoodooburied alivehomagehorror hostfamily reunioncockroachweedbottleblackoutbillionairepatricidetyrantactual animal killedcrabmacabrematchmeteoranimated creditsbroken necktrilogycomeuppancefurbucketmeteoritemistreanimationwoman shot in the foreheadcrategrandfather clocktrashcanauthor cameobased on the works of stephen kingdouble murderskull crushingcontrol freakbourbondisco musiccomic book artman eaterwraparound storyhorror comicseaweedmental abusespadefather's daytracksuitgallows humorsalt waterwoman smoking cigarlincolntropical fishkelpbloody corpsealien lifecontrol paneldaughter kills fatherdeath by shotgunantisepticfamily patriarchfather's gravespeech bubblestage lightingburied up to one's neckcake decoratinghigh tidejust dessertsmopping up blood (See All)

Red Riding Hood (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Red Riding Hood (2011)

Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn  β€¦that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)

Subgenre:
gothic horrorcult filmcoming of agesuspensetragedyfairy talecreature featurebased on fairy talefolk horror
Themes:
angerrevengemurderdeathlovefriendshipkidnappingbetrayalfeartortureescapedeceptionseductiondeath of fathersupernatural power β€¦death of motherparanoiahumiliationunrequited loveexecutionpaniccouragedeath of daughterautism (See All)
Mood:
nightmaredarkness
Locations:
woodschurchforestsnowboatvillagelakecavelog cabin
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistsoldierpriesthostagesister sister relationshiplove trianglegrandmother granddaughter relationshiphunting party β€¦woodcutter (See All)
Period:
winter
Story:
arranged marriagehatredgothicswordcorpsefiref ratedcharacter name in titlebloodviolenceflashbackdancingpartyknifechase β€¦three word titlesurprise endingvoice over narrationtitle directed by femaledreamblood splatterhorseshot in the chestrescueslow motion scenearrestmaskinterrogationcolor in titlesubjective cameragood versus evilsurvivalfoot chaseorphanambushaxemassacremountainarmyimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossritualflash forwardtreecursedangerstabbed in the backcharacter's point of view camera shotrace against timetragic eventpigloss of fatherwaterfallloss of motherwerewolfcaptainsabotagewolfrevelationhelmetjail cellhuntersevered handtorchanimal attackpreacherfull moonrampageshieldvisionbraverycrossbowrowboatmedieval timesdeath of sisteraerial shotcapturesnowingdark pastfemale directorkilling spreemoral dilemmatelepathyclose up of eyesnarrated by characterface maskhistorical fictionabuse of powerloss of daughtermental retardationshot with an arrowyoung version of characterwhodunithunttaverncabin in the woodsmercy killingpatricidereverendaltered version of studio logoloss of sisterchapeldeath of grandmothertragic pastmatricidemiddle agesblacksmithmind readinganimal killingwrongful arrestglowing eyeshatchetcard trickhorse drawn carriagestagecoachmistsuit of armorcaged humanbasketsilverwood choppingwhite rabbitloss of grandmotherred riding hoodwomen dancing togetherred capebrothers grimmtorture devicetunicthrown from a boatwitch hunterdaughter murders fatherplanetary alignmentwerewolf bitewoodsmanbitten in the handwalking over hot coalsbitten in the armred hoodblood moonbitten in the legmurder of grandmotherrabbit trapwater bucketmonster hunterred moon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Far From The Madding Crowd (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Far From The Madding Crowd (2015)

The story of independent, beautiful and headstrong Bathsheba Everdene ('Carey Mulligan' (qv)), who attracts three very different suitors: Gabriel Oak ('Matthias Schoenaerts' (qv)), a sheep farmer, captivated by her fetching willfulness; Frank Troy ('Tom Sturridge' (qv)), a handsome and reckless Serg β€¦eant; and William Boldwood ('Michael Sheen (I)' (qv)), a prosperous and mature bachelor. This timeless story of Bathsheba's choices and passions explores the nature of relationships and love - as well as the human ability to overcome hardships through resilience and perseverance. (Read More)

Themes:
jealousymurderdeathfriendshipsuicidemarriagechristmasmoneypregnancydrinkingweddingobsessionguiltgriefgambling β€¦illnessunrequited loveinheritancehunting (See All)
Mood:
rain
Locations:
woodschurchbeachsnowrural settingfarmstorm
Characters:
husband wife relationshipfriendsingerdancerolder man younger woman relationshipuncle niece relationshipaunt niece relationshipsuicide by drowningasking for forgiveness
Period:
19th centurychristmas party
Story:
horse and carriagebutlercandlepianoswordfiredogsexf ratedbased on novelviolencebare chested malekissdancingsinging β€¦partyvoice over narrationcryingsongfoodhorsemirrorshot in the chestdrinksecretfalling from heightletterrifletearsdead bodyneighborsubjective cameraswimmingorphanbridgeeatingwidowboxingapologycoffingraveyardmarriage proposalgunshotgraveprologueumbrelladebtchristmas treelightningfarmerpursuitdeath of husbandfeminismchickensleepingcowpoemapplauseloyaltydesirescene during opening creditsjail cellsergeantservantsheepladdercrying manpromisewindthunderministerdrummerthunderstormchristmas evepridevoice over lettercliffhousekeeperlanternpipe smokingengagement ringhorseback ridingpiano playervictorian eranarrated by characterwomen's rightsjewelrykilling a doglast will and testamentfencestaircasepocket watchfall from heightgiving a toastwagerdisappointmentmilitary uniformobsessive lovekindnessrespectbritish soldierscarfnervousnesspitchforkhymnbegginghorse and wagonshepherdbow tiescythetrespassingsecret lovecrime of passionharvestunwed pregnancymiddle aged manlambfalling off a clifffired from a jobhaybrandydead babylooking in a windowblowing a kissmilking a cowfirefightingpitypineapplegeesecheeringfiddlergrainwaving goodbyeshooting a dogsabrebailiffhaystacksuicide of husbandleft at the altartwo on a horserejecting a marriage proposalsheepdogreflection in mirrorfernreversal of fortuneblack bearhorse drawn hearseplaying with a dogthought deadvalentine's cardworkhousecloversplashing water on someonefarmhandasking for moneyfelling a treesharpening a knifebarn on firesheep farmerthree men in love with the same woman (See All)

Inspector Gadget (1999) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Inspector Gadget (1999)

A remake of the television series, Matthew Broderick stars as Gadget, who suffers an accident at the beginning of the film, and befriends Brenda, a robotic surgeon who repairs Gadget so that he can defeat the villain Claw. In the meantime, Gadget and Brenda fall in love.

Subgenre:
cult filmmartial artssuperheroslapstickslapstick comedy
Themes:
murderkidnappingherosurveillance
Mood:
car chasebreaking the fourth wall
Locations:
hospitalhelicopterwonder car
Characters:
villainpolicegirltough guysecurity guarduncle niece relationshipbabe scientist
Story:
disembodied headbutlerspiderevil mantitle spoken by characterdogcharacter name in titleviolencedancingexplosionpartychasemachine gunremakerescue β€¦camerashootingshowdowncar crashrobotscientistgood versus evilfoot chasebridgeexploding carcigar smokingtrainingduellimousinebased on tv seriesfantasy sequenceactor playing multiple rolesproduct placementstatuetough girlscene during end creditsconvertibleblindfoldlove interestnewspaper headlinenerdblockbusterjumping from heightback from the deadandroiddamsel in distressinventorsuper villaintitle appears in writingjumping through a windowparachutegadgetpolice inspectorflamethrowerlaser gunrocketactress playing multiple rolescartoon on tvjunkyardworld dominationamputeefilm camerabased on cartoonmegaphoneclawcrime fighterinspectorballroomfedoraphysical comedygadget carmicrochipcomic herocomic violencebowling ballaudio flashbackmanic laughterlarge format cameratoothpasteevil businessmandodge vipertalking carsmart carrobocopgirl dog relationshipigorprison escapeebumbling heroanimal licking someone (See All)

Stardust (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Stardust (2007)

The passage from this world to the fantasy kingdom of Stormhold is through a breach in a wall beside an English village. In the 1800s, a boy becomes a man when he ventures through the breach in pursuit of a fallen star, to prove his love for the village beauty. The star is no lump of rock, it's a ma β€¦iden, Yvaine. Tristan, the youth, is not the only one looking for her: three witches, led by Lamia, want her heart to make them young; and, the sons of the dead king of Stormhold want her because she holds a ruby that will give one of them title to the throne. Assisting Tristan are his mother, the victim of a spell, and a cross-dressing pirate of the skies. Will Tristan win his true love? (Read More)

Subgenre:
cult filmcoming of ageepicswashbucklersword and fantasy
Themes:
ghostsurrealismmurderdeathlovekidnappingbetrayalescapemagicunrequited lovehopedyingcourage
Locations:
beachforestsnowbathtubvillagestorm
Characters:
friendteenage boybabywitchyounger version of characterevil witch
Period:
1870s1850s
Story:
meat cleaverfencinggothiccandleswordfiretitle spoken by characterf ratedbased on novelviolenceone word titleflashbackkissdancingexplosion β€¦chasevoice over narrationfoodhorsemirrorblonderescuefalling from heightletterrunningbirthdayscientistgood versus evilsword fightdeath of friendeatingno opening creditsbirdcoffinbathunderwater scenekingprincesstransformationconfessionattempted murderargumentprologuerace against timelightningdeath of brotherdeath of sontied upflowersleepingcross dressingqueenmoonprincepirateballooncageelephantmousewitchcrafthonorslavetelescopethundermisunderstandingensemble castinsultlightstick fightmannequinhappy endinginvisibilitydead animaltowerblonde womancrownbroken mirrorcheeseimplied sexlong brown hairstaffcupwaltzstickcrossroadsliverblue blooddeath of kingtied togetherpushed off a cliffintestinemusic score features choirevil princesilver dress (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Glory (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Glory (1989)

Shaw was an officer in the Federal Army during the American Civil War who volunteered to lead the first company of black soldiers. Shaw was forced to deal with the prejudices of both the enemy (who had orders to kill commanding officers of blacks), and of his own fellow officers.

Subgenre:
epic
Themes:
angerdeathfriendshiptortureheromilitaryracismcorruptionhumiliationfreedomprejudice
Mood:
goreaffectiontearjerker
Locations:
beachnew england
Characters:
african americanfriendsoldierchildhood friendmilitary officerself esteemamerican soldier
Period:
19th century1860s
Story:
stutteringmuskethatredhateswordcorpsebloodviolenceone word titlebare chested malepistolbased on true storybased on bookshot to deathblood splatter β€¦shot in the chestbattleletterhand to hand combatrevolvercombatshot in the backsword fightstabbingarmyshot in the legracial slurstabbed in the backattackuniformtentshot in the armgeneralwhippingsacrificeblack americancivil warwhat happened to epiloguefriendship between menrace relationsslaveryrageloss of friendmale bondinghonorcolonelinterracial friendshipcannonbarefoottarget practicebraverywhipboston massachusettsshot in the facesculptureexploding headpridedead manracistpatriotismmain character diesheroismintimidationhead blown offwar herowar violencecorporal punishmentgovernorfortressbayonetwrathracial prejudicemilitary uniformamerican civil warn wordfinal battlemassachusettsfamous scoreorchestral music scoreracial tensioninfantrymass gravecavalryfloggingfortleg woundflintlock riflesouth carolinaafrican american protagoniststabbed with a swordblack historyu.s. civil warstabbed with a bayonetmute childracist insultcavalry chargechildren's choirhandwritingblack boyblack white relationsconfederacyabusive bossracial intolerancesymphonic music scoreafrican americansarmy trainingunionistblack soldiermusic score features choirblack american soldierbreakthrough herobased on lettersslave state (See All)

Dark Shadows (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dark Shadows (2012)

In the year 1752, Joshua and Naomi Collins, with young son Barnabas, set sail from Liverpool, England to start a new life in America. But even an ocean was not enough to escape the mysterious curse that has plagued their family. Two decades pass and Barnabas (Johnny Depp) has the world at his feet-o β€¦r at least the town of Collinsport, Maine. The master of Collinwood Manor, Barnabas is rich, powerful and an inveterate playboy...until he makes the grave mistake of breaking the heart of Angelique Bouchard (Eva Green). A witch, in every sense of the word, Angelique dooms him to a fate worse than death: turning him into a vampire, and then burying him alive. Two centuries later, Barnabas is inadvertently freed from his tomb and emerges into the very changed world of 1972. He returns to Collinwood Manor to find that his once-grand estate has fallen into ruin. The dysfunctional remnants of the Collins family have fared little better, each harboring their own dark secrets. Matriarch Elizabeth Collins Stoddard (Michelle Pfeiffer) has called upon live-in psychiatrist, Dr. Julia Hoffman (Helena Bonham Carter), to help with her family troubles. (Read More)

Subgenre:
gothic horrorblack comedydark comedyfish out of watervampire comedy
Themes:
jealousyghostsurrealismrevengesuicidedrunkennessmagicsupernatural powertime traveldysfunctional familyunrequited lovealcoholismmadness
Mood:
spoofnightmare
Locations:
woodsbarcemeterysmall townshipcastlecampfiresinging in a carfire truckabandoned factoryfishing village
Characters:
family relationshipsfather son relationshippoliceteenagermother daughter relationshipsingerpolice officerpolicemanvampirepsychiatristwitcholder man younger woman relationshipfishermanship captaingo go girl
Period:
1970s20th century18th centuryyear 1972
Story:
gothicundeadpaintingswordcorpsefiretitle spoken by characterbloodflashbacktwo word titlepartyvoice over narrationshotgunfalling from height β€¦shootingshowdownsunglassesgood versus evilorphanold manmassacreambulancemansionmontagedinerrock bandno opening creditscoffinfishingunderwater scenefemme fatalepantyhoseold womangunshotcursebased on tv seriesfactoryumbrellamanipulationreference to william shakespearestrong female characterwerewolfactor playing himselfsabotagefireplacediscowarehousetape recorderred dresstreasureexploding buildingwitchcrafttherapistservantmobrailway stationstrong female leadmind controlblack humortorchhitchhikingmental institutionsexual desirecamera shot of feetcrime scenepump action shotgunconstruction sitecynicismblood on faceintriguehippiedark humorimmortalityhypnosisheartclifffemale doctorcanered pantiesbarefoot femalepassionate kisschainbrushing teethblack magicfamily secretimprisonmentfemale stockinged feetmarijuana jointcartoon on tvburied alivelost lovemasturbation referencehanging upside downpsychedelicfoot closeuppocket watchstrait jacketfamily businesschandelierpunsexual frustrationevil womanmanipulative behaviorbechdel test passedreference to shakespeare's romeo and julietimmortalseductive behaviorvampirismmainefemale bosslack of moneysecret passagehouse fireold housefeet on tablechainsmagic spellgas explosionpointing a gun at someonesecret roomestranged fathersailing shipseductive womanfemale antagonistfemale to male footsie playingplaying footsieangry mobselfish womanfalling off a cliffmanorrenovationblood drinkinghidden roomlearning the truthdrinking bloodbossy womanmirror ballpassenger trainpretending to be someone elsepsychological manipulationelectroshock therapyexhumationgovernessmanipulative womanblood transfusionsecret passagewaygrand pianoforced suicidetriceratopsfemale psychiatristactor playing dual rolesmoking after sexdisco balltaking off underwearvolkswagen busliverpool englandestranged daughterlava lampbuilding explosionfemale stockinged solesreference to mcdonald's restaurantfemale werewolfactress playing dual rolesplashed with waterred lingeriefactory ownergender confusiongold watchpumpkin patch1770sbare feet on tableteen bedroomspurned womanfalling chandeliermephistophelesfisherybank check1760sbackhoebolt cutterwaffle1750swicked witchpatterned pantyhoseeighteenth centurymale stockinged feetbelief in ghostsreference to alice coopertransfusionred pantyhosetroll dollstar cameochanging one's namecannerycynical womandumping dead bodyfemale seductionimmortal manyear 1776 (See All)

Queen Of The Damned (2002) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Queen Of The Damned (2002)

After many years of sleeping in his coffin, the vampire Lestat awakens only to find that the world has changed and he wants to be a part of it. He gathers a following and becomes a rock star only to find that his music awakens the ancient Queen Akasha and she wants him to become her king...

Subgenre:
music videomartial artssupernatural
Themes:
revengemurderdeathlonelinesssupernatural power
Mood:
night
Locations:
cemeterylos angeles californianightclublondon englandairportengland
Characters:
singervampirekillermother
Story:
living deadgothicundeadskeletonevil manpaintingfirebased on novelbloodsequelflashbackvoice over narrationdreamblood splatterwatching tv β€¦hand to hand combatislanddecapitationconcertcaliforniathroat slittingrock bandsevered headfemme fataleperson on firestatuediaryrock 'n' rollneck breakingmurdererqueenburned alivefamemagazinemediapress conferencesadomasochismviolinrock starreverse footagerock concertnew orleans louisianaimmortalityhomoeroticismkilling spreeburned to deathtelekinesisviolinistgothreference to elvis presleylevitationsecret societyfemale vampireredheaded womanpredatorhollywood signbitten in the necktitle in titleevil womanpart computer animationfatal attractionbloodshedvampirismhomosexual subtextgroupieheart in handcryptfetishismblood drinkingsecret organizationegyptiansecret passagewayslide projectorbloody mouthmediterraneanturned to stonemisanthropestardomstar died before releasefanshuman preycold blooded murdercovenvampire human loveevil queenparanormal investigatorpreymisanthropygingercold blooded killerspeciesismdeath valleyinhumanity1780sspeciesmojave desertspontaneous combustioninterspecies romanceblood drainingpredator turns victimrolling stone magazinehunting peoplerose petalevil versus evilsuperiority complexepiscopaliankiller vs killersupremacyreading magazinepredator chases prey (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Nosferatu (1922)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Nosferatu (1922)

Wisbourg, Germany based estate agent Knock dispatches his associate, Hutter, to Count Orlok's castle in Transylvania as the Count wants to purchase an isolated house in Wisbourg. They plan on selling him the one across the way from Hutter's own home. Hutter leaves his innocent wife, Ellen, with some β€¦ friends while he is away. Hutter's trek is an unusual one, with many locals not wanting to take him near the castle where strange events have been occurring. Once at the castle, Hutter does manage to sell the Count the house, but he also notices and feels unusual occurrences, primarily feeling like there is a dark shadow hanging over him, even in the daytime when the Count is unusually asleep. Hutter eventually sees the Count's sleeping chamber in a crypt, and based on a book he has recently read, believes the Count is really a vampire or Nosferatu. While Hutter is trapped in the castle, the Count, hiding in a shipment of coffins, makes his way to Wisbourg, causing death along his way, which most attribute to the plague. Hutter himself tries to rush home to save his town and most importantly save Ellen from Nosferatu's imminent arrival. In Wisbourg, Ellen can feel the impending darkness as Nosferatu gets closer. But she learns that a sinless woman can sacrifice herself to kill the vampire. Will Hutter be able to save Ellen either from Nosferatu and/or her self-sacrifice? (Read More)

Subgenre:
gothic horrordark fantasysupernaturalsilent filmmonster moviesilent movie
Themes:
surrealismdeathfearescapemagicobsessionsupernatural powergreedpanicself sacrificemadness
Locations:
woodsbeachforestsmall townseashipcastlegermanyghost ship
Characters:
husband wife relationshipdoctornursevampirelustprofessorterror
Period:
19th century1830s
Story:
horse and carriagespidergothicundeadcandlecorpsebloodphotographchasebased on bookletterrivergood versus evilaxemountain β€¦bridgemapcoffinlegendcountrysideisolationrattied upwerewolfropedestinyfireplacefaintingloss of loved oneloss of wifeburialwoman in jeopardywhipdrummerrowboatsuperstitionblack and whitesailorasylumbatreal estate agentpeasantdraculafountainromaniatowerfreakabandoned housereal estaterafthospital roomcottageflyhusbandnewspaper articlepredatorsunrisedocumenthammockroosterinnshapeshiftingwriting a letterpsychotronic filmabandoned warehouseghoulpet catlocketsleepwalkingstreamsailing shipexpressionismangry mobwebbedriddenstagecoachremotetransylvaniamaster servant relationshipcountnew neighborseashorephantomhorror iconfiendsea captaindeliriumhorror movie remadecroquettravellerhorsebackhyenavampire batgerman expressionismstop motion scenegypsiesbite markcoded messagesea voyagenative dressbook of the deadmass hysteriaburial at seabuying a housenosferatublack deathescaping out a windowreflection in mirrorschoonerdunesquill pencreepy neighborbremen germanyday for nightvenus flytrappointy earsdeath by sunrisesitting on a roofsleeping in a coffinworried wife (See All)

The Addams Family (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Addams Family (1991)

The Addams step out of 'Charles Addams' (qv)' cartoons. They live with all of the trappings of the macabre (including a detached hand for a servant) and are quite wealthy. Added to this mix is a crooked accountant and his loan shark and a plot to slip in the shark's son into the family as their long β€¦ lost Uncle Fester. Can the false Fester find his way into the vault before he is discovered? (Read More)

Subgenre:
black comedycult filmfish out of water
Themes:
angerchristmaspregnancytorturedysfunctional familygreedamnesiainheritance
Locations:
cemetery
Characters:
family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshiplawyerlust for money
Period:
1990s
Story:
reunited familydisembodied handfencingbutlercharacter name in titlesequelsurprise endingrescuehalloweensword fightbased on comic bookmansioncigar smokingbased on tv seriesthreat β€¦brotherfirst partstrong female characterchainsawoccultlifting someone into the airdysfunctional marriagefraudblockbustereccentricscamcrossbowimpostorpassionate kissshaved headunclegothaccountantfreaktween girlloan sharkmacabrereference to shakespeare's hamletopposites attractknittingtrapdoorschool playbased on comic striphunchbackstrong manconcreepylifting a female into the airsiamese twinsfake bloodtrailer narrated by percy rodriguezwatching someone sleepfake doctorfamily lovelong lost brotherquirkysleeping womanreboot of seriesreference to george h.w. bushweirdescapadebased on adaptationreal tv show shown in fictional situationreference to nerotalladdams familypreteenage daughtertreasuryuncle festerloving family (See All)

Highlander (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Highlander (1986)

In New York, the owner of a sophisticated antique shop Russell Edwin Nash is challenged to a sword fight in the parking lot of the Madison Square Garden by a man called Iman Fasil that is beheaded by Russell. He hides his sword and is arrested by the police while leaving the stadium. Russell recalls β€¦ his life in the Sixteenth Century in Scotland, when he is Connor MacLeod and is deadly wounded in a battle against another Clan. However he surprisingly survives and his Clan believes he has a pact with the devil and expels him from their lands. Then he meets Juan Sanchez Villa-Lobos Ramirez that explains that he is immortal unless he is beheaded. Further, the immortals dispute a game killing each other and in the end only one survives receiving a price with the power of the other immortals. Russell is released by the police, but the snoopy forensic agent Brenda J. Wyatt is attracted by the case since she founds fragments of an ancient Katana and follows Russell. But the also immortal Kurgan is hunting down MacLeod and Brenda is in the middle of their battle. (Read More)

Subgenre:
dark fantasycult filmmartial artsdark comedysword and sorcerysword and fantasy
Themes:
murderdeathlovefriendshipkidnappingrapetortureheroinvestigationmagicmemorysupernatural powerwrestling
Mood:
gorerain
Locations:
woodschurchhospitalnew york citybarbeachforesthotelhelicoptersnowboatvillagepolice stationpolice carlake β€¦castleamerica (See All)
Characters:
policeboyfriend girlfriend relationshipprostitutepolice officerdetectivephotographertough guywarrioraction herolittle girlpolice detectiveteacher student relationshipgermanamerican β€¦police arrest (See All)
Period:
world war two1980s1940s16th century1500s
Story:
fencinggothicevil mancandlepaintingswordcorpsetitle spoken by charactersexnuditybloodviolenceone word titleflashbackkiss β€¦photographsingingcryingbeatingfistfightmachine gunhorseblondepunched in the facewatching tvcomputercamerabattlebrawlmaskshootingshowdownheld at gunpointtearsrunningrock musicinterrogationhandcuffsrevolvermanhattan new york citycombatreporterdecapitationgood versus evilgay slurflashlightsword fightstabbingbridgearmymixed martial artsweaponfishnunanimaldisarming someoneone man armypart of seriesfictional warbartendertrainingduelelectrocutionbuxomlightningtankopening action scenescreamfirst partkissing while having sexpubnewspaper headlinebattlefieldpoweruzientertainmentdestructionwoundtape recordercomic bookhelmetloss of loved onebuttockstimeaudienceknightparking garagehonorpromiseshieldthunderkatana swordold agescotlandzoopsychotronicimmortalityrowboatmentoraquariumdark herolionsuperstitionevidencetribesword dueltragic herobonfirereckless drivingdaggerwrestlershaved headrefereeparking lotshowpetenergyswordsmansunsethistorical fictionkatanaalleykendotelling someone to shut upfortresslatinarenakindnesspressaudio cassettemonitorsword fightinghead cut offdocumentmicroscopefemale coprepeated lineboxing ringimmortaladopted daughterantiquehorse and wagoniconbagpipesvalleymortalitychrysler building manhattan new york citymentor protege relationshipex marinescottishflintlock pistolsexual intercoursebanishmentbattle axewrestling matchmetropolisspectatorforceannouncerkiltprocessionwrestling ringrudenessbannerpracticeclanover the topgeeseelknewsstandalley fighthorsebackreference to mozartrapierhorseshoesiren the alarmlong swordhighlandscitadeloxenhighlandercar collisionstone bridge1530scentury1540s (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Rebecca (1940) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rebecca (1940)

A shy ladies' companion, staying in Monte Carlo with her stuffy employer, meets the wealthy Maxim de Winter. She and Max fall in love, marry and return to Manderley, his large country estate in Cornwall. Max is still troubled by the death of his first wife, Rebecca, in a boating accident the year be β€¦fore. The second Mrs. de Winter clashes with the housekeeper, Mrs. Danvers, and discovers that Rebecca still has a strange hold on everyone at Manderley. (Read More)

Subgenre:
suspense
Themes:
jealousymurderdeathsuicidemarriageinfidelitybetrayalpregnancyinvestigationdeceptionextramarital affairobsessionblackmailcancerunrequited love β€¦crueltywealth (See All)
Mood:
rain
Locations:
hotelboatlondon englandelevatorvillagerural setting
Characters:
husband wife relationshipdoctorolder man younger woman relationshipcousin cousin relationshipdeath obsession
Story:
clumsinessbutlerbridegothicpaintingfiretitle spoken by characterdogcharacter name in titlebased on novelone word titleflashbackcigarette smokingvoice over narrationdream β€¦underwearfistfightmirrordead bodybritishmansionwomanmarriage proposaldrowningtransformationconfessionlimousinecostumewidowercabinclass differencespubarsonburned aliveaccidental deathservanthome movietennisfull moonwoman in jeopardyhaunted by the pastnicknamefogcliffnotedark pasthousekeeperfamily secretbarking dogshynessdirector cameoinsecurityschemephysicianstairwayestateshipwreckfilm projectorcostume partynarcissismupper classorchestral music scoreshrinelesbian subtextnewlywedenigmahomosexual subtexthouse firesocialiterevolving doorportrait paintingdevotionmaster servant relationshipopening narrationduplicityluxury hotelsouth of francetelephone boxmarriage ceremonynameless characterfigurinecornwallsource musicconstablementally disabledmonte carloboathousefamily honorgowninferiority complexknickerscostume ballinquestholiday resortiron gateleitmotifenigmaticcollapsing househidden characterspanielgothic romancecocker spanielfancy dress ballpaid companionsecret from wifesunken boatintrusiveness (See All)

Labyrinth (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Labyrinth (1986)

The teenager Sarah is forced by her father and her stepmother to babysit her baby brother Toby while they are outside home. Toby does not stop crying and Sarah wishes that her brother be taken by the Goblin King. Out of the blue, Toby stops crying and when Sarah looks for him in the cradle, she lear β€¦ns that he wish was granted and the Goblin King Jarethhas taken him to his castle in the Goblin City in the middle of a labyrinth. Sarah repents an asks Jareth to give Toby back; but the Goblin King tells that she has to rescue her brother before midnight, otherwise Toby will be turned into a goblin. Soon Sarah teams up with the coward goblin Hoggle, the beast Ludo and the knight Didymus and his dog Ambrosius in her journey. Will they rescue Toby in time? (Read More)

Subgenre:
cult filmcoming of agesword and sorcerysteampunk
Themes:
angersurrealismfriendshipkidnappingbetrayalfearmonstermagicforgivenessmythology
Mood:
rain
Locations:
woodsforestcastlecavecampfirestorm
Characters:
father daughter relationshipfriendteenage girlgirlbabycrying baby
Period:
1980s
Story:
eyeballwormcandleswordfiretitle spoken by characterdogone word titledancingphotographsingingcryingsongdreammirror β€¦urinationrescueslow motion scenecatbattlemaskbooktearsrunningriversubjective cameragood versus evilsnakechild abusechildkingcreaturesearchjourneytransformationlegendcostumepuppetrace against timetentlightningbraceletringactor shares first name with charactertrapbrothertied upgardenchickensisterrockropeundergroundelectronic music scorequestbabysitterhelmetlifting someone into the aircaptivetoygiantladderknighttorchclockcannoncelebrationfull moonguardwindthunderbraveryfairypet dogstairslaughterlionlipstickarmorgrowing upwishfortune tellerowlweathermemory lossspelljewelrystrugglegatejunkyardmazeselfishnesswallstepmotherbeast16 year oldsorcererbellfantasy worldmetamorphosisfemale heromissingtrollgoblincowardsiblingriddletrapdoorcockney accentthe muppetsalice in wonderlandpitsnoringlabyrinthsittingcrotch shotbattle axecrystal ballwish fulfillmentmasqueradeperilmorphingbad smellclock towervirtual setlancelifting a male into the airpeachfantasy lifesentrymasked ballactor voicing multiple charactersgownmasquerade partycitadelbogtrumpeterdoor knockerfoot bridgebulgerevulsionescher stairwayactress voicing multiple charactersoubliettebaby cribpea shootertalking worm (See All)

Frankenweenie (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Frankenweenie (2012)

When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa β€¦rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)

Subgenre:
puppet animationstop motion animation
Themes:
deathfearmonstergrief
Mood:
rain
Locations:
swimming poolcemeterysmall townbicyclepolice carbaseballsewer
Characters:
husband wife relationshipfather son relationshipmother son relationshipteacherstudentbabylittle girllittle boymayor
Story:
horror for childrenspidercandlecorpsefiredogone word titlephotographexplosionsingingcryingrescuewatching tvcatsecret β€¦tearsrunningneighborclassroomscienceflashlightambulancecoffindrawinghit by a carcreaturesearchgravemicrophonesuburbumbrelladollbaseball batlightningscreamspeechratstagenewspaper headlinerecord playerexperimentapplauseballoonwatching a movielifelossphone boothfrogaudiencehome moviecarnivaltorchfull moonpromisethunderpet dog3 dimensionalshovelaquariumturtlechainuncleposterbatfiremantombenergyelectricitynotebookgategiant monsterfencepopcornelementary schoolgoldfishbellblackboardbaseball gamekitebased on short filmfrankensteinbackyardwindmillroller skatesgravestoneanguishpigtailsmovie cameradog moviebaseball fieldfairpet catslimearm slinghunchbackangry mobphonograph recordreanimationfairground3 dmovie projectorexhumationniececadaverloftbanneromenscience experimentspeakerclotheslineumpiregrave robbingscreenauditoriumbaseball gloveremake by original directorscience teacherschoolhousebaby strollerscience fairbaseball pitcherscience projectnerd boydeath of a petsurgical stitchesvacuum cleaningmanhole coverpet cemeteryfrench poodleback to lifefrankenstein spoofboltelectric kiss (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 3: Dream Warriors (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β€¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
stop motion animationcult filmindependent filmsupernaturalpsycho thrilleramerican horror
Themes:
ghostmurderdeathfuneralmonsterpsychopathsupernatural powerinsanitysadismevil
Mood:
gorenightmareslasher
Locations:
churchbarcemeteryschool boy
Characters:
villainfather daughter relationshipteenagermother daughter relationshipdoctorserial killernursetough guylittle girlsingle motherkillerterrorself mutilationslasher killeralcoholic father β€¦serial murdererevil nurse (See All)
Period:
1980s
Story:
scareddisembodied headundeadskeletonevil mancorpsefirefemale nuditynumber in titleviolencesequelbondagebare chested malecigarette smoking β€¦surprise endingdreamdigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperstabbingdeath of friendimpalementstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollisolationbasementmurderercharacter says i love youkillingsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countcharacters killed one by onekilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagewheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropeshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Nosferatu The Vampyre (1979) is one of the best movies like Corpse Bride (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Nosferatu The Vampyre (1979)

Jonathan Harker is sent away to Count Dracula's castle to sell him a house in Wismar where Jonathan lives. But Count Dracula is a vampire, an undead ghoul living off of men's blood. Inspired by a photograph of Lucy Harker, Jonathan's wife, Dracula moves to Wismar, bringing with him death and plague. β€¦.. An unusually contemplative version of Dracula, in which the vampire bears the curse of not being able to get old and die. (Read More)

Subgenre:
gothic horrorcult film
Themes:
surrealismdeathmarriagefearlonelinessdepressioninsanityillnessevilamnesiaself sacrifice
Mood:
nightmarehorror movie remake
Locations:
hospitalbeachcemeterysmall townvillageseashipcastlegermanytown
Characters:
husband wife relationshipdoctorvampirelustemployer employee relationship
Period:
19th century
Story:
horse and carriageundeadevil mancorpsebased on novelbloodknifesurprise endinghorsemirrorremakecatarrestfalling from heightbook β€¦beddead bodyvoyeurmansionwomanhousedinnernuncoffinforeign language adaptationjourneynecklacecursediarycrosshorse ridingpigratcaptaininjuryagenthammervisitsheepviolinclockwoman in jeopardygypsyimmortalitysuperstitionshadowexistentialismmelancholyviolinistbatcontractreflectionreal estate agentharbordraculaplaguereal estatemarried coupleinsane asylumkittensunrisefeverinnpsychotronic filmsleepwalkingescaped mental patientbitebaldnessfuneral processionblood drinkingtransylvaniadrinking bloodstakemaster servant relationshipbusiness tripnew neighborruinvampire biteriding a horsebaltic seanew german cinemacity councilblack seagerman expressionismestate agentgypsiespsychic linktown squarenosferatuwatching through a windowevil spellpallbearerpeststraitjacketlong fingernailssucking bloodmultiple language versionpointy earssigning a contractbiting someone's necksleeping in a coffin (See All)

The Little Mermaid (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Little Mermaid (1989)

In Disney's beguiling animated romp, rebellious 16-year-old mermaid Ariel is fascinated with life on land. On one of her visits to the surface, which are forbidden by her controlling father, King Triton, she falls for a human prince. Determined to be with her new love, Ariel makes a dangerous deal w β€¦ith the sea witch Ursula to become human for three days. But when plans go awry for the star-crossed lovers, the king must make the ultimate sacrifice for his daughter. (Read More)

Subgenre:
fairy tale2d animationfish out of waterdisneybased on fairy tale
Themes:
angersurrealismrevengelovefriendshipbetrayalfeardanceweddingmagicfalling in loveself sacrifice
Locations:
beachboatkitchenseashipcastleoceanstormcaribbeanstorm at seasea foodsea stormship firesea witch
Characters:
family relationshipsfather daughter relationshipteenagerteenage girlfemale protagonistmusicianpriestsister sister relationshipbest friendmaidwitchmermaidevil witchmysterious girllittle mermaid
Period:
19th century1830s
Story:
angry fathermeat cleaverbridefiretitle spoken by characterdognuditykissfightexplosionsingingknifethree word titlemirrorrescue β€¦battlebirthdaybedgood versus evilcookingconcertdisguisefishdinnerforeign language adaptationbathkingprincessdrowningtransformationdangerbased on short storymistaken identitystatuelightningexploding bodysadnessfirst partunderwaterfireworkssacrificeprincerockropepirateteen angstdestructiondressheroinetalking animalscene during opening creditslifting someone into the airroyaltywitchcraftvillainessblockbustergiantcheffrogsharkteenage protagonistanimal attackanthropomorphismtelescopeanthropomorphic animalmuterowboathypnosismusical numberspyingyoung loveturtlesailorduckkingdomwishsmokespellcontracthappy endingsidekicksunsetlaundrydockscene before opening creditsflutelegsseagull16 year olddolphinnude girlunconsciousnessbubble bathfemale heroswimming underwaterpipepotionfriends who live togetherfinal battlecrabstar crossed loversrainbowalter egooctopusexploding shiprescue from drowningsnailconductornakedbarrelwavemagic spellshark attackx rayed skeletoncanceled weddingwedding cakefat womancarriagehumanbirdsdefeatvoicedealcuriosityseal the animalforkpuppet showfalse namedanishstruck by lightningjamaicanharpoonblowing out candledisobeying orderslifting a female into the airfireflycollectinganchorcastle thunderclotheslinecinderella storysuper villainesslagoonseashellblue eyesjack in the boxmalletevil laughtershrimpsunken shiphans christian andersenseasicknessred eyesflamingolairfake namemaster of disguisestarfishpelicantridenttalking birdbird attacksea turtletrue identity revealedsailwolf whistlewhirlpoolgrottowhite hairmermanblowing smoke in someone's faceredheaded girltalking fishinterspecies romanceseafoodseahorsesinging animalbedtimeloss of voicedisney princessbluebirdpinching nosecombing someone's hairbitten on the buttflower in hairgiantessseashell bikinidisguised as humanmoray eelappearing from watercrow's nestlily padobjectanimal licking someonespiraling eyestalking crabwashing oneselfbroken teethfiery redheadwasher womanblowing a raspberryflattenedfrench chefold english sheepdogbecoming humandestroying a statuefish tailpolypundersea kingdom (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Corpse Bride?
<< FIND THEM HERE! >>